F328680

General Info

Members Datasets Scaffolds Average Seq Length
217 152 204 164

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000001|Ga0105251_10000001334
Length 186
Sequence MFTQSGSPGTISDFQATEELQVTQQEIRIDSYAPGDEQGIVELIVPIQREEFGIAITAQDQPDLLAIPSFYQTGTGDFWVARHDGVVIGSIALKDIGNGDAALRKMFVATAWRGREFGVARRLLECLIEAARARGVRRIFLGTTAKFLAAHRFYEKHGFTLVDQQELPPAFPLMVVDTRFYAIELG

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2516143018 Ensifer sp. BR816 Isolate Nodule
3 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
6 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
7 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
8 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
9 2855730933 Achromobacter sp. HZ28 Isolate Nodule
10 2855767633 Achromobacter sp. HZ34 Isolate Nodule
11 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
12 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
13 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
72 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
73 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
74 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
75 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
76 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
81 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 0
Isolates 5.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.12
Nodule 2.3
Rhizoplane 2.76
Rhizosphere 59.45
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000046 3300002774 Bacteria 78180
2 JGI25153J46596_10000099 3300003215 Bacteria 100036
3 rootH1_10031870 3300003316 Unclassified 2331
4 rootL2_10070832 3300003322 Unclassified 3220
5 rootL2_10075980 3300003322 Bacteria 3086
6 rootH1_10003203 3300003323 Bacteria 20511
7 rootH1_10057735 3300003323 Bacteria 4900
8 rootH1_10068431 3300003323 Bacteria 12390
9 Ga0055538_1000002 3300003751 Bacteria 999437
10 Ga0055539_1000002 3300003752 Bacteria 999437
11 Ga0055533_1000004 3300003756 Bacteria 999437
12 Ga0055525_1000002 3300003759 Bacteria 999437
13 Ga0055526_1003932 3300003771 Bacteria 9175
14 Ga0055526_1044272 3300003771 Bacteria 1076
15 Ga0055537_1007286 3300003773 Bacteria 2684
16 Ga0055536_1020372 3300003781 Bacteria 2049
17 Ga0055530_10008901 3300003791 Bacteria 3944
18 Ga0055540_1001420 3300003792 Bacteria 14268
19 Ga0055531_10037895 3300003794 Bacteria 1457
20 Ga0055531_10037902 3300003794 Bacteria 1457
21 Ga0055541_1000002 3300003841 Bacteria 896405
22 Ga0065165_1034061 3300005262 Bacteria 1579
23 Ga0070662_100366490 3300005457 Bacteria 1183
24 Ga0068867_100108491 3300005459 Unclassified 2129
25 Ga0070685_10091738 3300005466 Bacteria 1840
26 Ga0070698_101079126 3300005471 Bacteria 751
27 Ga0075436_100754825 3300006914 Bacteria 723
28 Ga0099794_10204498 3300007265 Bacteria 1012
29 Ga0105251_10000001 3300009011 Bacteria 466643
30 Ga0114129_10005536 3300009147 Bacteria 17864
31 Ga0105242_10440317 3300009176 Unclassified 1226
32 Ga0105237_10140284 3300009545 Bacteria 2411
33 Ga0157373_10084920 3300013100 Bacteria 2231
34 Ga0157375_12106353 3300013308 Bacteria 671
35 Ga0213872_10140187 3300021361 Bacteria 1061
36 Ga0209784_100002 3300025224 Bacteria 1753105
37 Ga0209566_100003 3300025225 Bacteria 1753105
38 Ga0209674_100004 3300025226 Bacteria 1753105
39 Ga0209563_100006 3300025230 Bacteria 1753105
40 Ga0207425_1000020 3300025245 Bacteria 372623
41 Ga0209677_100003 3300025253 Bacteria 1753105
42 Ga0209129_1003578 3300025258 Bacteria 6655
43 Ga0209565_1000151 3300025263 Bacteria 93781
44 Ga0209676_1009799 3300025292 Bacteria 4080
45 Ga0209676_1022183 3300025292 Bacteria 2109
46 Ga0209025_1000366 3300025294 Bacteria 95707
47 Ga0209564_1001216 3300025295 Bacteria 29241
48 Ga0209564_1004923 3300025295 Bacteria 7898
49 Ga0209758_1000004 3300025297 Bacteria 1375322
50 Ga0209050_1000001 3300025298 Bacteria 3563507
51 Ga0209050_1000585 3300025298 Bacteria 59049
52 Ga0209050_1014501 3300025298 Bacteria 3388
53 Ga0207426_1016748 3300025302 Bacteria 2621
54 Ga0209051_1000251 3300025303 Bacteria 90973
55 Ga0209257_1003746 3300025304 Bacteria 12588
56 Ga0209257_1007074 3300025304 Bacteria 6930
57 Ga0207713_1000929 3300025735 Bacteria 26289
58 Ga0207706_10409681 3300025933 Bacteria 1175
59 Ga0207669_10646575 3300025937 Bacteria 864
60 Ga0207667_10000032 3300025949 Bacteria 322253
61 Ga0207678_10352084 3300026067 Bacteria 1270
62 Ga0207648_10368734 3300026089 Bacteria 1297
63 Ga0265338_10006910 3300028800 Bacteria 14280
64 Ga0265338_10246847 3300028800 Bacteria 1319
65 Ga0265327_10000166 3300031251 Bacteria 141539
66 Ga0307509_10125244 3300031507 Bacteria 2537
67 Ga0307509_10187462 3300031507 Bacteria 1924
68 Ga0307516_10000006 3300031730 Bacteria 298586
69 Ga0307510_10251751 3300033180 Bacteria 1254
70 Ga0400484_37015 3300038725 Bacteria 1318
71 Ga0400490_39920 3300038726 Bacteria 7565
72 Ga0400491_27930 3300038727 Bacteria 6929
73 Ga0400485_19928 3300038735 Bacteria 8127
74 Ga0400488_61634 3300038741 Bacteria 3021
75 Ga0400486_12733 3300038742 Bacteria 4599
76 Ga0400489_45490 3300039093 Bacteria 1180
77 Ga0400489_50966 3300039093 Bacteria 2414
78 Ga0400487_36968 3300039110 Bacteria 4752
79 Ga0436361_1014091 3300039447 Bacteria 2391
80 Ga0436361_1203849 3300039447 Bacteria 3316
81 Ga0436361_1220721 3300039447 Bacteria 3975
82 Ga0451793_0603725 3300041452 Bacteria 1242
83 Ga0451800_0485307 3300041459 Bacteria 586
84 Ga0451802_1694308 3300041460 Bacteria 762
85 Ga0451849_0008738 3300041505 Bacteria 1652
86 Ga0439432_070982 3300042006 Bacteria 1062
87 Ga0439457_009554 3300042014 Unclassified 2254
88 Ga0451577_0316882 3300042876 Bacteria 1414
89 Ga0466972_0013820 3300044658 Bacteria 4052
90 Ga0466965_0002568 3300044683 Bacteria 7757
91 Ga0453684_0012340 3300044712 Bacteria 14130
92 Ga0466968_0004965 3300044735 Bacteria 4985
93 Ga0466957_0004302 3300044842 Bacteria 7904
94 Ga0466960_0001586 3300044901 Bacteria 8318
95 Ga0451576_0003312 3300045051 Bacteria 22336
96 Ga0495617_008362 3300046452 Bacteria 3570
97 Ga0495627_001012 3300046453 Bacteria 18873
98 Ga0495627_116983 3300046453 Bacteria 754
99 Ga0495590_0017619 3300046457 Bacteria 2568
100 Ga0495591_004020 3300046458 Bacteria 7358
101 Ga0495591_014999 3300046458 Bacteria 2755
102 Ga0495638_0095194 3300046460 Unclassified 1789
103 Ga0495650_0000293 3300046471 Bacteria 91661
104 Ga0495605_0001085 3300046474 Bacteria 18130
105 Ga0495605_0164178 3300046474 Bacteria 984
106 Ga0495584_0020884 3300046491 Bacteria 3324
107 Ga0495584_0066481 3300046491 Unclassified 1813
108 Ga0495585_0013188 3300046492 Bacteria 4842
109 Ga0495596_0000343 3300046500 Bacteria 30182
110 Ga0495596_0028857 3300046500 Bacteria 2225
111 Ga0495607_0000047 3300046501 Bacteria 121696
112 Ga0495607_0003448 3300046501 Bacteria 12109
113 Ga0495607_0016727 3300046501 Bacteria 4729
114 Ga0495583_0000850 3300046506 Bacteria 37186
115 Ga0495583_0005161 3300046506 Bacteria 8992
116 Ga0495606_0000171 3300046507 Bacteria 114960
117 Ga0495606_0004718 3300046507 Bacteria 13435
118 Ga0495606_0084212 3300046507 Bacteria 1970
119 Ga0495610_0005199 3300046512 Bacteria 9321
120 Ga0495610_0133719 3300046512 Bacteria 1074
121 Ga0495616_0005599 3300046513 Bacteria 7688
122 Ga0495616_0014463 3300046513 Bacteria 4416
123 Ga0495620_0012961 3300046515 Bacteria 4283
124 Ga0495631_0001156 3300046518 Bacteria 16332
125 Ga0495631_0001538 3300046518 Bacteria 13870
126 Ga0495631_0005030 3300046518 Bacteria 6960
127 Ga0495632_0025835 3300046519 Bacteria 3100
128 Ga0495632_0031177 3300046519 Unclassified 2759
129 Ga0495632_0036583 3300046519 Bacteria 2496
130 Ga0495632_0037258 3300046519 Bacteria 2468
131 Ga0495632_0285804 3300046519 Bacteria 733
132 Ga0495632_0292624 3300046519 Unclassified 723
133 Ga0495637_0000015 3300046520 Bacteria 228949
134 Ga0495637_0000063 3300046520 Bacteria 93270
135 Ga0495643_0008767 3300046522 Bacteria 6374
136 Ga0495644_0001679 3300046523 Bacteria 8986
137 Ga0495648_0000255 3300046524 Bacteria 60610
138 Ga0495648_0149946 3300046524 Bacteria 1217
139 Ga0495648_0150120 3300046524 Unclassified 1216
140 Ga0495654_0005130 3300046530 Bacteria 7650
141 Ga0495654_0007038 3300046530 Bacteria 6331
142 Ga0495654_0046560 3300046530 Bacteria 2135
143 Ga0495654_0072036 3300046530 Bacteria 1636
144 Ga0495609_0000107 3300046538 Bacteria 97734
145 Ga0495597_0163237 3300046542 Bacteria 908
146 Ga0495622_0114844 3300046557 Bacteria 1231
147 Ga0495668_0026723 3300046616 Bacteria 3273
148 Ga0495668_0036047 3300046616 Bacteria 2772
149 Ga0495668_0124590 3300046616 Unclassified 1410
150 Ga0495611_0001123 3300046648 Bacteria 14049
151 Ga0495611_0007017 3300046648 Bacteria 4787
152 Ga0495625_0000004 3300046660 Bacteria 611314
153 Ga0495625_0040390 3300046660 Bacteria 3403
154 Ga0495661_0000006 3300046665 Bacteria 427288
155 Ga0495661_0005342 3300046665 Bacteria 9131
156 Ga0495670_0222404 3300046691 Bacteria 1003
157 Ga0495671_0004843 3300046692 Bacteria 7956
158 Ga0495671_0011433 3300046692 Bacteria 4883
159 Ga0495671_0035191 3300046692 Bacteria 2544
160 Ga0495671_0046877 3300046692 Bacteria 2160
161 Ga0495671_0064284 3300046692 Bacteria 1806
162 Ga0495671_0103567 3300046692 Unclassified 1390
163 Ga0495649_0056943 3300046694 Bacteria 2108
164 Ga0495660_0018906 3300046810 Bacteria 3954
165 Ga0495660_0047566 3300046810 Bacteria 2348
166 Ga0495660_0139527 3300046810 Bacteria 1207
167 Ga0495672_0003542 3300047320 Bacteria 13296
168 Ga0495672_0009617 3300047320 Bacteria 6978
169 Ga0495676_0000004 3300047321 Bacteria 313696
170 Ga0495683_0028425 3300047323 Bacteria 2859
171 Ga0495679_000015 3300047446 Bacteria 287256
172 Ga0495679_031258 3300047446 Bacteria 1718
173 Ga0495673_0002281 3300047469 Bacteria 13753
174 Ga0495673_0002617 3300047469 Bacteria 12476
175 Ga0495673_0005928 3300047469 Bacteria 7284
176 Ga0495673_0006527 3300047469 Bacteria 6847
177 Ga0495681_0000164 3300047470 Bacteria 55469
178 Ga0495686_0008215 3300047472 Bacteria 7697
179 Ga0495686_0022296 3300047472 Bacteria 4192
180 Ga0495626_0000012 3300048091 Bacteria 258483
181 Ga0495626_0000403 3300048091 Bacteria 44195
182 Ga0496100_0170499 3300048903 Bacteria 1567
183 Ga0496103_0435711 3300048906 Bacteria 841
184 Ga0496116_0266538 3300048919 Bacteria 840
185 Ga0496121_0031372 3300048924 Bacteria 4856
186 Ga0496123_0231147 3300048926 Bacteria 925
187 Ga0495678_000043 3300049459 Bacteria 172593
188 Ga0495678_004285 3300049459 Bacteria 8324
189 Ga0495678_020265 3300049459 Bacteria 2949
190 Ga0495678_115062 3300049459 Bacteria 911
191 Ga0501257_008665 3300049686 Unclassified 2290
192 Ga0501225_0001687 3300049705 Bacteria 6902
193 nmdc:mga00v17_198053_c1 3300050491 Bacteria 1298
194 nmdc:mga05p37_4096_c1 3300050507 Bacteria 17035
195 Ga0500583_0000081 3300053092 Bacteria 55682
196 Ga0500583_0001039 3300053092 Bacteria 7923
197 Ga0500594_0062129 3300053118 Bacteria 1080
198 Ga0500642_0185866 3300053130 Unclassified 971
199 Ga0500642_0372054 3300053130 Bacteria 630
200 Ga0500658_0201631 3300053134 Bacteria 910
201 Ga0500586_216234 3300053145 Bacteria 620
202 Ga0500616_0072890 3300053153 Unclassified 1745
203 Ga0500622_0057213 3300053156 Bacteria 1995
204 Ga0500622_0066037 3300053156 Bacteria 1837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0231147 Ga0496123_0231147_446_886 146
2 3300041459 Ga0451800_0485307 Ga0451800_0485307_15_473 150
3 3300038725 Ga0400484_37015 Ga0400484_37015_234_701 152
4 iso_pu_bacteria 2511231026 2511387092 155
5 iso_pu_bacteria 2765235838 2765569651 155
6 iso_pu_bacteria 2839094727 2839097429 155
7 iso_pu_bacteria 2919046199 2919046972 155
8 iso_pu_bacteria 2928130867 2928131727 155
9 iso_pu_bacteria 2738541278 2738729931 156
10 iso_pu_bacteria 2600255283 2601624142 157
11 iso_pu_bacteria 2775507049 2776913059 157
12 3300005457 Ga0070662_100366490 Ga0070662_1003664902 158
13 3300005459 Ga0068867_100108491 Ga0068867_1001084913 158
14 3300013308 Ga0157375_12106353 Ga0157375_121063531 158
15 3300025933 Ga0207706_10409681 Ga0207706_104096812 158
16 3300025937 Ga0207669_10646575 Ga0207669_106465752 158
17 3300026089 Ga0207648_10368734 Ga0207648_103687342 158
18 3300031730 Ga0307516_10000006 Ga0307516_1000000636 158
19 3300042876 Ga0451577_0316882 Ga0451577_0316882_511_990 158
20 3300044712 Ga0453684_0012340 Ga0453684_0012340_3576_4055 158
21 3300045051 Ga0451576_0003312 Ga0451576_0003312_11626_12105 158
22 3300003322 rootL2_10075980 rootL2_100759804 159
23 3300003751 Ga0055538_1000002 Ga0055538_100000241 159
24 3300003752 Ga0055539_1000002 Ga0055539_100000241 159
25 3300003756 Ga0055533_1000004 Ga0055533_100000441 159
26 3300003759 Ga0055525_1000002 Ga0055525_100000241 159
27 3300003841 Ga0055541_1000002 Ga0055541_1000002799 159
28 3300009545 Ga0105237_10140284 Ga0105237_101402842 159
29 3300021361 Ga0213872_10140187 Ga0213872_101401871 159
30 3300025224 Ga0209784_100002 Ga0209784_100002280 159
31 3300025225 Ga0209566_100003 Ga0209566_100003280 159
32 3300025226 Ga0209674_100004 Ga0209674_100004280 159
33 3300025230 Ga0209563_100006 Ga0209563_100006280 159
34 3300025253 Ga0209677_100003 Ga0209677_100003280 159
35 3300025949 Ga0207667_10000032 Ga0207667_1000003290 159
36 3300031507 Ga0307509_10125244 Ga0307509_101252445 159
37 3300031507 Ga0307509_10187462 Ga0307509_101874622 159
38 3300039447 Ga0436361_1014091 Ga0436361_1014091_1763_2248 159
39 3300039447 Ga0436361_1203849 Ga0436361_1203849_2816_3301 159
40 3300039447 Ga0436361_1220721 Ga0436361_1220721_3475_3960 159
41 3300046457 Ga0495590_0017619 Ga0495590_0017619_1461_1949 159
42 3300046460 Ga0495638_0095194 Ga0495638_0095194_1019_1507 159
43 3300046491 Ga0495584_0066481 Ga0495584_0066481_1205_1693 159
44 3300046519 Ga0495632_0031177 Ga0495632_0031177_1019_1507 159
45 3300046616 Ga0495668_0124590 Ga0495668_0124590_582_1070 159
46 3300046660 Ga0495625_0040390 Ga0495625_0040390_1897_2385 159
47 3300048919 Ga0496116_0266538 Ga0496116_0266538_110_595 159
48 3300048924 Ga0496121_0031372 Ga0496121_0031372_1643_2128 159
49 3300050491 nmdc:mga00v17_198053_c1 nmdc:mga00v17_198053_c1_118_636 159
50 3300003316 rootH1_10031870 rootH1_100318702 160
51 3300003322 rootL2_10070832 rootL2_100708324 160
52 3300003323 rootH1_10003203 rootH1_1000320319 160
53 3300005471 Ga0070698_101079126 Ga0070698_1010791261 160
54 3300041452 Ga0451793_0603725 Ga0451793_0603725_545_1036 160
55 3300041460 Ga0451802_1694308 Ga0451802_1694308_166_651 160
56 3300041505 Ga0451849_0008738 Ga0451849_0008738_249_740 160
57 3300044842 Ga0466957_0004302 Ga0466957_0004302_7137_7637 160
58 3300049686 Ga0501257_008665 Ga0501257_008665_160_657 160
59 3300049705 Ga0501225_0001687 Ga0501225_0001687_5053_5547 160
60 3300053092 Ga0500583_0001039 Ga0500583_0001039_7162_7647 160
61 3300053118 Ga0500594_0062129 Ga0500594_0062129_46_537 160
62 3300053130 Ga0500642_0185866 Ga0500642_0185866_60_545 160
63 3300053130 Ga0500642_0372054 Ga0500642_0372054_22_516 160
64 3300053153 Ga0500616_0072890 Ga0500616_0072890_613_1107 160
65 3300053156 Ga0500622_0057213 Ga0500622_0057213_1431_1916 160
66 3300053156 Ga0500622_0066037 Ga0500622_0066037_949_1434 160
67 3300003323 rootH1_10057735 rootH1_100577352 161
68 3300003323 rootH1_10068431 rootH1_100684312 161
69 3300005466 Ga0070685_10091738 Ga0070685_100917382 161
70 3300006914 Ga0075436_100754825 Ga0075436_1007548252 161
71 3300007265 Ga0099794_10204498 Ga0099794_102044981 161
72 3300009011 Ga0105251_10000001 Ga0105251_10000001334 161
73 3300009147 Ga0114129_10005536 Ga0114129_1000553614 161
74 3300009176 Ga0105242_10440317 Ga0105242_104403172 161
75 3300013100 Ga0157373_10084920 Ga0157373_100849203 161
76 3300025735 Ga0207713_1000929 Ga0207713_100092910 161
77 3300026067 Ga0207678_10352084 Ga0207678_103520842 161
78 3300028800 Ga0265338_10006910 Ga0265338_1000691010 161
79 3300028800 Ga0265338_10246847 Ga0265338_102468472 161
80 3300031251 Ga0265327_10000166 Ga0265327_10000166131 161
81 3300033180 Ga0307510_10251751 Ga0307510_102517512 161
82 3300038726 Ga0400490_39920 Ga0400490_39920_5226_5735 161
83 3300038727 Ga0400491_27930 Ga0400491_27930_6162_6671 161
84 3300038735 Ga0400485_19928 Ga0400485_19928_2235_2732 161
85 3300038741 Ga0400488_61634 Ga0400488_61634_2461_2955 161
86 3300038742 Ga0400486_12733 Ga0400486_12733_3324_3821 161
87 3300039093 Ga0400489_45490 Ga0400489_45490_398_931 161
88 3300039093 Ga0400489_50966 Ga0400489_50966_1151_1648 161
89 3300039110 Ga0400487_36968 Ga0400487_36968_636_1133 161
90 3300042006 Ga0439432_070982 Ga0439432_070982_531_1043 161
91 3300042014 Ga0439457_009554 Ga0439457_009554_873_1373 161
92 3300044658 Ga0466972_0013820 Ga0466972_0013820_2856_3359 161
93 3300044683 Ga0466965_0002568 Ga0466965_0002568_4063_4566 161
94 3300044735 Ga0466968_0004965 Ga0466968_0004965_486_989 161
95 3300044901 Ga0466960_0001586 Ga0466960_0001586_3253_3756 161
96 3300046452 Ga0495617_008362 Ga0495617_008362_2838_3329 161
97 3300046453 Ga0495627_001012 Ga0495627_001012_4804_5295 161
98 3300046453 Ga0495627_116983 Ga0495627_116983_111_638 161
99 3300046458 Ga0495591_004020 Ga0495591_004020_3135_3623 161
100 3300046458 Ga0495591_014999 Ga0495591_014999_1525_2013 161
101 3300046471 Ga0495650_0000293 Ga0495650_0000293_75748_76236 161
102 3300046474 Ga0495605_0001085 Ga0495605_0001085_8209_8703 161
103 3300046474 Ga0495605_0164178 Ga0495605_0164178_237_725 161
104 3300046491 Ga0495584_0020884 Ga0495584_0020884_2600_3088 161
105 3300046492 Ga0495585_0013188 Ga0495585_0013188_1900_2388 161
106 3300046500 Ga0495596_0000343 Ga0495596_0000343_20657_21166 161
107 3300046500 Ga0495596_0028857 Ga0495596_0028857_664_1152 161
108 3300046501 Ga0495607_0000047 Ga0495607_0000047_82942_83430 161
109 3300046501 Ga0495607_0003448 Ga0495607_0003448_8516_9010 161
110 3300046501 Ga0495607_0016727 Ga0495607_0016727_4096_4617 161
111 3300046506 Ga0495583_0000850 Ga0495583_0000850_5342_5830 161
112 3300046506 Ga0495583_0005161 Ga0495583_0005161_6283_6771 161
113 3300046507 Ga0495606_0000171 Ga0495606_0000171_105447_105935 161
114 3300046507 Ga0495606_0004718 Ga0495606_0004718_3931_4425 161
115 3300046507 Ga0495606_0084212 Ga0495606_0084212_708_1217 161
116 3300046512 Ga0495610_0005199 Ga0495610_0005199_8108_8617 161
117 3300046512 Ga0495610_0133719 Ga0495610_0133719_237_725 161
118 3300046513 Ga0495616_0005599 Ga0495616_0005599_3314_3802 161
119 3300046513 Ga0495616_0014463 Ga0495616_0014463_1013_1501 161
120 3300046515 Ga0495620_0012961 Ga0495620_0012961_1193_1681 161
121 3300046518 Ga0495631_0001156 Ga0495631_0001156_10823_11314 161
122 3300046518 Ga0495631_0001538 Ga0495631_0001538_6981_7469 161
123 3300046518 Ga0495631_0005030 Ga0495631_0005030_4364_4852 161
124 3300046519 Ga0495632_0025835 Ga0495632_0025835_303_791 161
125 3300046519 Ga0495632_0036583 Ga0495632_0036583_774_1265 161
126 3300046519 Ga0495632_0037258 Ga0495632_0037258_1816_2304 161
127 3300046519 Ga0495632_0285804 Ga0495632_0285804_152_640 161
128 3300046519 Ga0495632_0292624 Ga0495632_0292624_160_651 161
129 3300046520 Ga0495637_0000015 Ga0495637_0000015_56617_57105 161
130 3300046520 Ga0495637_0000063 Ga0495637_0000063_57757_58284 161
131 3300046522 Ga0495643_0008767 Ga0495643_0008767_2356_2844 161
132 3300046523 Ga0495644_0001679 Ga0495644_0001679_4006_4494 161
133 3300046524 Ga0495648_0000255 Ga0495648_0000255_45490_45978 161
134 3300046524 Ga0495648_0149946 Ga0495648_0149946_334_822 161
135 3300046524 Ga0495648_0150120 Ga0495648_0150120_333_821 161
136 3300046530 Ga0495654_0005130 Ga0495654_0005130_2271_2762 161
137 3300046530 Ga0495654_0007038 Ga0495654_0007038_940_1428 161
138 3300046530 Ga0495654_0046560 Ga0495654_0046560_953_1468 161
139 3300046530 Ga0495654_0072036 Ga0495654_0072036_823_1311 161
140 3300046538 Ga0495609_0000107 Ga0495609_0000107_58963_59451 161
141 3300046542 Ga0495597_0163237 Ga0495597_0163237_143_631 161
142 3300046557 Ga0495622_0114844 Ga0495622_0114844_236_724 161
143 3300046616 Ga0495668_0026723 Ga0495668_0026723_1120_1608 161
144 3300046616 Ga0495668_0036047 Ga0495668_0036047_2141_2629 161
145 3300046648 Ga0495611_0001123 Ga0495611_0001123_11270_11758 161
146 3300046648 Ga0495611_0007017 Ga0495611_0007017_309_797 161
147 3300046660 Ga0495625_0000004 Ga0495625_0000004_403378_403866 161
148 3300046665 Ga0495661_0000006 Ga0495661_0000006_173753_174241 161
149 3300046665 Ga0495661_0005342 Ga0495661_0005342_1456_1944 161
150 3300046691 Ga0495670_0222404 Ga0495670_0222404_224_712 161
151 3300046692 Ga0495671_0004843 Ga0495671_0004843_4708_5196 161
152 3300046692 Ga0495671_0011433 Ga0495671_0011433_1603_2094 161
153 3300046692 Ga0495671_0035191 Ga0495671_0035191_848_1336 161
154 3300046692 Ga0495671_0046877 Ga0495671_0046877_478_966 161
155 3300046692 Ga0495671_0064284 Ga0495671_0064284_488_976 161
156 3300046692 Ga0495671_0103567 Ga0495671_0103567_544_1035 161
157 3300046694 Ga0495649_0056943 Ga0495649_0056943_483_971 161
158 3300046810 Ga0495660_0018906 Ga0495660_0018906_334_822 161
159 3300046810 Ga0495660_0047566 Ga0495660_0047566_690_1217 161
160 3300046810 Ga0495660_0139527 Ga0495660_0139527_341_829 161
161 3300047320 Ga0495672_0003542 Ga0495672_0003542_4454_4981 161
162 3300047320 Ga0495672_0009617 Ga0495672_0009617_3635_4126 161
163 3300047321 Ga0495676_0000004 Ga0495676_0000004_123155_123643 161
164 3300047323 Ga0495683_0028425 Ga0495683_0028425_2004_2492 161
165 3300047446 Ga0495679_000015 Ga0495679_000015_266508_266996 161
166 3300047446 Ga0495679_031258 Ga0495679_031258_279_767 161
167 3300047469 Ga0495673_0002281 Ga0495673_0002281_5546_6073 161
168 3300047469 Ga0495673_0002617 Ga0495673_0002617_5536_6063 161
169 3300047469 Ga0495673_0005928 Ga0495673_0005928_5946_6434 161
170 3300047469 Ga0495673_0006527 Ga0495673_0006527_1647_2135 161
171 3300047470 Ga0495681_0000164 Ga0495681_0000164_20057_20545 161
172 3300047472 Ga0495686_0008215 Ga0495686_0008215_6929_7417 161
173 3300047472 Ga0495686_0022296 Ga0495686_0022296_2747_3235 161
174 3300048091 Ga0495626_0000012 Ga0495626_0000012_94996_95484 161
175 3300048091 Ga0495626_0000403 Ga0495626_0000403_36776_37285 161
176 3300049459 Ga0495678_000043 Ga0495678_000043_35718_36245 161
177 3300049459 Ga0495678_004285 Ga0495678_004285_6857_7345 161
178 3300049459 Ga0495678_020265 Ga0495678_020265_1021_1509 161
179 3300049459 Ga0495678_115062 Ga0495678_115062_304_792 161
180 3300050507 nmdc:mga05p37_4096_c1 nmdc:mga05p37_4096_c1_15178_15675 161
181 3300053092 Ga0500583_0000081 Ga0500583_0000081_54833_55459 161
182 3300053134 Ga0500658_0201631 Ga0500658_0201631_162_890 161
183 3300053145 Ga0500586_216234 Ga0500586_216234_43_531 161
184 iso_pu_bacteria 2516143018 2516208642 161
185 iso_pu_bacteria 2791355094 2792638581 161
186 iso_pu_bacteria 2855730933 2855733134 161
187 iso_pu_bacteria 2855767633 2855771886 161
188 3300002774 JGI25150J39212_1000046 JGI25150J39212_100004680 162
189 3300003215 JGI25153J46596_10000099 JGI25153J46596_1000009947 162
190 3300003771 Ga0055526_1003932 Ga0055526_100393210 162
191 3300003771 Ga0055526_1044272 Ga0055526_10442723 162
192 3300003773 Ga0055537_1007286 Ga0055537_10072864 162
193 3300003781 Ga0055536_1020372 Ga0055536_10203722 162
194 3300003791 Ga0055530_10008901 Ga0055530_100089013 162
195 3300003792 Ga0055540_1001420 Ga0055540_10014204 162
196 3300003794 Ga0055531_10037895 Ga0055531_100378953 162
197 3300003794 Ga0055531_10037902 Ga0055531_100379023 162
198 3300005262 Ga0065165_1034061 Ga0065165_10340612 162
199 3300025245 Ga0207425_1000020 Ga0207425_1000020270 162
200 3300025258 Ga0209129_1003578 Ga0209129_10035783 162
201 3300025263 Ga0209565_1000151 Ga0209565_100015137 162
202 3300025292 Ga0209676_1009799 Ga0209676_10097992 162
203 3300025292 Ga0209676_1022183 Ga0209676_10221832 162
204 3300025294 Ga0209025_1000366 Ga0209025_100036661 162
205 3300025295 Ga0209564_1001216 Ga0209564_10012165 162
206 3300025295 Ga0209564_1004923 Ga0209564_10049231 162
207 3300025297 Ga0209758_1000004 Ga0209758_1000004534 162
208 3300025298 Ga0209050_1000001 Ga0209050_10000012493 162
209 3300025298 Ga0209050_1000585 Ga0209050_100058527 162
210 3300025298 Ga0209050_1014501 Ga0209050_10145013 162
211 3300025302 Ga0207426_1016748 Ga0207426_10167483 162
212 3300025303 Ga0209051_1000251 Ga0209051_10002512 162
213 3300025304 Ga0209257_1003746 Ga0209257_10037469 162
214 3300025304 Ga0209257_1007074 Ga0209257_10070742 162
215 3300048903 Ga0496100_0170499 Ga0496100_0170499_221_712 162
216 3300048906 Ga0496103_0435711 Ga0496103_0435711_82_570 162
217 iso_pu_bacteria 2881412998 2881415932 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

50

167

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

41

159

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

74

161

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.954 4 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9466 4 161
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9308 4 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9239 4 161
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9123 1 162
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9486 4 161 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9251 4 161 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8997 5 162 3.40.630.30
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8903 65 113 3.40.630.30
af_P39337_13_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8894 8 143 3.40.630.30
ID Description Score Start End GO Terms
AF-C2V1I4-F1-model_v4 deleted 0.9879 73 162
AF-C2MRZ2-F1-model_v4 deleted 0.9806 36 162
AF-A0A380KP53-F1-model_v4 GNAT family acetyltransferase 0.9802 62 161 GO:0008080
AF-C2S9T3-F1-model_v4 deleted 0.9789 43 162
AF-A0A1S1N3B5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9782 80 162 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map