F328558

General Info

Members Datasets Scaffolds Average Seq Length
217 136 217 393

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100151341|Ga0068856_1001513412
Length 454
Sequence VSPEEEGGPGCYGQAAAGSRTLFVCTGPLHATCRVEQPECICCDVAMASVLPTLVVVASTEQLRLPLAMLVIFGSAKLLDEIFERLHQPGIVGQILAGILIGPSVLGWMQPSVFLSRLADLGVMFLLFRVGLEVKSSDLIKAGPRASMVAVLGVIVPFFTGWGLLALWGESRIESIFVGAALVATSVGITAQVLAAKDLLQEKASKIILGAAVIDDILGLIVLALVSSLAKGQVNVLELCLTAVFAIAFTVVVVKWGTAAMGRLLPRLNQQLRAGEAQFNAALALMFALSVLSVYAGVAAIIGAFFAGMMLSESVEERVHDLTQGVTEFLIPFFLAGIGLHFNLGTFRNGRTLLLTLLIVLVAVFSKFIGCGLASLPLGRRNALRVGVGMIPRGEVGMVVAQIGLSLGVIAQGIYDAVVFMSIATTLIAPPLLNLTYKGARPEAAVLEDHPSIL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10040368 3300005327 Bacteria 3765
2 Ga0070683_100000073 3300005329 Bacteria 69199
3 Ga0070683_100014461 3300005329 Bacteria 6903
4 Ga0070683_100047297 3300005329 Bacteria 3975
5 Ga0070680_100027050 3300005336 Bacteria 4593
6 Ga0068868_100114630 3300005338 Unclassified 2193
7 Ga0070689_100061196 3300005340 Bacteria 2928
8 Ga0070661_100016471 3300005344 Bacteria 5227
9 Ga0070673_100085242 3300005364 Bacteria 2571
10 Ga0070713_100001513 3300005436 Bacteria 14808
11 Ga0070681_10050656 3300005458 Bacteria 4143
12 Ga0070681_10104206 3300005458 Unclassified 2779
13 Ga0070679_100288450 3300005530 Bacteria 1593
14 Ga0070684_100000211 3300005535 Bacteria 41055
15 Ga0070684_100002197 3300005535 Bacteria 14387
16 Ga0070684_100056078 3300005535 Bacteria 3437
17 Ga0068853_100023137 3300005539 Bacteria 5200
18 Ga0070693_100052423 3300005547 Bacteria 2339
19 Ga0070665_100042379 3300005548 Unclassified 4575
20 Ga0070665_100156942 3300005548 Bacteria 2277
21 Ga0068855_100009593 3300005563 Bacteria 11677
22 Ga0068855_100033215 3300005563 Bacteria 6160
23 Ga0068855_100121247 3300005563 Bacteria 2993
24 Ga0068855_100225513 3300005563 Bacteria 2100
25 Ga0068857_100010935 3300005577 Bacteria 7899
26 Ga0068857_100131935 3300005577 Bacteria 2253
27 Ga0068856_100012682 3300005614 Bacteria 8160
28 Ga0068856_100068750 3300005614 Bacteria 3501
29 Ga0068856_100151341 3300005614 Bacteria 2329
30 Ga0068856_100160040 3300005614 Bacteria 2262
31 Ga0068864_100053298 3300005618 Bacteria 3489
32 Ga0068863_100078075 3300005841 Unclassified 3135
33 Ga0070717_10044518 3300006028 Bacteria 3625
34 Ga0070717_10116821 3300006028 Unclassified 2281
35 Ga0070712_100089954 3300006175 Unclassified 2247
36 Ga0097621_100031301 3300006237 Bacteria 4222
37 Ga0068871_100007521 3300006358 Bacteria 7790
38 Ga0068871_100106013 3300006358 Bacteria 2359
39 Ga0075431_100060354 3300006847 Bacteria 3913
40 Ga0075433_10074525 3300006852 Bacteria 2987
41 Ga0075429_100024003 3300006880 Bacteria 5289
42 Ga0075429_100067454 3300006880 Unclassified 3113
43 Ga0075429_100334257 3300006880 Bacteria 1326
44 Ga0105240_10000429 3300009093 Bacteria 77882
45 Ga0105240_10003797 3300009093 Bacteria 23330
46 Ga0105245_10005950 3300009098 Bacteria 10720
47 Ga0114129_10085207 3300009147 Bacteria 4384
48 Ga0114129_10129454 3300009147 Bacteria 3468
49 Ga0114129_10145919 3300009147 Bacteria 3242
50 Ga0114129_10166492 3300009147 Bacteria 3008
51 Ga0105241_10001009 3300009174 Bacteria 21387
52 Ga0105241_10036691 3300009174 Bacteria 3690
53 Ga0105241_10039381 3300009174 Bacteria 3565
54 Ga0105241_10062104 3300009174 Unclassified 2879
55 Ga0105241_10089767 3300009174 Unclassified 2422
56 Ga0105248_10169797 3300009177 Bacteria 2458
57 Ga0105248_10170664 3300009177 Bacteria 2451
58 Ga0105248_10218926 3300009177 Unclassified 2144
59 Ga0105237_10001666 3300009545 Bacteria 28772
60 Ga0105237_10048279 3300009545 Bacteria 4279
61 Ga0105237_10078644 3300009545 Bacteria 3287
62 Ga0105237_10328074 3300009545 Bacteria 1534
63 Ga0105238_10001043 3300009551 Bacteria 28029
64 Ga0105238_10026679 3300009551 Bacteria 5890
65 Ga0105238_10332264 3300009551 Bacteria 1507
66 Ga0105249_10087720 3300009553 Bacteria 2904
67 Ga0105239_10022217 3300010375 Bacteria 6992
68 Ga0105239_10344031 3300010375 Unclassified 1683
69 Ga0105246_10053740 3300011119 Unclassified 2773
70 Ga0157371_10060841 3300013102 Bacteria 2677
71 Ga0157370_10000754 3300013104 Bacteria 40412
72 Ga0157369_10001712 3300013105 Bacteria 26704
73 Ga0157369_10004580 3300013105 Bacteria 16246
74 Ga0157369_10014586 3300013105 Bacteria 8866
75 Ga0157369_10017225 3300013105 Bacteria 8121
76 Ga0157369_10047410 3300013105 Bacteria 4665
77 Ga0157369_10054055 3300013105 Bacteria 4337
78 Ga0157369_10211232 3300013105 Bacteria 2034
79 Ga0157374_10005181 3300013296 Bacteria 10933
80 Ga0157374_10007272 3300013296 Bacteria 9435
81 Ga0157374_10097500 3300013296 Unclassified 2813
82 Ga0157378_10019944 3300013297 Bacteria 5896
83 Ga0157372_10011561 3300013307 Bacteria 9391
84 Ga0157372_10074871 3300013307 Bacteria 3819
85 Ga0157372_10099491 3300013307 Bacteria 3317
86 Ga0157372_10112388 3300013307 Unclassified 3121
87 Ga0157372_10197944 3300013307 Bacteria 2327
88 Ga0157375_10076689 3300013308 Bacteria 3370
89 Ga0157375_10148520 3300013308 Bacteria 2477
90 Ga0163163_10063787 3300014325 Bacteria 3655
91 Ga0163163_10138211 3300014325 Unclassified 2478
92 Ga0163163_10185058 3300014325 Unclassified 2131
93 Ga0157379_10030470 3300014968 Bacteria 4803
94 Ga0157376_10021442 3300014969 Bacteria 5017
95 Ga0213875_10043773 3300021388 Unclassified 2102
96 Ga0207707_10128334 3300025912 Bacteria 2217
97 Ga0207695_10005624 3300025913 Bacteria 16548
98 Ga0207695_10019391 3300025913 Bacteria 7833
99 Ga0207671_10018234 3300025914 Bacteria 5391
100 Ga0207693_10224246 3300025915 Unclassified 1476
101 Ga0207660_10002883 3300025917 Bacteria 11237
102 Ga0207657_10079915 3300025919 Bacteria 2750
103 Ga0207657_10167011 3300025919 Bacteria 1784
104 Ga0207694_10008977 3300025924 Bacteria 7546
105 Ga0207687_10006856 3300025927 Bacteria 7500
106 Ga0207687_10139011 3300025927 Unclassified 1840
107 Ga0207700_10016892 3300025928 Bacteria 4860
108 Ga0207664_10169797 3300025929 Unclassified 1866
109 Ga0207644_10102962 3300025931 Bacteria 2148
110 Ga0207686_10049103 3300025934 Unclassified 2618
111 Ga0207665_10015236 3300025939 Bacteria 5050
112 Ga0207661_10000070 3300025944 Bacteria 69785
113 Ga0207661_10037899 3300025944 Bacteria 3775
114 Ga0207661_10260189 3300025944 Bacteria 1545
115 Ga0207667_10047646 3300025949 Bacteria 4536
116 Ga0207667_10190227 3300025949 Bacteria 2106
117 Ga0207667_10337900 3300025949 Bacteria 1537
118 Ga0207712_10051525 3300025961 Bacteria 2879
119 Ga0207702_10002673 3300026078 Bacteria 16738
120 Ga0207702_10015107 3300026078 Bacteria 6402
121 Ga0207641_10069037 3300026088 Unclassified 3032
122 Ga0207676_10204206 3300026095 Bacteria 1748
123 Ga0207674_10003763 3300026116 Bacteria 18513
124 Ga0207674_10040335 3300026116 Bacteria 4837
125 Ga0207683_10194324 3300026121 Unclassified 1843
126 Ga0265316_10108862 3300031344 Bacteria 2100
127 Ga0373934_0057729 3300035086 Bacteria 1544
128 Ga0373935_0139385 3300035692 Unclassified 1637
129 Ga0373933_0211311 3300035724 Bacteria 1243
130 Ga0373947_0082975 3300035725 Unclassified 1987
131 Ga0373937_0214018 3300036401 Unclassified 1814
132 Ga0373937_0360781 3300036401 Bacteria 1377
133 Ga0395900_0039710 3300037418 Bacteria 4849
134 Ga0395898_0130034 3300037466 Bacteria 2412
135 Ga0395905_0287414 3300037471 Unclassified 1531
136 Ga0436364_1287719 3300037853 Bacteria 4852
137 Ga0466966_0025415 3300044684 Bacteria 3869
138 Ga0453684_0389206 3300044712 Bacteria 1564
139 Ga0466967_0332834 3300045976 Bacteria 1467
140 Ga0495592_0027173 3300046454 Bacteria 4338
141 Ga0495651_0013495 3300046462 Bacteria 6319
142 Ga0495580_0001582 3300046472 Bacteria 19995
143 Ga0495580_0014909 3300046472 Bacteria 5886
144 Ga0495580_0028337 3300046472 Bacteria 4071
145 Ga0495664_0002225 3300046477 Bacteria 10380
146 Ga0495664_0062259 3300046477 Bacteria 2222
147 Ga0495594_0154785 3300046499 Bacteria 1302
148 Ga0495628_0002955 3300046516 Bacteria 15240
149 Ga0495628_0036978 3300046516 Unclassified 3915
150 Ga0495652_0044680 3300046529 Bacteria 3813
151 Ga0495665_0018604 3300046531 Bacteria 3733
152 Ga0495665_0129280 3300046531 Bacteria 1322
153 Ga0495587_0037321 3300046536 Bacteria 2918
154 Ga0495645_0022750 3300046543 Bacteria 4535
155 Ga0495645_0045409 3300046543 Unclassified 3205
156 Ga0495645_0098252 3300046543 Unclassified 2084
157 Ga0495667_0053480 3300046559 Bacteria 2659
158 Ga0495667_0088474 3300046559 Bacteria 2007
159 Ga0495634_0131581 3300046642 Bacteria 1594
160 Ga0495635_0045308 3300046663 Bacteria 3035
161 Ga0495599_0009070 3300046678 Bacteria 6062
162 Ga0495623_0047036 3300046679 Bacteria 2738
163 Ga0495623_0071426 3300046679 Unclassified 2160
164 Ga0495623_0097603 3300046679 Bacteria 1794
165 Ga0495623_0151433 3300046679 Unclassified 1371
166 Ga0495613_0133642 3300046689 Bacteria 1776
167 Ga0495600_0179795 3300046809 Bacteria 1363
168 Ga0495674_0004670 3300047319 Bacteria 13170
169 Ga0495680_0077541 3300047322 Bacteria 2517
170 Ga0495675_0095555 3300047444 Bacteria 1863
171 Ga0495684_0002048 3300047471 Bacteria 16226
172 Ga0495684_0010004 3300047471 Bacteria 7332
173 Ga0495602_0082142 3300048088 Bacteria 2705
174 Ga0495602_0109425 3300048088 Unclassified 2248
175 Ga0496115_0061468 3300048918 Bacteria 3028
176 Ga0501031_0001148 3300049568 Bacteria 16120
177 Ga0501032_0012252 3300049569 Bacteria 6136
178 Ga0501033_0040052 3300049570 Unclassified 3498
179 Ga0501034_0015793 3300049571 Bacteria 7754
180 Ga0501036_0000076 3300049572 Bacteria 60845
181 Ga0501037_0004720 3300049573 Bacteria 9903
182 Ga0501037_0092847 3300049573 Bacteria 2183
183 Ga0501038_0024433 3300049574 Bacteria 5391
184 Ga0501039_0038996 3300049575 Bacteria 3669
185 Ga0501043_0001662 3300049579 Bacteria 19301
186 Ga0501046_0002199 3300049580 Bacteria 18429
187 Ga0501047_0006159 3300049581 Bacteria 11281
188 Ga0501047_0016133 3300049581 Bacteria 7125
189 Ga0501067_0013070 3300049583 Bacteria 4594
190 Ga0501068_0000626 3300049584 Bacteria 18042
191 Ga0501069_0001472 3300049585 Bacteria 11593
192 Ga0501070_0019276 3300049586 Bacteria 5721
193 Ga0501072_0008300 3300049588 Bacteria 7888
194 Ga0501073_0035530 3300049589 Unclassified 3541
195 Ga0501073_0122552 3300049589 Bacteria 1802
196 Ga0501074_0028133 3300049590 Bacteria 4073
197 Ga0501077_0003535 3300049593 Bacteria 9388
198 Ga0501079_0006494 3300049741 Bacteria 8781
199 Ga0501080_0000049 3300049742 Bacteria 76472
200 Ga0501083_0019332 3300049744 Unclassified 4745
201 Ga0501035_0003460 3300049822 Bacteria 15111
202 Ga0501035_0026646 3300049822 Bacteria 5287
203 Ga0501044_0013449 3300049823 Bacteria 8851
204 Ga0501044_0063934 3300049823 Unclassified 3757
205 Ga0501045_0029449 3300049824 Unclassified 3969
206 nmdc:mga05p37_237188_c1 3300050507 Bacteria 2195
207 nmdc:mga05p37_371387_c1 3300050507 Bacteria 1678
208 nmdc:mga05p37_9442_c1 3300050507 Bacteria 11550
209 nmdc:mga09592_327726_c1 3300050508 Bacteria 1326
210 nmdc:mga09592_63614_c1 3300050508 Bacteria 3123
211 nmdc:mga06r32_2319_c1 3300050510 Bacteria 17031
212 nmdc:mga06r32_58868_c1 3300050510 Bacteria 3693
213 nmdc:mga0a205_48492_c1 3300050515 Bacteria 4098
214 Ga0495619_0049230 3300053085 Bacteria 2779
215 Ga0501084_0011595 3300054114 Bacteria 7295
216 Ga0501082_0001506 3300060353 Bacteria 20530
217 Ga0501082_0016754 3300060353 Bacteria 6310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0360781 Ga0373937_0360781_357_1346 299
2 3300046642 Ga0495634_0131581 Ga0495634_0131581_536_1570 314
3 3300046531 Ga0495665_0129280 Ga0495665_0129280_12_1136 343
4 3300035724 Ga0373933_0211311 Ga0373933_0211311_13_1167 354
5 3300009174 Ga0105241_10039381 Ga0105241_100393813 362
6 3300010375 Ga0105239_10022217 Ga0105239_100222176 362
7 3300014325 Ga0163163_10063787 Ga0163163_100637872 363
8 3300046454 Ga0495592_0027173 Ga0495592_0027173_2953_4137 364
9 3300046462 Ga0495651_0013495 Ga0495651_0013495_929_2113 364
10 3300046477 Ga0495664_0002225 Ga0495664_0002225_7748_8932 364
11 3300046516 Ga0495628_0002955 Ga0495628_0002955_12086_13270 364
12 3300046529 Ga0495652_0044680 Ga0495652_0044680_1394_2578 364
13 3300046536 Ga0495587_0037321 Ga0495587_0037321_26_1210 364
14 3300046543 Ga0495645_0022750 Ga0495645_0022750_3150_4334 364
15 3300046559 Ga0495667_0088474 Ga0495667_0088474_16_1200 364
16 3300046663 Ga0495635_0045308 Ga0495635_0045308_406_1590 364
17 3300046678 Ga0495599_0009070 Ga0495599_0009070_467_1651 364
18 3300046689 Ga0495613_0133642 Ga0495613_0133642_17_1201 364
19 3300046809 Ga0495600_0179795 Ga0495600_0179795_71_1255 364
20 3300047322 Ga0495680_0077541 Ga0495680_0077541_72_1256 364
21 3300047444 Ga0495675_0095555 Ga0495675_0095555_605_1789 364
22 3300053085 Ga0495619_0049230 Ga0495619_0049230_797_1981 364
23 3300009553 Ga0105249_10087720 Ga0105249_100877203 367
24 3300013105 Ga0157369_10054055 Ga0157369_100540552 367
25 3300021388 Ga0213875_10043773 Ga0213875_100437732 367
26 3300025961 Ga0207712_10051525 Ga0207712_100515253 367
27 3300037853 Ga0436364_1287719 Ga0436364_1287719_3083_4273 367
28 3300031344 Ga0265316_10108862 Ga0265316_101088621 368
29 3300006847 Ga0075431_100060354 Ga0075431_1000603542 370
30 3300050510 nmdc:mga06r32_58868_c1 nmdc:mga06r32_58868_c1_288_1517 370
31 3300005329 Ga0070683_100000073 Ga0070683_10000007352 371
32 3300005340 Ga0070689_100061196 Ga0070689_1000611962 371
33 3300005535 Ga0070684_100000211 Ga0070684_1000002118 371
34 3300025944 Ga0207661_10000070 Ga0207661_100000708 371
35 3300009551 Ga0105238_10001043 Ga0105238_1000104324 373
36 3300005577 Ga0068857_100131935 Ga0068857_1001319352 374
37 3300009545 Ga0105237_10328074 Ga0105237_103280741 374
38 3300026116 Ga0207674_10040335 Ga0207674_100403351 374
39 3300009174 Ga0105241_10001009 Ga0105241_100010093 375
40 3300035692 Ga0373935_0139385 Ga0373935_0139385_45_1211 376
41 3300005458 Ga0070681_10104206 Ga0070681_101042062 378
42 3300005563 Ga0068855_100225513 Ga0068855_1002255132 378
43 3300025944 Ga0207661_10260189 Ga0207661_102601892 378
44 3300025949 Ga0207667_10190227 Ga0207667_101902272 378
45 3300046543 Ga0495645_0098252 Ga0495645_0098252_938_2074 378
46 3300006880 Ga0075429_100067454 Ga0075429_1000674543 379
47 3300009147 Ga0114129_10145919 Ga0114129_101459192 379
48 3300013308 Ga0157375_10148520 Ga0157375_101485203 382
49 3300025928 Ga0207700_10016892 Ga0207700_100168924 382
50 3300044712 Ga0453684_0389206 Ga0453684_0389206_143_1300 382
51 3300005344 Ga0070661_100016471 Ga0070661_1000164715 383
52 3300005618 Ga0068864_100053298 Ga0068864_1000532981 383
53 3300006237 Ga0097621_100031301 Ga0097621_1000313013 383
54 3300006358 Ga0068871_100007521 Ga0068871_1000075218 383
55 3300006358 Ga0068871_100106013 Ga0068871_1001060133 383
56 3300009098 Ga0105245_10005950 Ga0105245_1000595010 383
57 3300009174 Ga0105241_10036691 Ga0105241_100366913 383
58 3300013297 Ga0157378_10019944 Ga0157378_100199442 383
59 3300014968 Ga0157379_10030470 Ga0157379_100304703 383
60 3300025927 Ga0207687_10006856 Ga0207687_100068562 383
61 3300005336 Ga0070680_100027050 Ga0070680_1000270503 385
62 3300005364 Ga0070673_100085242 Ga0070673_1000852423 386
63 3300009147 Ga0114129_10129454 Ga0114129_101294542 386
64 3300013307 Ga0157372_10112388 Ga0157372_101123882 386
65 3300025917 Ga0207660_10002883 Ga0207660_100028835 386
66 3300005535 Ga0070684_100002197 Ga0070684_10000219710 387
67 3300005563 Ga0068855_100033215 Ga0068855_1000332156 388
68 3300013105 Ga0157369_10001712 Ga0157369_1000171224 388
69 3300025919 Ga0207657_10167011 Ga0207657_101670112 388
70 3300035725 Ga0373947_0082975 Ga0373947_0082975_331_1566 388
71 3300046499 Ga0495594_0154785 Ga0495594_0154785_66_1232 388
72 3300046679 Ga0495623_0151433 Ga0495623_0151433_184_1350 388
73 3300046477 Ga0495664_0062259 Ga0495664_0062259_746_1915 389
74 3300046543 Ga0495645_0045409 Ga0495645_0045409_275_1444 389
75 3300046679 Ga0495623_0047036 Ga0495623_0047036_523_1692 389
76 3300047471 Ga0495684_0010004 Ga0495684_0010004_1111_2280 389
77 3300005329 Ga0070683_100014461 Ga0070683_1000144617 390
78 3300005530 Ga0070679_100288450 Ga0070679_1002884501 390
79 3300005547 Ga0070693_100052423 Ga0070693_1000524232 390
80 3300005577 Ga0068857_100010935 Ga0068857_10001093510 390
81 3300009093 Ga0105240_10000429 Ga0105240_1000042925 390
82 3300009174 Ga0105241_10089767 Ga0105241_100897672 390
83 3300009551 Ga0105238_10026679 Ga0105238_100266792 390
84 3300013296 Ga0157374_10097500 Ga0157374_100975002 390
85 3300025913 Ga0207695_10019391 Ga0207695_100193918 390
86 3300025924 Ga0207694_10008977 Ga0207694_100089778 390
87 3300026116 Ga0207674_10003763 Ga0207674_1000376313 390
88 3300060353 Ga0501082_0001506 Ga0501082_0001506_5784_6965 390
89 3300006880 Ga0075429_100334257 Ga0075429_1003342571 391
90 3300046472 Ga0495580_0014909 Ga0495580_0014909_616_1854 391
91 3300049568 Ga0501031_0001148 Ga0501031_0001148_10444_11619 391
92 3300049569 Ga0501032_0012252 Ga0501032_0012252_3467_4642 391
93 3300049570 Ga0501033_0040052 Ga0501033_0040052_1201_2376 391
94 3300049571 Ga0501034_0015793 Ga0501034_0015793_2010_3185 391
95 3300049572 Ga0501036_0000076 Ga0501036_0000076_33994_35169 391
96 3300049573 Ga0501037_0004720 Ga0501037_0004720_4570_5745 391
97 3300049574 Ga0501038_0024433 Ga0501038_0024433_1615_2790 391
98 3300049575 Ga0501039_0038996 Ga0501039_0038996_1146_2321 391
99 3300049579 Ga0501043_0001662 Ga0501043_0001662_8020_9195 391
100 3300049580 Ga0501046_0002199 Ga0501046_0002199_3458_4633 391
101 3300049581 Ga0501047_0016133 Ga0501047_0016133_1365_2540 391
102 3300049583 Ga0501067_0013070 Ga0501067_0013070_1882_3057 391
103 3300049584 Ga0501068_0000626 Ga0501068_0000626_2929_4104 391
104 3300049585 Ga0501069_0001472 Ga0501069_0001472_7511_8686 391
105 3300049588 Ga0501072_0008300 Ga0501072_0008300_3933_5108 391
106 3300049589 Ga0501073_0035530 Ga0501073_0035530_484_1659 391
107 3300049590 Ga0501074_0028133 Ga0501074_0028133_1365_2540 391
108 3300049593 Ga0501077_0003535 Ga0501077_0003535_3330_4505 391
109 3300049741 Ga0501079_0006494 Ga0501079_0006494_2909_4084 391
110 3300049742 Ga0501080_0000049 Ga0501080_0000049_59876_61051 391
111 3300049744 Ga0501083_0019332 Ga0501083_0019332_2448_3623 391
112 3300049822 Ga0501035_0026646 Ga0501035_0026646_2781_3956 391
113 3300049823 Ga0501044_0063934 Ga0501044_0063934_1251_2426 391
114 3300049824 Ga0501045_0029449 Ga0501045_0029449_2558_3733 391
115 3300050508 nmdc:mga09592_327726_c1 nmdc:mga09592_327726_c1_46_1275 391
116 3300054114 Ga0501084_0011595 Ga0501084_0011595_363_1538 391
117 3300060353 Ga0501082_0016754 Ga0501082_0016754_4698_5873 391
118 3300005329 Ga0070683_100047297 Ga0070683_1000472973 392
119 3300005436 Ga0070713_100001513 Ga0070713_10000151312 392
120 3300006852 Ga0075433_10074525 Ga0075433_100745254 392
121 3300006880 Ga0075429_100024003 Ga0075429_1000240033 392
122 3300009093 Ga0105240_10003797 Ga0105240_1000379722 392
123 3300009147 Ga0114129_10085207 Ga0114129_100852072 392
124 3300009147 Ga0114129_10166492 Ga0114129_101664923 392
125 3300009174 Ga0105241_10062104 Ga0105241_100621041 392
126 3300009545 Ga0105237_10001666 Ga0105237_1000166612 392
127 3300010375 Ga0105239_10344031 Ga0105239_103440311 392
128 3300025913 Ga0207695_10005624 Ga0207695_1000562419 392
129 3300025914 Ga0207671_10018234 Ga0207671_100182343 392
130 3300025927 Ga0207687_10139011 Ga0207687_101390111 392
131 3300025934 Ga0207686_10049103 Ga0207686_100491033 392
132 3300025944 Ga0207661_10037899 Ga0207661_100378995 392
133 3300050507 nmdc:mga05p37_237188_c1 nmdc:mga05p37_237188_c1_164_1363 392
134 3300050507 nmdc:mga05p37_9442_c1 nmdc:mga05p37_9442_c1_6796_7995 392
135 3300050508 nmdc:mga09592_63614_c1 nmdc:mga09592_63614_c1_331_1530 392
136 3300050515 nmdc:mga0a205_48492_c1 nmdc:mga0a205_48492_c1_189_1388 392
137 3300005841 Ga0068863_100078075 Ga0068863_1000780753 393
138 3300009177 Ga0105248_10169797 Ga0105248_101697973 393
139 3300009177 Ga0105248_10218926 Ga0105248_102189262 393
140 3300009545 Ga0105237_10078644 Ga0105237_100786442 393
141 3300009551 Ga0105238_10332264 Ga0105238_103322642 393
142 3300011119 Ga0105246_10053740 Ga0105246_100537402 393
143 3300013105 Ga0157369_10211232 Ga0157369_102112323 393
144 3300013308 Ga0157375_10076689 Ga0157375_100766893 393
145 3300014325 Ga0163163_10138211 Ga0163163_101382112 393
146 3300014325 Ga0163163_10185058 Ga0163163_101850582 393
147 3300026088 Ga0207641_10069037 Ga0207641_100690372 393
148 3300026095 Ga0207676_10204206 Ga0207676_102042062 393
149 3300035086 Ga0373934_0057729 Ga0373934_0057729_293_1474 393
150 3300037471 Ga0395905_0287414 Ga0395905_0287414_25_1212 393
151 3300046472 Ga0495580_0001582 Ga0495580_0001582_4853_6034 393
152 3300046531 Ga0495665_0018604 Ga0495665_0018604_2086_3267 393
153 3300046559 Ga0495667_0053480 Ga0495667_0053480_1214_2395 393
154 3300046679 Ga0495623_0071426 Ga0495623_0071426_388_1569 393
155 3300046679 Ga0495623_0097603 Ga0495623_0097603_29_1210 393
156 3300047471 Ga0495684_0002048 Ga0495684_0002048_12952_14133 393
157 3300048088 Ga0495602_0082142 Ga0495602_0082142_396_1577 393
158 3300048088 Ga0495602_0109425 Ga0495602_0109425_388_1569 393
159 3300005539 Ga0068853_100023137 Ga0068853_1000231372 394
160 3300005563 Ga0068855_100121247 Ga0068855_1001212472 394
161 3300005614 Ga0068856_100012682 Ga0068856_1000126827 394
162 3300005614 Ga0068856_100068750 Ga0068856_1000687502 394
163 3300005614 Ga0068856_100151341 Ga0068856_1001513412 394
164 3300006028 Ga0070717_10044518 Ga0070717_100445182 394
165 3300013102 Ga0157371_10060841 Ga0157371_100608412 394
166 3300013105 Ga0157369_10014586 Ga0157369_100145862 394
167 3300013105 Ga0157369_10017225 Ga0157369_100172259 394
168 3300013105 Ga0157369_10047410 Ga0157369_100474105 394
169 3300013296 Ga0157374_10005181 Ga0157374_100051816 394
170 3300013296 Ga0157374_10007272 Ga0157374_100072728 394
171 3300013307 Ga0157372_10074871 Ga0157372_100748712 394
172 3300013307 Ga0157372_10197944 Ga0157372_101979442 394
173 3300014969 Ga0157376_10021442 Ga0157376_100214423 394
174 3300025919 Ga0207657_10079915 Ga0207657_100799152 394
175 3300025949 Ga0207667_10047646 Ga0207667_100476462 394
176 3300026078 Ga0207702_10002673 Ga0207702_1000267314 394
177 3300026078 Ga0207702_10015107 Ga0207702_100151075 394
178 3300026121 Ga0207683_10194324 Ga0207683_101943242 394
179 3300037418 Ga0395900_0039710 Ga0395900_0039710_1959_3191 394
180 3300037466 Ga0395898_0130034 Ga0395898_0130034_887_2119 394
181 3300049573 Ga0501037_0092847 Ga0501037_0092847_454_1686 394
182 3300049581 Ga0501047_0006159 Ga0501047_0006159_7284_8516 394
183 3300049586 Ga0501070_0019276 Ga0501070_0019276_3988_5220 394
184 3300049589 Ga0501073_0122552 Ga0501073_0122552_22_1254 394
185 3300049822 Ga0501035_0003460 Ga0501035_0003460_11740_12972 394
186 3300049823 Ga0501044_0013449 Ga0501044_0013449_2022_3320 394
187 3300005458 Ga0070681_10050656 Ga0070681_100506562 395
188 3300005548 Ga0070665_100156942 Ga0070665_1001569422 395
189 3300013307 Ga0157372_10011561 Ga0157372_100115613 395
190 3300025912 Ga0207707_10128334 Ga0207707_101283341 395
191 3300025929 Ga0207664_10169797 Ga0207664_101697971 395
192 3300025949 Ga0207667_10337900 Ga0207667_103379001 395
193 3300048918 Ga0496115_0061468 Ga0496115_0061468_55_1245 395
194 3300005548 Ga0070665_100042379 Ga0070665_1000423794 396
195 3300005563 Ga0068855_100009593 Ga0068855_1000095936 396
196 3300009545 Ga0105237_10048279 Ga0105237_100482792 396
197 3300013104 Ga0157370_10000754 Ga0157370_1000075412 396
198 3300013105 Ga0157369_10004580 Ga0157369_100045806 396
199 3300036401 Ga0373937_0214018 Ga0373937_0214018_32_1258 396
200 3300044684 Ga0466966_0025415 Ga0466966_0025415_1543_2760 396
201 3300045976 Ga0466967_0332834 Ga0466967_0332834_83_1315 396
202 3300050507 nmdc:mga05p37_371387_c1 nmdc:mga05p37_371387_c1_434_1630 396
203 3300050510 nmdc:mga06r32_2319_c1 nmdc:mga06r32_2319_c1_7032_8228 396
204 3300005535 Ga0070684_100056078 Ga0070684_1000560784 397
205 3300006028 Ga0070717_10116821 Ga0070717_101168213 397
206 3300006175 Ga0070712_100089954 Ga0070712_1000899542 397
207 3300013307 Ga0157372_10099491 Ga0157372_100994914 397
208 3300025915 Ga0207693_10224246 Ga0207693_102242461 397
209 3300025939 Ga0207665_10015236 Ga0207665_100152363 397
210 3300009177 Ga0105248_10170664 Ga0105248_101706644 398
211 3300025931 Ga0207644_10102962 Ga0207644_101029622 398
212 3300005338 Ga0068868_100114630 Ga0068868_1001146304 399
213 3300005327 Ga0070658_10040368 Ga0070658_100403683 400
214 3300005614 Ga0068856_100160040 Ga0068856_1001600401 400
215 3300046472 Ga0495580_0028337 Ga0495580_0028337_2564_3802 400
216 3300046516 Ga0495628_0036978 Ga0495628_0036978_1218_2456 400
217 3300047319 Ga0495674_0004670 Ga0495674_0004670_612_1850 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

67

438

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.9285 11 387
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.9098 11 387
8bxg-assembly1.cif.gz_A structure of the k/h exchanger kefc. 0.8069 4 388
8by2-assembly1.cif.gz_A structure of the k+/h+ exchanger kefc with gsh. 0.8043 4 388
8jd9-assembly1.cif.gz_A cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class1 0.8007 8 384
ID Description Score Start End Superfamily
5bz2A00 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9285 11 387 1.20.1530.20
5bz2A00 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9098 11 387 1.20.1530.20
af_Q0DIK5_28_436_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8967 10 382 1.20.1530.20
af_I1ME88_42_441_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8873 11 381 1.20.1530.20
af_Q9P7I1_23_428_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8822 11 387 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A3A4WD03-F1-model_v4 Cation:proton antiporter 0.949 6 389 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A359LWN6-F1-model_v4 Cation:proton antiporter 0.9465 99 400 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A6I3FNV8-F1-model_v4 Cation/H+ exchanger transmembrane domain-containing protein 0.941 1 384 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A359LWN6-F1-model_v4 Cation:proton antiporter 0.9403 99 400 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A538AIL6-F1-model_v4 Cation/H+ exchanger transmembrane domain-containing protein 0.9329 4 383 GO:0006814
GO:0015297
GO:0016020
GO:1902600

Feature Viewer

pLDDT pTM Quality
80.45 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map