F328580

General Info

Members Datasets Scaffolds Average Seq Length
217 133 215 296

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100064991|Ga0068860_1000649912
Length 318
Sequence MVSGRLEGSEGFILMARFGRVLTAMVTPMHEDGSLNYDAIRQLARYLEAHGNDGLVVAGTTGESPVLTDDERLSLFAAVIEAVTIPVIAGTGTNDTPHSVQMTKEAAKLGAAGVLAVCPYYNRPSQAGLEGHFRAMAAASDLPVVLYDIPVRTGRKITTATMLKLFREVPNIVALKDAAGNPGETAALISSAPAGVDVYSGDDIMTLPLLASGAVGVIGVATHWAGEDCQQMLDLWGKGDTEGARLVNSRLLESFAFETGDDAPNPLPTKAMMRHLGIPVGQARLPMGDAPAFVDAQAPEVWANLQRWRDEFPLRPSL

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
62 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
67 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
71 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
72 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.22
Nodule 0
Rhizoplane 7.83
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10030069 3300003373 Bacteria 1408
2 Ga0070689_100043043 3300005340 Bacteria 3469
3 Ga0070674_100047724 3300005356 Bacteria 2936
4 Ga0070674_100062104 3300005356 Bacteria 2609
5 Ga0070662_100151851 3300005457 Bacteria 1804
6 Ga0070681_10035592 3300005458 Bacteria 5002
7 Ga0068867_100007821 3300005459 Bacteria 7560
8 Ga0070706_100022481 3300005467 Bacteria 5803
9 Ga0070697_100174375 3300005536 Bacteria 1821
10 Ga0070702_100012858 3300005615 Bacteria 4213
11 Ga0068866_10003083 3300005718 Bacteria 6870
12 Ga0068863_100306615 3300005841 Bacteria 1540
13 Ga0068860_100009570 3300005843 Bacteria 9628
14 Ga0068860_100064991 3300005843 Bacteria 3465
15 Ga0068860_100282256 3300005843 Bacteria 1623
16 Ga0081455_10000584 3300005937 Bacteria 47478
17 Ga0081538_10000498 3300005981 Bacteria 43866
18 Ga0081538_10004479 3300005981 Bacteria 12865
19 Ga0081538_10083073 3300005981 Bacteria 1695
20 Ga0075365_10093045 3300006038 Bacteria 2056
21 Ga0075363_100019279 3300006048 Bacteria 3409
22 Ga0075363_100231351 3300006048 Bacteria 1061
23 Ga0075364_10017669 3300006051 Bacteria 4460
24 Ga0075364_10030422 3300006051 Bacteria 3465
25 Ga0075364_10064614 3300006051 Bacteria 2402
26 Ga0070715_10020255 3300006163 Bacteria 2563
27 Ga0070716_100013324 3300006173 Bacteria 4189
28 Ga0075367_10029769 3300006178 Bacteria 3126
29 Ga0075367_10067498 3300006178 Bacteria 2144
30 Ga0075366_10187479 3300006195 Bacteria 1257
31 Ga0075433_10150460 3300006852 Bacteria 2070
32 Ga0075434_100033077 3300006871 Bacteria 5101
33 Ga0075434_100174883 3300006871 Bacteria 2167
34 Ga0075429_100007928 3300006880 Bacteria 9226
35 Ga0075429_100082048 3300006880 Bacteria 2811
36 Ga0075436_100018508 3300006914 Bacteria 4768
37 Ga0075435_100286857 3300007076 Bacteria 1406
38 Ga0099794_10002014 3300007265 Bacteria 7337
39 Ga0114129_10077745 3300009147 Bacteria 4616
40 Ga0114129_10148709 3300009147 Bacteria 3207
41 Ga0114129_10207669 3300009147 Bacteria 2649
42 Ga0105243_10006046 3300009148 Bacteria 9367
43 Ga0105243_10342118 3300009148 Bacteria 1371
44 Ga0105249_10323216 3300009553 Bacteria 1554
45 Ga0157378_10002124 3300013297 Bacteria 17635
46 Ga0157375_10666044 3300013308 Bacteria 1196
47 Ga0163163_10008461 3300014325 Bacteria 9141
48 Ga0157379_10070721 3300014968 Bacteria 3122
49 Ga0213876_10041175 3300021384 Bacteria 2441
50 Ga0207688_10101185 3300025901 Bacteria 1664
51 Ga0207685_10092779 3300025905 Bacteria 1275
52 Ga0207684_10015762 3300025910 Bacteria 6502
53 Ga0207707_10098363 3300025912 Bacteria 2558
54 Ga0207707_10173027 3300025912 Bacteria 1887
55 Ga0207706_10090041 3300025933 Bacteria 2698
56 Ga0207709_10351336 3300025935 Bacteria 1113
57 Ga0207669_10091447 3300025937 Bacteria 1982
58 Ga0207669_10102818 3300025937 Bacteria 1894
59 Ga0207665_10020044 3300025939 Bacteria 4392
60 Ga0207691_10106985 3300025940 Bacteria 2490
61 Ga0207661_10260425 3300025944 Bacteria 1545
62 Ga0207667_10284482 3300025949 Bacteria 1690
63 Ga0207712_10087805 3300025961 Bacteria 2281
64 Ga0207703_10150567 3300026035 Bacteria 2028
65 Ga0207648_10002677 3300026089 Bacteria 18952
66 Ga0207675_100066541 3300026118 Bacteria 3369
67 Ga0209588_1040259 3300027671 Bacteria 1508
68 Ga0268264_10010958 3300028381 Bacteria 7488
69 Ga0268264_10164489 3300028381 Bacteria 2002
70 Ga0265327_10005242 3300031251 Bacteria 10932
71 Ga0316575_10000433 3300031665 Bacteria 11941
72 Ga0316579_10000270 3300031691 Bacteria 15967
73 Ga0316576_10000958 3300031727 Bacteria 14800
74 Ga0316576_10004710 3300031727 Bacteria 8232
75 Ga0316576_10054361 3300031727 Bacteria 2920
76 Ga0316578_10000051 3300031728 Bacteria 24205
77 Ga0316578_10017503 3300031728 Bacteria 3901
78 Ga0316577_10001719 3300031733 Bacteria 10515
79 Ga0316577_10018003 3300031733 Bacteria 3905
80 Ga0316583_10008667 3300032133 Bacteria 3670
81 Ga0316585_10000581 3300032137 Bacteria 8933
82 Ga0316574_0001259 3300035398 Bacteria 11813
83 Ga0316574_0020072 3300035398 Bacteria 3951
84 Ga0316574_0092525 3300035398 Bacteria 1930
85 Ga0316574_0245517 3300035398 Bacteria 1144
86 Ga0316582_0001224 3300036647 Bacteria 11050
87 Ga0316582_0022315 3300036647 Bacteria 3756
88 Ga0316584_0000769 3300036712 Bacteria 17905
89 Ga0316584_0007065 3300036712 Bacteria 7645
90 Ga0316584_0011896 3300036712 Bacteria 6132
91 Ga0316581_0023783 3300037588 Bacteria 1813
92 Ga0400483_043011 3300039062 Bacteria 1448
93 Ga0400483_044773 3300039062 Bacteria 15120
94 Ga0400483_213929 3300039062 Bacteria 24874
95 Ga0400483_282825 3300039062 Bacteria 7394
96 Ga0436365_0606023 3300039437 Bacteria 16759
97 Ga0436365_1246711 3300039437 Bacteria 7624
98 Ga0436365_1556127 3300039437 Bacteria 1820
99 Ga0436362_0253498 3300039453 Bacteria 9535
100 Ga0439448_0016134 3300042005 Bacteria 2271
101 Ga0439464_0001093 3300042439 Bacteria 6236
102 Ga0439460_0010162 3300042461 Bacteria 2402
103 Ga0451577_0004119 3300042876 Bacteria 15591
104 Ga0453684_0048878 3300044712 Bacteria 5585
105 Ga0451576_0473949 3300045051 Bacteria 1315
106 Ga0495653_0019271 3300046463 Bacteria 5534
107 Ga0495608_0100007 3300046511 Bacteria 1870
108 Ga0495667_0022809 3300046559 Bacteria 4216
109 Ga0495657_0005413 3300046675 Bacteria 10106
110 Ga0495680_0004542 3300047322 Bacteria 13260
111 Ga0495675_0047433 3300047444 Bacteria 2733
112 Ga0495602_0055506 3300048088 Bacteria 3488
113 Ga0496103_0123665 3300048906 Bacteria 1649
114 Ga0496103_0208022 3300048906 Bacteria 1258
115 Ga0496106_0037626 3300048909 Bacteria 3621
116 Ga0496107_0051910 3300048910 Bacteria 2958
117 Ga0496108_0030889 3300048911 Bacteria 4440
118 Ga0496109_0031425 3300048912 Bacteria 4765
119 Ga0496109_0240758 3300048912 Bacteria 1703
120 Ga0496109_0641290 3300048912 Bacteria 999
121 Ga0496110_0006331 3300048913 Bacteria 9353
122 Ga0496110_0022268 3300048913 Bacteria 5378
123 Ga0496110_0059906 3300048913 Bacteria 3357
124 Ga0496110_0195579 3300048913 Bacteria 1836
125 Ga0496110_0218890 3300048913 Bacteria 1731
126 Ga0496110_0227500 3300048913 Bacteria 1696
127 Ga0496111_0069865 3300048914 Bacteria 2554
128 Ga0496111_0264641 3300048914 Bacteria 1276
129 Ga0496114_0011575 3300048917 Bacteria 7050
130 Ga0496116_0018821 3300048919 Bacteria 5307
131 Ga0496122_0000041 3300048925 Bacteria 282392
132 Ga0496122_0113111 3300048925 Bacteria 1775
133 Ga0496123_0023786 3300048926 Bacteria 4680
134 Ga0496126_0000168 3300048929 Bacteria 152201
135 Ga0501034_0234626 3300049571 Bacteria 1782
136 Ga0501036_0149828 3300049572 Bacteria 1968
137 Ga0501036_0342273 3300049572 Bacteria 1249
138 Ga0501037_0163563 3300049573 Bacteria 1586
139 Ga0501038_0153137 3300049574 Bacteria 1879
140 Ga0501038_0170019 3300049574 Bacteria 1765
141 Ga0501038_0366292 3300049574 Bacteria 1120
142 Ga0501039_0038205 3300049575 Bacteria 3709
143 Ga0501039_0085421 3300049575 Bacteria 2458
144 Ga0501040_0036293 3300049576 Bacteria 3344
145 Ga0501040_0045576 3300049576 Bacteria 2992
146 Ga0501040_0084434 3300049576 Bacteria 2203
147 Ga0501040_0311356 3300049576 Bacteria 1126
148 Ga0501042_0044247 3300049578 Bacteria 3171
149 Ga0501042_0137278 3300049578 Bacteria 1763
150 Ga0501047_0160197 3300049581 Bacteria 2122
151 Ga0501047_0588489 3300049581 Bacteria 935
152 Ga0501048_0067966 3300049582 Bacteria 2518
153 Ga0501048_0068678 3300049582 Bacteria 2503
154 Ga0501048_0244203 3300049582 Bacteria 1274
155 Ga0501067_0088371 3300049583 Bacteria 1720
156 Ga0501069_0022184 3300049585 Bacteria 3450
157 Ga0501071_0032738 3300049587 Bacteria 3693
158 Ga0501071_0098653 3300049587 Bacteria 2152
159 Ga0501071_0166618 3300049587 Bacteria 1649
160 Ga0501072_0016000 3300049588 Bacteria 5752
161 Ga0501072_0030931 3300049588 Bacteria 4188
162 Ga0501072_0043671 3300049588 Bacteria 3523
163 Ga0501072_0199745 3300049588 Bacteria 1594
164 Ga0501074_0088203 3300049590 Bacteria 2222
165 Ga0501074_0223603 3300049590 Bacteria 1340
166 Ga0501075_0063767 3300049591 Bacteria 2778
167 Ga0501075_0073877 3300049591 Bacteria 2579
168 Ga0501075_0183339 3300049591 Bacteria 1597
169 Ga0501076_0043614 3300049592 Bacteria 3535
170 Ga0501076_0076291 3300049592 Bacteria 2688
171 Ga0501076_0090011 3300049592 Bacteria 2468
172 Ga0501076_0125927 3300049592 Bacteria 2076
173 Ga0501076_0244816 3300049592 Bacteria 1467
174 Ga0501077_0086287 3300049593 Bacteria 1990
175 Ga0501077_0149375 3300049593 Bacteria 1483
176 Ga0501079_0175962 3300049741 Bacteria 1669
177 Ga0501080_0302598 3300049742 Bacteria 1450
178 Ga0501080_0425962 3300049742 Bacteria 1192
179 Ga0501081_0039606 3300049743 Bacteria 3226
180 Ga0501081_0070955 3300049743 Bacteria 2428
181 Ga0501035_0220670 3300049822 Bacteria 1619
182 Ga0501044_0002029 3300049823 Bacteria 23340
183 Ga0501044_0070686 3300049823 Bacteria 3550
184 Ga0501044_0184650 3300049823 Bacteria 2051
185 Ga0501045_0002095 3300049824 Bacteria 13480
186 nmdc:mga03n38_153259_c1 3300050490 Bacteria 1161
187 nmdc:mga03n38_24045_c1 3300050490 Bacteria 2487
188 nmdc:mga03n38_72081_c1 3300050490 Bacteria 1601
189 nmdc:mga03n38_74005_c1 3300050490 Bacteria 1583
190 nmdc:mga00v17_17059_c1 3300050491 Bacteria 4101
191 nmdc:mga00v17_18027_c1 3300050491 Bacteria 4006
192 nmdc:mga00v17_203611_c1 3300050491 Bacteria 1280
193 nmdc:mga00v17_91457_c1 3300050491 Bacteria 1911
194 nmdc:mga0yw44_3335_c1 3300050492 Bacteria 7110
195 nmdc:mga05p37_401687_c1 3300050507 Bacteria 1600
196 nmdc:mga09592_21542_c1 3300050508 Bacteria 5312
197 nmdc:mga09592_439_c1 3300050508 Bacteria 30674
198 nmdc:mga0qj67_9325_c1 3300050509 Bacteria 7297
199 nmdc:mga06r32_1239_c1 3300050510 Bacteria 22937
200 nmdc:mga0n895_166751_c1 3300050512 Bacteria 2234
201 nmdc:mga0n895_24447_c1 3300050512 Bacteria 5693
202 nmdc:mga0a205_127999_c1 3300050515 Bacteria 2439
203 Ga0495601_0212847 3300053077 Bacteria 1263
204 Ga0495595_0088118 3300053084 Bacteria 1486
205 Ga0500568_0040850 3300053139 Bacteria 1866
206 Ga0500616_0000477 3300053153 Bacteria 51936
207 Ga0501084_0223154 3300054114 Bacteria 1590
208 Ga0501084_0243469 3300054114 Bacteria 1518
209 Ga0501082_0050847 3300060353 Bacteria 3574
210 Ga0501082_0073167 3300060353 Bacteria 2952
211 Ga0501082_0110916 3300060353 Bacteria 2374
212 Ga0501082_0119155 3300060353 Bacteria 2287
213 Ga0530510_0011815 3300061734 Bacteria 6126
214 Ga0530510_0034932 3300061734 Bacteria 3622
215 Ga0530510_0261111 3300061734 Bacteria 1292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0588489 Ga0501047_0588489_25_813 262
2 3300039062 Ga0400483_044773 Ga0400483_044773_747_1640 277
3 3300039062 Ga0400483_282825 Ga0400483_282825_3448_4341 277
4 3300048913 Ga0496110_0227500 Ga0496110_0227500_168_1052 278
5 3300005356 Ga0070674_100047724 Ga0070674_1000477242 279
6 3300025937 Ga0207669_10102818 Ga0207669_101028182 279
7 3300048913 Ga0496110_0059906 Ga0496110_0059906_2384_3232 280
8 3300005843 Ga0068860_100009570 Ga0068860_1000095703 283
9 3300028381 Ga0268264_10010958 Ga0268264_100109582 283
10 iso_pu_bacteria 2740891818 2740990939 283
11 3300005340 Ga0070689_100043043 Ga0070689_1000430432 284
12 3300005356 Ga0070674_100062104 Ga0070674_1000621042 284
13 3300005459 Ga0068867_100007821 Ga0068867_1000078215 284
14 3300005615 Ga0070702_100012858 Ga0070702_1000128584 284
15 3300005718 Ga0068866_10003083 Ga0068866_100030834 284
16 3300006178 Ga0075367_10067498 Ga0075367_100674983 284
17 3300013297 Ga0157378_10002124 Ga0157378_1000212412 284
18 3300025937 Ga0207669_10091447 Ga0207669_100914472 284
19 3300026089 Ga0207648_10002677 Ga0207648_1000267719 284
20 3300031665 Ga0316575_10000433 Ga0316575_100004337 284
21 3300031691 Ga0316579_10000270 Ga0316579_1000027011 284
22 3300031727 Ga0316576_10004710 Ga0316576_100047106 284
23 3300031728 Ga0316578_10000051 Ga0316578_100000518 284
24 3300031733 Ga0316577_10001719 Ga0316577_100017194 284
25 3300032133 Ga0316583_10008667 Ga0316583_100086672 284
26 3300032137 Ga0316585_10000581 Ga0316585_100005816 284
27 3300035398 Ga0316574_0001259 Ga0316574_0001259_2833_3702 284
28 3300036647 Ga0316582_0001224 Ga0316582_0001224_4799_5668 284
29 3300036712 Ga0316584_0000769 Ga0316584_0000769_2834_3703 284
30 3300037588 Ga0316581_0023783 Ga0316581_0023783_652_1521 284
31 3300048906 Ga0496103_0208022 Ga0496103_0208022_76_957 284
32 3300048909 Ga0496106_0037626 Ga0496106_0037626_966_1847 284
33 3300048910 Ga0496107_0051910 Ga0496107_0051910_836_1717 284
34 3300049572 Ga0501036_0149828 Ga0501036_0149828_992_1852 284
35 3300049574 Ga0501038_0153137 Ga0501038_0153137_825_1718 284
36 3300049587 Ga0501071_0166618 Ga0501071_0166618_14_874 284
37 iso_pu_bacteria 2925326138 2925327147 284
38 3300048925 Ga0496122_0000041 Ga0496122_0000041_17146_18018 285
39 3300048926 Ga0496123_0023786 Ga0496123_0023786_907_1779 285
40 3300048929 Ga0496126_0000168 Ga0496126_0000168_115642_116514 285
41 3300006048 Ga0075363_100231351 Ga0075363_1002313511 286
42 3300006178 Ga0075367_10029769 Ga0075367_100297693 286
43 3300050490 nmdc:mga03n38_153259_c1 nmdc:mga03n38_153259_c1_238_1119 286
44 3300005841 Ga0068863_100306615 Ga0068863_1003066152 287
45 3300009147 Ga0114129_10148709 Ga0114129_101487092 287
46 3300014325 Ga0163163_10008461 Ga0163163_100084614 287
47 3300026035 Ga0207703_10150567 Ga0207703_101505672 287
48 3300042876 Ga0451577_0004119 Ga0451577_0004119_10889_11779 287
49 3300044712 Ga0453684_0048878 Ga0453684_0048878_1288_2178 287
50 3300045051 Ga0451576_0473949 Ga0451576_0473949_272_1162 287
51 3300048906 Ga0496103_0123665 Ga0496103_0123665_318_1304 287
52 3300048911 Ga0496108_0030889 Ga0496108_0030889_89_1075 287
53 3300048912 Ga0496109_0031425 Ga0496109_0031425_386_1372 287
54 3300048912 Ga0496109_0641290 Ga0496109_0641290_64_945 287
55 3300048913 Ga0496110_0006331 Ga0496110_0006331_2391_3377 287
56 3300048917 Ga0496114_0011575 Ga0496114_0011575_5995_6981 287
57 3300048919 Ga0496116_0018821 Ga0496116_0018821_208_1089 287
58 3300048925 Ga0496122_0113111 Ga0496122_0113111_356_1243 287
59 3300005536 Ga0070697_100174375 Ga0070697_1001743753 288
60 3300006163 Ga0070715_10020255 Ga0070715_100202552 288
61 3300006173 Ga0070716_100013324 Ga0070716_1000133242 288
62 3300006852 Ga0075433_10150460 Ga0075433_101504603 288
63 3300006871 Ga0075434_100033077 Ga0075434_1000330773 288
64 3300006871 Ga0075434_100174883 Ga0075434_1001748832 288
65 3300006914 Ga0075436_100018508 Ga0075436_1000185085 288
66 3300007076 Ga0075435_100286857 Ga0075435_1002868572 288
67 3300007265 Ga0099794_10002014 Ga0099794_100020145 288
68 3300025905 Ga0207685_10092779 Ga0207685_100927791 288
69 3300025939 Ga0207665_10020044 Ga0207665_100200442 288
70 3300027671 Ga0209588_1040259 Ga0209588_10402592 288
71 3300035398 Ga0316574_0092525 Ga0316574_0092525_741_1622 288
72 3300039062 Ga0400483_043011 Ga0400483_043011_68_961 288
73 3300048912 Ga0496109_0240758 Ga0496109_0240758_69_962 288
74 3300048913 Ga0496110_0218890 Ga0496110_0218890_213_1106 288
75 3300048914 Ga0496111_0264641 Ga0496111_0264641_225_1139 288
76 3300050512 nmdc:mga0n895_166751_c1 nmdc:mga0n895_166751_c1_758_1630 288
77 3300050512 nmdc:mga0n895_24447_c1 nmdc:mga0n895_24447_c1_3036_3908 288
78 3300050515 nmdc:mga0a205_127999_c1 nmdc:mga0a205_127999_c1_201_1073 288
79 3300053077 Ga0495601_0212847 Ga0495601_0212847_256_1149 288
80 3300053153 Ga0500616_0000477 Ga0500616_0000477_23345_24241 288
81 3300049573 Ga0501037_0163563 Ga0501037_0163563_655_1545 289
82 3300049574 Ga0501038_0170019 Ga0501038_0170019_335_1225 289
83 3300049575 Ga0501039_0085421 Ga0501039_0085421_1522_2412 289
84 3300049576 Ga0501040_0036293 Ga0501040_0036293_1294_2184 289
85 3300049578 Ga0501042_0137278 Ga0501042_0137278_617_1507 289
86 3300049582 Ga0501048_0067966 Ga0501048_0067966_943_1833 289
87 3300049588 Ga0501072_0016000 Ga0501072_0016000_2718_3608 289
88 3300049591 Ga0501075_0063767 Ga0501075_0063767_1274_2164 289
89 3300049592 Ga0501076_0043614 Ga0501076_0043614_2128_3018 289
90 3300049742 Ga0501080_0302598 Ga0501080_0302598_346_1236 289
91 3300049743 Ga0501081_0039606 Ga0501081_0039606_444_1334 289
92 3300049824 Ga0501045_0002095 Ga0501045_0002095_7224_8114 289
93 3300060353 Ga0501082_0119155 Ga0501082_0119155_297_1187 289
94 3300061734 Ga0530510_0034932 Ga0530510_0034932_178_1068 289
95 3300031251 Ga0265327_10005242 Ga0265327_100052428 291
96 3300031727 Ga0316576_10000958 Ga0316576_100009588 292
97 3300031733 Ga0316577_10018003 Ga0316577_100180032 292
98 3300036712 Ga0316584_0011896 Ga0316584_0011896_4201_5085 292
99 3300049823 Ga0501044_0184650 Ga0501044_0184650_172_1062 292
100 3300005467 Ga0070706_100022481 Ga0070706_1000224812 293
101 3300009147 Ga0114129_10077745 Ga0114129_100777453 293
102 3300025910 Ga0207684_10015762 Ga0207684_100157625 293
103 3300031727 Ga0316576_10054361 Ga0316576_100543613 293
104 3300031728 Ga0316578_10017503 Ga0316578_100175032 293
105 3300035398 Ga0316574_0020072 Ga0316574_0020072_1719_2600 293
106 3300036647 Ga0316582_0022315 Ga0316582_0022315_2678_3559 293
107 3300036712 Ga0316584_0007065 Ga0316584_0007065_2150_3031 293
108 3300039062 Ga0400483_213929 Ga0400483_213929_4172_5062 293
109 3300049581 Ga0501047_0160197 Ga0501047_0160197_41_922 293
110 3300049585 Ga0501069_0022184 Ga0501069_0022184_544_1425 293
111 3300049823 Ga0501044_0002029 Ga0501044_0002029_21548_22429 293
112 3300050507 nmdc:mga05p37_401687_c1 nmdc:mga05p37_401687_c1_352_1233 293
113 3300005457 Ga0070662_100151851 Ga0070662_1001518511 294
114 3300005458 Ga0070681_10035592 Ga0070681_100355924 294
115 3300005843 Ga0068860_100064991 Ga0068860_1000649912 294
116 3300005843 Ga0068860_100282256 Ga0068860_1002822562 294
117 3300006038 Ga0075365_10093045 Ga0075365_100930452 294
118 3300006048 Ga0075363_100019279 Ga0075363_1000192793 294
119 3300006051 Ga0075364_10017669 Ga0075364_100176695 294
120 3300006051 Ga0075364_10030422 Ga0075364_100304222 294
121 3300006051 Ga0075364_10064614 Ga0075364_100646142 294
122 3300006195 Ga0075366_10187479 Ga0075366_101874791 294
123 3300009148 Ga0105243_10006046 Ga0105243_100060464 294
124 3300009148 Ga0105243_10342118 Ga0105243_103421182 294
125 3300009553 Ga0105249_10323216 Ga0105249_103232162 294
126 3300013308 Ga0157375_10666044 Ga0157375_106660442 294
127 3300014968 Ga0157379_10070721 Ga0157379_100707211 294
128 3300021384 Ga0213876_10041175 Ga0213876_100411753 294
129 3300025901 Ga0207688_10101185 Ga0207688_101011852 294
130 3300025912 Ga0207707_10098363 Ga0207707_100983633 294
131 3300025912 Ga0207707_10173027 Ga0207707_101730272 294
132 3300025933 Ga0207706_10090041 Ga0207706_100900412 294
133 3300025935 Ga0207709_10351336 Ga0207709_103513361 294
134 3300025940 Ga0207691_10106985 Ga0207691_101069852 294
135 3300025961 Ga0207712_10087805 Ga0207712_100878052 294
136 3300026118 Ga0207675_100066541 Ga0207675_1000665413 294
137 3300028381 Ga0268264_10164489 Ga0268264_101644892 294
138 3300035398 Ga0316574_0245517 Ga0316574_0245517_196_1086 294
139 3300039437 Ga0436365_0606023 Ga0436365_0606023_6115_7002 294
140 3300039437 Ga0436365_1246711 Ga0436365_1246711_3880_4770 294
141 3300039437 Ga0436365_1556127 Ga0436365_1556127_252_1163 294
142 3300039453 Ga0436362_0253498 Ga0436362_0253498_3646_4536 294
143 3300046463 Ga0495653_0019271 Ga0495653_0019271_230_1117 294
144 3300046511 Ga0495608_0100007 Ga0495608_0100007_741_1628 294
145 3300046559 Ga0495667_0022809 Ga0495667_0022809_3194_4081 294
146 3300046675 Ga0495657_0005413 Ga0495657_0005413_7914_8801 294
147 3300047322 Ga0495680_0004542 Ga0495680_0004542_2102_2989 294
148 3300047444 Ga0495675_0047433 Ga0495675_0047433_171_1058 294
149 3300048088 Ga0495602_0055506 Ga0495602_0055506_1048_1935 294
150 3300048913 Ga0496110_0022268 Ga0496110_0022268_184_1107 294
151 3300048914 Ga0496111_0069865 Ga0496111_0069865_40_963 294
152 3300049571 Ga0501034_0234626 Ga0501034_0234626_193_1089 294
153 3300049572 Ga0501036_0342273 Ga0501036_0342273_218_1108 294
154 3300049575 Ga0501039_0038205 Ga0501039_0038205_2391_3314 294
155 3300049576 Ga0501040_0045576 Ga0501040_0045576_1798_2721 294
156 3300049576 Ga0501040_0084434 Ga0501040_0084434_768_1691 294
157 3300049578 Ga0501042_0044247 Ga0501042_0044247_805_1728 294
158 3300049582 Ga0501048_0068678 Ga0501048_0068678_1135_2025 294
159 3300049582 Ga0501048_0244203 Ga0501048_0244203_98_1021 294
160 3300049583 Ga0501067_0088371 Ga0501067_0088371_478_1371 294
161 3300049587 Ga0501071_0032738 Ga0501071_0032738_2042_2929 294
162 3300049587 Ga0501071_0098653 Ga0501071_0098653_550_1458 294
163 3300049588 Ga0501072_0030931 Ga0501072_0030931_923_1813 294
164 3300049588 Ga0501072_0043671 Ga0501072_0043671_2028_2915 294
165 3300049588 Ga0501072_0199745 Ga0501072_0199745_528_1451 294
166 3300049590 Ga0501074_0088203 Ga0501074_0088203_472_1362 294
167 3300049590 Ga0501074_0223603 Ga0501074_0223603_398_1285 294
168 3300049591 Ga0501075_0073877 Ga0501075_0073877_1071_1961 294
169 3300049591 Ga0501075_0183339 Ga0501075_0183339_85_1008 294
170 3300049592 Ga0501076_0076291 Ga0501076_0076291_941_1864 294
171 3300049592 Ga0501076_0090011 Ga0501076_0090011_613_1503 294
172 3300049592 Ga0501076_0125927 Ga0501076_0125927_780_1703 294
173 3300049593 Ga0501077_0086287 Ga0501077_0086287_433_1356 294
174 3300049593 Ga0501077_0149375 Ga0501077_0149375_165_1055 294
175 3300049741 Ga0501079_0175962 Ga0501079_0175962_166_1056 294
176 3300049742 Ga0501080_0425962 Ga0501080_0425962_23_946 294
177 3300049743 Ga0501081_0070955 Ga0501081_0070955_941_1831 294
178 3300049822 Ga0501035_0220670 Ga0501035_0220670_575_1498 294
179 3300049823 Ga0501044_0070686 Ga0501044_0070686_1057_1953 294
180 3300050490 nmdc:mga03n38_24045_c1 nmdc:mga03n38_24045_c1_583_1497 294
181 3300050490 nmdc:mga03n38_72081_c1 nmdc:mga03n38_72081_c1_370_1284 294
182 3300050490 nmdc:mga03n38_74005_c1 nmdc:mga03n38_74005_c1_56_970 294
183 3300050491 nmdc:mga00v17_17059_c1 nmdc:mga00v17_17059_c1_2205_3119 294
184 3300050491 nmdc:mga00v17_18027_c1 nmdc:mga00v17_18027_c1_164_1078 294
185 3300050491 nmdc:mga00v17_203611_c1 nmdc:mga00v17_203611_c1_34_948 294
186 3300050491 nmdc:mga00v17_91457_c1 nmdc:mga00v17_91457_c1_884_1780 294
187 3300050492 nmdc:mga0yw44_3335_c1 nmdc:mga0yw44_3335_c1_5606_6520 294
188 3300053084 Ga0495595_0088118 Ga0495595_0088118_420_1307 294
189 3300054114 Ga0501084_0223154 Ga0501084_0223154_257_1180 294
190 3300060353 Ga0501082_0050847 Ga0501082_0050847_2505_3395 294
191 3300060353 Ga0501082_0110916 Ga0501082_0110916_759_1682 294
192 3300061734 Ga0530510_0261111 Ga0530510_0261111_265_1173 294
193 3300048913 Ga0496110_0195579 Ga0496110_0195579_825_1739 295
194 3300049576 Ga0501040_0311356 Ga0501040_0311356_24_950 295
195 3300053139 Ga0500568_0040850 Ga0500568_0040850_244_1155 295
196 3300003373 JGI25407J50210_10030069 JGI25407J50210_100300691 296
197 3300005937 Ga0081455_10000584 Ga0081455_1000058437 296
198 3300005981 Ga0081538_10000498 Ga0081538_1000049811 296
199 3300005981 Ga0081538_10004479 Ga0081538_100044798 296
200 3300005981 Ga0081538_10083073 Ga0081538_100830732 296
201 3300006880 Ga0075429_100007928 Ga0075429_1000079283 296
202 3300006880 Ga0075429_100082048 Ga0075429_1000820483 296
203 3300009147 Ga0114129_10207669 Ga0114129_102076692 296
204 3300025944 Ga0207661_10260425 Ga0207661_102604252 296
205 3300025949 Ga0207667_10284482 Ga0207667_102844822 296
206 3300042005 Ga0439448_0016134 Ga0439448_0016134_144_1034 296
207 3300042439 Ga0439464_0001093 Ga0439464_0001093_2737_3627 296
208 3300042461 Ga0439460_0010162 Ga0439460_0010162_322_1212 296
209 3300049574 Ga0501038_0366292 Ga0501038_0366292_90_980 296
210 3300049592 Ga0501076_0244816 Ga0501076_0244816_561_1451 296
211 3300050508 nmdc:mga09592_21542_c1 nmdc:mga09592_21542_c1_1825_2715 296
212 3300050508 nmdc:mga09592_439_c1 nmdc:mga09592_439_c1_22565_23467 296
213 3300050509 nmdc:mga0qj67_9325_c1 nmdc:mga0qj67_9325_c1_3233_4135 296
214 3300050510 nmdc:mga06r32_1239_c1 nmdc:mga06r32_1239_c1_6575_7477 296
215 3300054114 Ga0501084_0243469 Ga0501084_0243469_286_1176 296
216 3300060353 Ga0501082_0073167 Ga0501082_0073167_1403_2293 296
217 3300061734 Ga0530510_0011815 Ga0530510_0011815_1983_2873 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

17

299

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l21-assembly2.cif.gz_C the crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps-a204r 0.9673 3 294
5j5d-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid 0.9669 3 294
1xl9-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase dapa-2 (ba3935) from bacillus anthracis. 0.9582 4 290
3cpr-assembly1.cif.gz_A the crystal structure of corynebacterium glutamicum dihydrodipicolinate synthase to 2.2 a resolution 0.9568 2 295
3hij-assembly1.cif.gz_D crystal structure of dihydrodipicolinate synthase from bacillus anthracis in complex with its substrate, pyruvate 0.9566 6 290
ID Description Score Start End Superfamily
1xl9D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.958 4 290 3.20.20.70
3cprA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9568 2 295 3.20.20.70
5ud6B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9472 6 295 3.20.20.70
3cprA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.941 2 295 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9405 6 294 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7K1BPH5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9936 4 224 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A7V9SZR3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9888 13 206 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A6J7III5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9879 3 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A3C2DG87-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9878 2 165 GO:0005829
GO:0008840
GO:0044281
AF-A0A0R2PVM5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9863 32 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Feature Viewer

pLDDT pTM Quality
95.33 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map