F328582

General Info

Members Datasets Scaffolds Average Seq Length
217 136 434 182

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100428445|Ga0068860_1004284452
Length 193
Sequence MAVLIRLAAEGDAAAIESIYRRYVEGSRISFEEVAPDAAEMARRIRGDLPGFHPWFVAEEDGRILGYAASSRFRTRPAYRWTVETGIYLAEGAQGRGIGRELLSTLLAVLERQGYVAAIGAIALPNDSSIALHEKLGFFHTGTYRGVGFKMGEWLDVGLWQKDLAPRTATPAEPRPFCQLLGDPESNVEQIGC

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
109 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
136 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 2.3
Rhizosphere 95.39
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100428445 3300005843 Bacteria 1312
2 Ga0070658_10023015 3300005327 Bacteria 5002
3 Ga0070658_10267905 3300005327 Bacteria 1452
4 Ga0070658_10597378 3300005327 Bacteria 956
5 Ga0070690_100449490 3300005330 Bacteria 955
6 Ga0070670_100296214 3300005331 Bacteria 1414
7 Ga0070677_10046954 3300005333 Bacteria 1729
8 Ga0068869_100144897 3300005334 Bacteria 1837
9 Ga0070682_100406073 3300005337 Bacteria 1032
10 Ga0070660_100131139 3300005339 Bacteria 2006
11 Ga0070661_100125993 3300005344 Bacteria 1921
12 Ga0070692_10140896 3300005345 Bacteria 1365
13 Ga0070668_100077595 3300005347 Bacteria 2597
14 Ga0070671_100257553 3300005355 Bacteria 1483
15 Ga0070659_100021513 3300005366 Bacteria 4913
16 Ga0070659_100062562 3300005366 Bacteria 2942
17 Ga0070659_100235200 3300005366 Bacteria 1515
18 Ga0070667_100006585 3300005367 Bacteria 9659
19 Ga0070667_100011915 3300005367 Bacteria 7194
20 Ga0070667_100013020 3300005367 Bacteria 6877
21 Ga0070667_100052295 3300005367 Bacteria 3446
22 Ga0070694_100756229 3300005444 Bacteria 794
23 Ga0070663_100067572 3300005455 Bacteria 2593
24 Ga0070662_100114459 3300005457 Bacteria 2059
25 Ga0070681_10402036 3300005458 Bacteria 1281
26 Ga0070684_100027526 3300005535 Bacteria 4799
27 Ga0068853_100024140 3300005539 Bacteria 5096
28 Ga0068853_100192994 3300005539 Bacteria 1851
29 Ga0068853_100378189 3300005539 Bacteria 1322
30 Ga0070672_100466016 3300005543 Bacteria 1090
31 Ga0070686_100373595 3300005544 Bacteria 1077
32 Ga0070695_100090785 3300005545 Bacteria 2039
33 Ga0070696_100008089 3300005546 Bacteria 7028
34 Ga0070693_100189466 3300005547 Bacteria 1329
35 Ga0070664_100086336 3300005564 Bacteria 2711
36 Ga0068854_100158493 3300005578 Bacteria 1751
37 Ga0068854_100247178 3300005578 Bacteria 1423
38 Ga0068852_100080245 3300005616 Bacteria 2892
39 Ga0068859_100000144 3300005617 Bacteria 67220
40 Ga0068859_100020039 3300005617 Bacteria 6716
41 Ga0068859_100907914 3300005617 Bacteria 965
42 Ga0068864_100000092 3300005618 Bacteria 94499
43 Ga0068864_100007095 3300005618 Bacteria 9201
44 Ga0068866_10247954 3300005718 Bacteria 1088
45 Ga0068861_100083371 3300005719 Bacteria 2508
46 Ga0068851_10063848 3300005834 Bacteria 1891
47 Ga0068863_100000961 3300005841 Bacteria 28951
48 Ga0068863_100012981 3300005841 Bacteria 8033
49 Ga0068863_100030670 3300005841 Bacteria 5133
50 Ga0068863_100202321 3300005841 Bacteria 1911
51 Ga0068858_100000256 3300005842 Bacteria 56844
52 Ga0068858_100000332 3300005842 Bacteria 50007
53 Ga0068858_100475425 3300005842 Bacteria 1206
54 Ga0068860_100018286 3300005843 Bacteria 6821
55 Ga0068860_100098527 3300005843 Bacteria 2788
56 Ga0068862_100080955 3300005844 Bacteria 2817
57 Ga0075428_100304040 3300006844 Bacteria 1715
58 Ga0097620_100000144 3300006931 Bacteria 67220
59 Ga0097620_100020039 3300006931 Bacteria 6716
60 Ga0097620_100907900 3300006931 Bacteria 965
61 Ga0105250_10037805 3300009092 Bacteria 1937
62 Ga0111539_10129323 3300009094 Bacteria 2957
63 Ga0114129_11223125 3300009147 Bacteria 934
64 Ga0105243_11519008 3300009148 Bacteria 694
65 Ga0105248_10000426 3300009177 Bacteria 47826
66 Ga0105248_10062840 3300009177 Bacteria 4168
67 Ga0105248_10084108 3300009177 Bacteria 3579
68 Ga0105248_10176683 3300009177 Bacteria 2406
69 Ga0105249_10020107 3300009553 Bacteria 5965
70 Ga0157373_10110070 3300013100 Bacteria 1936
71 Ga0157371_10293773 3300013102 Bacteria 1175
72 Ga0157371_10296110 3300013102 Bacteria 1171
73 Ga0157370_10563318 3300013104 Unclassified 1044
74 Ga0157369_10014410 3300013105 Bacteria 8927
75 Ga0157378_11423749 3300013297 Bacteria 736
76 Ga0163162_10031019 3300013306 Bacteria 5299
77 Ga0163162_10034487 3300013306 Bacteria 5036
78 Ga0163162_10180306 3300013306 Bacteria 2238
79 Ga0163162_11063982 3300013306 Bacteria 916
80 Ga0157372_11053574 3300013307 Bacteria 941
81 Ga0157375_10281698 3300013308 Bacteria 1825
82 Ga0163163_10000080 3300014325 Bacteria 106006
83 Ga0157379_10050189 3300014968 Bacteria 3724
84 Ga0157379_10138763 3300014968 Bacteria 2191
85 Ga0163161_10294537 3300017792 Bacteria 1276
86 Ga0207697_10063772 3300025315 Bacteria 1536
87 Ga0207656_10073061 3300025321 Bacteria 1528
88 Ga0207696_1058702 3300025711 Bacteria 1085
89 Ga0207682_10046269 3300025893 Bacteria 1788
90 Ga0207642_10197073 3300025899 Bacteria 1110
91 Ga0207688_10062584 3300025901 Bacteria 2098
92 Ga0207705_10010603 3300025909 Bacteria 6697
93 Ga0207707_10798327 3300025912 Bacteria 786
94 Ga0207657_10243209 3300025919 Bacteria 1436
95 Ga0207657_10682559 3300025919 Bacteria 798
96 Ga0207649_10073425 3300025920 Bacteria 2191
97 Ga0207649_11026776 3300025920 Bacteria 649
98 Ga0207650_10018589 3300025925 Bacteria 4878
99 Ga0207644_10234449 3300025931 Bacteria 1459
100 Ga0207690_10022581 3300025932 Bacteria 3916
101 Ga0207690_10305473 3300025932 Bacteria 1246
102 Ga0207690_11038964 3300025932 Bacteria 682
103 Ga0207709_10366173 3300025935 Bacteria 1093
104 Ga0207691_10429866 3300025940 Bacteria 1125
105 Ga0207711_10000187 3300025941 Bacteria 66307
106 Ga0207711_10005888 3300025941 Bacteria 10351
107 Ga0207711_10029709 3300025941 Bacteria 4611
108 Ga0207689_10092345 3300025942 Bacteria 2486
109 Ga0207679_10236214 3300025945 Bacteria 1546
110 Ga0207679_10519196 3300025945 Bacteria 1065
111 Ga0207679_11046117 3300025945 Unclassified 749
112 Ga0207651_10449593 3300025960 Unclassified 1105
113 Ga0207651_10919252 3300025960 Unclassified 780
114 Ga0207651_11058360 3300025960 Bacteria 726
115 Ga0207712_10010974 3300025961 Bacteria 5765
116 Ga0207668_10060457 3300025972 Bacteria 2659
117 Ga0207668_10209278 3300025972 Bacteria 1559
118 Ga0207640_10131216 3300025981 Bacteria 1812
119 Ga0207640_10221975 3300025981 Bacteria 1447
120 Ga0207640_10647846 3300025981 Bacteria 900
121 Ga0207640_10688200 3300025981 Bacteria 875
122 Ga0207658_10001984 3300025986 Bacteria 15265
123 Ga0207658_10013838 3300025986 Bacteria 5520
124 Ga0207658_10042140 3300025986 Bacteria 3309
125 Ga0207658_10043563 3300025986 Bacteria 3263
126 Ga0207658_10047192 3300025986 Bacteria 3151
127 Ga0207658_10049772 3300025986 Bacteria 3080
128 Ga0207658_10150653 3300025986 Bacteria 1895
129 Ga0207658_10384042 3300025986 Bacteria 1230
130 Ga0207703_10001205 3300026035 Bacteria 24220
131 Ga0207703_10002564 3300026035 Bacteria 15695
132 Ga0207703_10367501 3300026035 Bacteria 1328
133 Ga0207639_10046814 3300026041 Bacteria 3265
134 Ga0207678_10006779 3300026067 Bacteria 10152
135 Ga0207641_10000175 3300026088 Bacteria 89110
136 Ga0207641_10011733 3300026088 Bacteria 7196
137 Ga0207641_10095787 3300026088 Bacteria 2606
138 Ga0207676_10000138 3300026095 Bacteria 63283
139 Ga0207676_10001264 3300026095 Bacteria 18812
140 Ga0207683_10338997 3300026121 Bacteria 1379
141 Ga0207698_10009614 3300026142 Bacteria 6174
142 Ga0207428_10234610 3300027907 Bacteria 1372
143 Ga0268266_10126604 3300028379 Bacteria 2281
144 Ga0268265_10007183 3300028380 Bacteria 7526
145 Ga0268265_10047202 3300028380 Bacteria 3225
146 Ga0268265_10050068 3300028380 Bacteria 3146
147 Ga0268264_10001379 3300028381 Bacteria 22755
148 Ga0268264_10265587 3300028381 Bacteria 1601
149 Ga0307408_100055145 3300031548 Bacteria 2876
150 Ga0307408_100653029 3300031548 Bacteria 941
151 Ga0307405_10004105 3300031731 Bacteria 6842
152 Ga0307413_10054154 3300031824 Bacteria 2433
153 Ga0307413_10189686 3300031824 Bacteria 1474
154 Ga0307410_10010241 3300031852 Bacteria 5300
155 Ga0307410_10118104 3300031852 Bacteria 1929
156 Ga0307410_10368592 3300031852 Bacteria 1152
157 Ga0307406_10113607 3300031901 Bacteria 1869
158 Ga0307406_11262958 3300031901 Bacteria 643
159 Ga0307407_10262037 3300031903 Bacteria 1189
160 Ga0307412_10001641 3300031911 Bacteria 12348
161 Ga0307412_10002813 3300031911 Bacteria 9660
162 Ga0307412_10041182 3300031911 Bacteria 2992
163 Ga0307412_10142994 3300031911 Bacteria 1755
164 Ga0307412_10464309 3300031911 Bacteria 1046
165 Ga0307409_100131379 3300031995 Bacteria 2140
166 Ga0307409_100145619 3300031995 Bacteria 2048
167 Ga0307409_100626293 3300031995 Bacteria 1066
168 Ga0307409_100640014 3300031995 Unclassified 1056
169 Ga0307416_100004177 3300032002 Bacteria 8654
170 Ga0307416_100915095 3300032002 Bacteria 978
171 Ga0307414_10123806 3300032004 Bacteria 1993
172 Ga0307414_10283553 3300032004 Bacteria 1393
173 Ga0307414_10424551 3300032004 Bacteria 1160
174 Ga0307411_10027376 3300032005 Bacteria 3448
175 Ga0307415_100033897 3300032126 Bacteria 3318
176 Ga0307415_100046081 3300032126 Bacteria 2927
177 Ga0307415_100151057 3300032126 Bacteria 1788
178 Ga0307510_10025870 3300033180 Bacteria 6761
179 Ga0395899_0050626 3300037312 Bacteria 3084
180 Ga0395899_0613522 3300037312 Bacteria 691
181 Ga0395900_0084170 3300037418 Bacteria 3268
182 Ga0395905_0302293 3300037471 Bacteria 1487
183 Ga0395905_0596625 3300037471 Bacteria 1006
184 Ga0395901_0000826 3300038443 Bacteria 34177
185 Ga0439461_0013069 3300041410 Bacteria 1562
186 Ga0450914_002325 3300042118 Bacteria 1343
187 Ga0450889_000125 3300042144 Bacteria 7591
188 Ga0439446_0112446 3300042156 Bacteria 870
189 Ga0439434_0033554 3300042435 Bacteria 1565
190 Ga0439464_0001270 3300042439 Bacteria 5864
191 Ga0439460_0105317 3300042461 Unclassified 910
192 Ga0466963_0116551 3300044694 Bacteria 1836
193 Ga0466967_1059614 3300045976 Bacteria 808
194 Ga0495629_0560787 3300046459 Bacteria 766
195 Ga0495583_0199518 3300046506 Bacteria 813
196 Ga0495648_0057846 3300046524 Bacteria 2322
197 Ga0495663_0060055 3300046525 Unclassified 1194
198 Ga0495668_0037430 3300046616 Bacteria 2714
199 Ga0495625_0029644 3300046660 Bacteria 4089
200 Ga0495669_0042725 3300046684 Bacteria 2016
201 Ga0495669_0054988 3300046684 Bacteria 1792
202 Ga0495669_0157867 3300046684 Bacteria 1076
203 Ga0495660_0339732 3300046810 Bacteria 670
204 Ga0496107_0143080 3300048910 Bacteria 1768
205 Ga0496107_0262052 3300048910 Bacteria 1286
206 Ga0496108_0015808 3300048911 Bacteria 6152
207 Ga0496110_0832006 3300048913 Bacteria 828
208 Ga0496116_0191707 3300048919 Bacteria 1081
209 Ga0501067_0018973 3300049583 Bacteria 3805
210 Ga0501068_0490040 3300049584 Bacteria 797
211 nmdc:mga05p37_1501596_c1 3300050507 Bacteria 671
212 nmdc:mga09592_463131_c1 3300050508 Unclassified 1093
213 nmdc:mga08y16_120848_c1 3300050511 Bacteria 2726
214 Ga0500643_005944 3300053087 Bacteria 5175
215 Ga0500658_0000023 3300053134 Bacteria 123176
216 2600203021 2599185354 Bacteria 4398675
217 2753767388 2751185897 Bacteria 5322941
218 Ga0068860_100428445
219 Ga0070658_10023015
220 Ga0070658_10267905
221 Ga0070658_10597378
222 Ga0070690_100449490
223 Ga0070670_100296214
224 Ga0070677_10046954
225 Ga0068869_100144897
226 Ga0070682_100406073
227 Ga0070660_100131139
228 Ga0070661_100125993
229 Ga0070692_10140896
230 Ga0070668_100077595
231 Ga0070671_100257553
232 Ga0070659_100021513
233 Ga0070659_100062562
234 Ga0070659_100235200
235 Ga0070667_100006585
236 Ga0070667_100011915
237 Ga0070667_100013020
238 Ga0070667_100052295
239 Ga0070694_100756229
240 Ga0070663_100067572
241 Ga0070662_100114459
242 Ga0070681_10402036
243 Ga0070684_100027526
244 Ga0068853_100024140
245 Ga0068853_100192994
246 Ga0068853_100378189
247 Ga0070672_100466016
248 Ga0070686_100373595
249 Ga0070695_100090785
250 Ga0070696_100008089
251 Ga0070693_100189466
252 Ga0070664_100086336
253 Ga0068854_100158493
254 Ga0068854_100247178
255 Ga0068852_100080245
256 Ga0068859_100000144
257 Ga0068859_100020039
258 Ga0068859_100907914
259 Ga0068864_100000092
260 Ga0068864_100007095
261 Ga0068866_10247954
262 Ga0068861_100083371
263 Ga0068851_10063848
264 Ga0068863_100000961
265 Ga0068863_100012981
266 Ga0068863_100030670
267 Ga0068863_100202321
268 Ga0068858_100000256
269 Ga0068858_100000332
270 Ga0068858_100475425
271 Ga0068860_100018286
272 Ga0068860_100098527
273 Ga0068862_100080955
274 Ga0075428_100304040
275 Ga0097620_100000144
276 Ga0097620_100020039
277 Ga0097620_100907900
278 Ga0105250_10037805
279 Ga0111539_10129323
280 Ga0114129_11223125
281 Ga0105243_11519008
282 Ga0105248_10000426
283 Ga0105248_10062840
284 Ga0105248_10084108
285 Ga0105248_10176683
286 Ga0105249_10020107
287 Ga0157373_10110070
288 Ga0157371_10293773
289 Ga0157371_10296110
290 Ga0157370_10563318
291 Ga0157369_10014410
292 Ga0157378_11423749
293 Ga0163162_10031019
294 Ga0163162_10034487
295 Ga0163162_10180306
296 Ga0163162_11063982
297 Ga0157372_11053574
298 Ga0157375_10281698
299 Ga0163163_10000080
300 Ga0157379_10050189
301 Ga0157379_10138763
302 Ga0163161_10294537
303 Ga0207697_10063772
304 Ga0207656_10073061
305 Ga0207696_1058702
306 Ga0207682_10046269
307 Ga0207642_10197073
308 Ga0207688_10062584
309 Ga0207705_10010603
310 Ga0207707_10798327
311 Ga0207657_10243209
312 Ga0207657_10682559
313 Ga0207649_10073425
314 Ga0207649_11026776
315 Ga0207650_10018589
316 Ga0207644_10234449
317 Ga0207690_10022581
318 Ga0207690_10305473
319 Ga0207690_11038964
320 Ga0207709_10366173
321 Ga0207691_10429866
322 Ga0207711_10000187
323 Ga0207711_10005888
324 Ga0207711_10029709
325 Ga0207689_10092345
326 Ga0207679_10236214
327 Ga0207679_10519196
328 Ga0207679_11046117
329 Ga0207651_10449593
330 Ga0207651_10919252
331 Ga0207651_11058360
332 Ga0207712_10010974
333 Ga0207668_10060457
334 Ga0207668_10209278
335 Ga0207640_10131216
336 Ga0207640_10221975
337 Ga0207640_10647846
338 Ga0207640_10688200
339 Ga0207658_10001984
340 Ga0207658_10013838
341 Ga0207658_10042140
342 Ga0207658_10043563
343 Ga0207658_10047192
344 Ga0207658_10049772
345 Ga0207658_10150653
346 Ga0207658_10384042
347 Ga0207703_10001205
348 Ga0207703_10002564
349 Ga0207703_10367501
350 Ga0207639_10046814
351 Ga0207678_10006779
352 Ga0207641_10000175
353 Ga0207641_10011733
354 Ga0207641_10095787
355 Ga0207676_10000138
356 Ga0207676_10001264
357 Ga0207683_10338997
358 Ga0207698_10009614
359 Ga0207428_10234610
360 Ga0268266_10126604
361 Ga0268265_10007183
362 Ga0268265_10047202
363 Ga0268265_10050068
364 Ga0268264_10001379
365 Ga0268264_10265587
366 Ga0307408_100055145
367 Ga0307408_100653029
368 Ga0307405_10004105
369 Ga0307413_10054154
370 Ga0307413_10189686
371 Ga0307410_10010241
372 Ga0307410_10118104
373 Ga0307410_10368592
374 Ga0307406_10113607
375 Ga0307406_11262958
376 Ga0307407_10262037
377 Ga0307412_10001641
378 Ga0307412_10002813
379 Ga0307412_10041182
380 Ga0307412_10142994
381 Ga0307412_10464309
382 Ga0307409_100131379
383 Ga0307409_100145619
384 Ga0307409_100626293
385 Ga0307409_100640014
386 Ga0307416_100004177
387 Ga0307416_100915095
388 Ga0307414_10123806
389 Ga0307414_10283553
390 Ga0307414_10424551
391 Ga0307411_10027376
392 Ga0307415_100033897
393 Ga0307415_100046081
394 Ga0307415_100151057
395 Ga0307510_10025870
396 Ga0395899_0050626
397 Ga0395899_0613522
398 Ga0395900_0084170
399 Ga0395905_0302293
400 Ga0395905_0596625
401 Ga0395901_0000826
402 Ga0439461_0013069
403 Ga0450914_002325
404 Ga0450889_000125
405 Ga0439446_0112446
406 Ga0439434_0033554
407 Ga0439464_0001270
408 Ga0439460_0105317
409 Ga0466963_0116551
410 Ga0466967_1059614
411 Ga0495629_0560787
412 Ga0495583_0199518
413 Ga0495648_0057846
414 Ga0495663_0060055
415 Ga0495668_0037430
416 Ga0495625_0029644
417 Ga0495669_0042725
418 Ga0495669_0054988
419 Ga0495669_0157867
420 Ga0495660_0339732
421 Ga0496107_0143080
422 Ga0496107_0262052
423 Ga0496108_0015808
424 Ga0496110_0832006
425 Ga0496116_0191707
426 Ga0501067_0018973
427 Ga0501068_0490040
428 nmdc:mga05p37_1501596_c1
429 nmdc:mga09592_463131_c1
430 nmdc:mga08y16_120848_c1
431 Ga0500643_005944
432 Ga0500658_0000023
433 2600203021
434 2753767388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

5

159

0.92

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

51

139

0.8

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

15

138

0.78

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

3

139

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.9504 10 186
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.9373 8 169
5jtf-assembly1.cif.gz_B crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440 0.9354 10 181
5t7d-assembly1.cif.gz_A crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a 0.9321 9 182
2jlm-assembly1.cif.gz_C structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 0.9308 10 173
ID Description Score Start End Superfamily
af_Q55BC6_2_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9439 10 169 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9408 9 180 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9399 122 169 3.40.630.30
2ge3B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9341 8 166 3.40.630.30
2jlmC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9308 10 173 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A354TZ90-F1-model_v4 deleted 0.9863 57 184
AF-A0A1Z9NBF2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9831 10 169 GO:0016747
AF-A0A7G5FDC9-F1-model_v4 N-acetyltransferase 0.9822 10 169 GO:0016747
AF-A0A1H8G0G4-F1-model_v4 Phosphinothricin acetyltransferase 0.9805 10 185 GO:0016747
AF-A0A843SG52-F1-model_v4 GNAT family N-acetyltransferase 0.9782 10 171 GO:0016747

Map