F328542

General Info

Members Datasets Scaffolds Average Seq Length
217 143 434 264

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100904706|Ga0068855_1009047061
Length 284
Sequence VGELALTAQPARRNAAVLMASERQQRKAEAFKALHEGKPFVIPNPWDAGSARALEALGFPALATTSSGFAFSLGRLDGGVTLDEVAAHVSALDAATGLPISVDLEDGFGPEPEDAARAITRVAEAGAVGGSIEDYDRSGRIYERGHAAERVAAAADAVAKLDFPFMLAGRAENHIRDNPDLDDTVGRLQAYEAAGADVLYAPGLRTVDEIRTVCDAVSRPVNVLAVPALSFEEIAGAGAQRVSVGGALTWVAAKAFADAATAIRDRGDFSALAARVPLDEWLGT

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
82 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 12.44
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100904706 3300005563 Bacteria 932
2 JGI25406J46586_10083573 3300003203 Bacteria 975
3 Ga0070660_100017279 3300005339 Bacteria 5255
4 Ga0070659_100222667 3300005366 Unclassified 1558
5 Ga0070659_100684059 3300005366 Bacteria 886
6 Ga0070714_100004096 3300005435 Bacteria 10960
7 Ga0070714_100025230 3300005435 Bacteria 4904
8 Ga0070681_10148574 3300005458 Bacteria 2271
9 Ga0070706_100210015 3300005467 Bacteria 1818
10 Ga0070707_100288932 3300005468 Bacteria 1593
11 Ga0070707_100454953 3300005468 Bacteria 1241
12 Ga0070698_100189110 3300005471 Unclassified 1997
13 Ga0070679_100325705 3300005530 Unclassified 1485
14 Ga0070697_100005160 3300005536 Bacteria 10032
15 Ga0070695_100048547 3300005545 Unclassified 2715
16 Ga0070696_100229166 3300005546 Bacteria 1397
17 Ga0070704_100150933 3300005549 Bacteria 1827
18 Ga0068855_100072581 3300005563 Bacteria 4000
19 Ga0068856_100391268 3300005614 Bacteria 1410
20 Ga0068856_100476083 3300005614 Bacteria 1270
21 Ga0068866_10037311 3300005718 Bacteria 2386
22 Ga0068861_100531765 3300005719 Bacteria 1068
23 Ga0081455_10002959 3300005937 Bacteria 19861
24 Ga0081538_10022175 3300005981 Bacteria 4609
25 Ga0081540_1006862 3300005983 Bacteria 8216
26 Ga0081539_10000062 3300005985 Bacteria 249871
27 Ga0070717_10124151 3300006028 Bacteria 2215
28 Ga0075365_10068254 3300006038 Bacteria 2388
29 Ga0075365_10227587 3300006038 Bacteria 1309
30 Ga0075432_10007842 3300006058 Bacteria 3640
31 Ga0075432_10013707 3300006058 Bacteria 2756
32 Ga0070716_100160737 3300006173 Bacteria 1455
33 Ga0075428_100029563 3300006844 Bacteria 6062
34 Ga0075428_100631219 3300006844 Unclassified 1143
35 Ga0075430_100070097 3300006846 Bacteria 2940
36 Ga0075431_100105710 3300006847 Bacteria 2904
37 Ga0075433_10000426 3300006852 Bacteria 27056
38 Ga0075433_10228301 3300006852 Bacteria 1653
39 Ga0075434_100000203 3300006871 Bacteria 40085
40 Ga0075434_100036081 3300006871 Unclassified 4889
41 Ga0075429_100278715 3300006880 Unclassified 1464
42 Ga0068865_100220797 3300006881 Bacteria 1481
43 Ga0068865_100409741 3300006881 Unclassified 1112
44 Ga0075436_100036477 3300006914 Bacteria 3393
45 Ga0075436_100071140 3300006914 Bacteria 2405
46 Ga0075435_100003314 3300007076 Bacteria 10922
47 Ga0075435_100056822 3300007076 Bacteria 3164
48 Ga0111539_10022676 3300009094 Bacteria 7712
49 Ga0111539_10113401 3300009094 Bacteria 3179
50 Ga0105245_10120791 3300009098 Bacteria 2447
51 Ga0114129_10009830 3300009147 Bacteria 13643
52 Ga0114129_10070349 3300009147 Unclassified 4879
53 Ga0114129_10084319 3300009147 Bacteria 4412
54 Ga0114129_10096983 3300009147 Bacteria 4081
55 Ga0114129_10111047 3300009147 Bacteria 3784
56 Ga0114129_10335956 3300009147 Unclassified 2005
57 Ga0114129_10464802 3300009147 Bacteria 1658
58 Ga0114129_10575625 3300009147 Bacteria 1462
59 Ga0114129_10840898 3300009147 Bacteria 1168
60 Ga0105243_10425227 3300009148 Unclassified 1240
61 Ga0105243_10887046 3300009148 Bacteria 886
62 Ga0105238_10583453 3300009551 Bacteria 1124
63 Ga0105249_10008924 3300009553 Bacteria 8758
64 Ga0105239_10034948 3300010375 Bacteria 5520
65 Ga0105239_10287305 3300010375 Unclassified 1852
66 Ga0163162_10149299 3300013306 Unclassified 2454
67 Ga0163162_10218405 3300013306 Bacteria 2036
68 Ga0157372_10075246 3300013307 Bacteria 3810
69 Ga0182008_10091231 3300014497 Unclassified 1502
70 Ga0157377_10300999 3300014745 Bacteria 1058
71 Ga0163161_10035374 3300017792 Bacteria 3575
72 Ga0206353_11563880 3300020082 Bacteria 2114
73 Ga0207699_10095122 3300025906 Bacteria 1878
74 Ga0207707_10024075 3300025912 Bacteria 5324
75 Ga0207663_10221862 3300025916 Bacteria 1376
76 Ga0207657_10040516 3300025919 Bacteria 4126
77 Ga0207649_10261548 3300025920 Unclassified 1250
78 Ga0207652_10018569 3300025921 Bacteria 5705
79 Ga0207646_10290715 3300025922 Bacteria 1477
80 Ga0207659_10402356 3300025926 Unclassified 1145
81 Ga0207687_10012398 3300025927 Bacteria 5570
82 Ga0207687_10336316 3300025927 Bacteria 1226
83 Ga0207664_10011689 3300025929 Bacteria 6255
84 Ga0207706_10006276 3300025933 Bacteria 11046
85 Ga0207706_10136504 3300025933 Bacteria 2158
86 Ga0207709_10007173 3300025935 Bacteria 6218
87 Ga0207669_10130406 3300025937 Unclassified 1726
88 Ga0207704_10148993 3300025938 Bacteria 1648
89 Ga0207665_10092262 3300025939 Bacteria 2100
90 Ga0207665_10247744 3300025939 Bacteria 1315
91 Ga0207702_10273342 3300026078 Bacteria 1595
92 Ga0207428_10011705 3300027907 Bacteria 7736
93 Ga0207428_10045282 3300027907 Bacteria 3545
94 Ga0268265_10184275 3300028380 Bacteria 1797
95 Ga0265338_10010089 3300028800 Bacteria 11159
96 Ga0265327_10009580 3300031251 Bacteria 6962
97 Ga0307408_100502440 3300031548 Bacteria 1062
98 Ga0307409_100149884 3300031995 Bacteria 2023
99 Ga0307416_100032533 3300032002 Bacteria 3942
100 Ga0307416_100108264 3300032002 Bacteria 2441
101 Ga0373932_0061138 3300035112 Bacteria 1145
102 Ga0373960_0021629 3300035121 Bacteria 1713
103 Ga0395899_0043654 3300037312 Bacteria 3344
104 Ga0395900_0022614 3300037418 Bacteria 6434
105 Ga0395900_0099212 3300037418 Bacteria 2992
106 Ga0395900_0147454 3300037418 Bacteria 2406
107 Ga0395900_0181679 3300037418 Bacteria 2137
108 Ga0395900_0258754 3300037418 Bacteria 1739
109 Ga0395898_0002858 3300037466 Bacteria 19705
110 Ga0395898_0016777 3300037466 Bacteria 7483
111 Ga0395898_0155431 3300037466 Bacteria 2188
112 Ga0395905_0002826 3300037471 Bacteria 19022
113 Ga0395905_0013078 3300037471 Bacteria 7968
114 Ga0395901_0007417 3300038443 Bacteria 11065
115 Ga0395901_0057596 3300038443 Bacteria 4042
116 Ga0395901_0074709 3300038443 Bacteria 3536
117 Ga0395901_0096504 3300038443 Bacteria 3098
118 Ga0395901_0139678 3300038443 Bacteria 2546
119 Ga0395901_0340454 3300038443 Bacteria 1550
120 Ga0436360_1049222 3300039438 Bacteria 2546
121 Ga0436362_0129992 3300039453 Bacteria 2481
122 Ga0451853_2145451 3300041512 Bacteria 1790
123 Ga0439450_040732 3300042008 Bacteria 1078
124 Ga0450910_021276 3300042147 Bacteria 982
125 Ga0439458_0016326 3300042157 Bacteria 1689
126 Ga0466964_0026861 3300044706 Bacteria 2255
127 Ga0466964_0121076 3300044706 Bacteria 1180
128 Ga0466959_0128697 3300045049 Bacteria 1795
129 Ga0466967_0026011 3300045976 Bacteria 4838
130 Ga0466967_0393808 3300045976 Bacteria 1347
131 Ga0466967_0573124 3300045976 Bacteria 1112
132 Ga0466967_0626618 3300045976 Bacteria 1062
133 Ga0495603_0150105 3300046455 Bacteria 1354
134 Ga0495605_0126426 3300046474 Bacteria 1156
135 Ga0495584_0009291 3300046491 Bacteria 5067
136 Ga0495607_0153296 3300046501 Unclassified 1177
137 Ga0495644_0011313 3300046523 Bacteria 3436
138 Ga0495663_0023842 3300046525 Bacteria 1775
139 Ga0495642_0034433 3300046528 Bacteria 2040
140 Ga0495598_0005472 3300046537 Bacteria 2817
141 Ga0495609_0106061 3300046538 Unclassified 1215
142 Ga0495668_0079025 3300046616 Bacteria 1806
143 Ga0495611_0088977 3300046648 Bacteria 1426
144 Ga0495635_0049238 3300046663 Bacteria 2904
145 Ga0495670_0019723 3300046691 Bacteria 3323
146 Ga0495636_0070425 3300047318 Bacteria 1492
147 Ga0495677_0022650 3300047445 Bacteria 2279
148 Ga0496100_0050093 3300048903 Bacteria 2704
149 Ga0496100_0077257 3300048903 Bacteria 2238
150 Ga0496100_0201818 3300048903 Bacteria 1450
151 Ga0496101_0057013 3300048904 Bacteria 2824
152 Ga0496101_0085214 3300048904 Bacteria 2341
153 Ga0496102_0035345 3300048905 Bacteria 4497
154 Ga0496102_0152192 3300048905 Bacteria 2174
155 Ga0496104_0114673 3300048907 Bacteria 2585
156 Ga0496105_0011293 3300048908 Bacteria 7051
157 Ga0496106_0086939 3300048909 Bacteria 2408
158 Ga0496107_0000695 3300048910 Bacteria 19143
159 Ga0496108_0002572 3300048911 Bacteria 14535
160 Ga0496108_0025399 3300048911 Bacteria 4882
161 Ga0496108_0227310 3300048911 Bacteria 1622
162 Ga0496109_0005577 3300048912 Bacteria 10536
163 Ga0496109_0011970 3300048912 Bacteria 7470
164 Ga0496109_0094121 3300048912 Bacteria 2773
165 Ga0496110_0111176 3300048913 Bacteria 2462
166 Ga0496110_0115075 3300048913 Bacteria 2420
167 Ga0496110_0132706 3300048913 Bacteria 2249
168 Ga0496111_0011094 3300048914 Bacteria 6064
169 Ga0496111_0190782 3300048914 Bacteria 1523
170 Ga0496112_0006871 3300048915 Bacteria 10034
171 Ga0496113_0165039 3300048916 Bacteria 1752
172 Ga0496114_0077876 3300048917 Bacteria 2796
173 Ga0496115_0027615 3300048918 Bacteria 4442
174 Ga0496115_0059490 3300048918 Bacteria 3077
175 Ga0501038_0046391 3300049574 Bacteria 3767
176 Ga0501040_0080922 3300049576 Bacteria 2250
177 Ga0501040_0168402 3300049576 Bacteria 1551
178 Ga0501041_0086815 3300049577 Bacteria 1930
179 Ga0501043_0024346 3300049579 Bacteria 4751
180 Ga0501047_0430707 3300049581 Bacteria 1150
181 Ga0501067_0005121 3300049583 Bacteria 7282
182 Ga0501069_0129381 3300049585 Bacteria 1445
183 Ga0501069_0240718 3300049585 Bacteria 1054
184 Ga0501071_0012379 3300049587 Bacteria 5786
185 Ga0501072_0241816 3300049588 Bacteria 1438
186 Ga0501073_0219550 3300049589 Bacteria 1313
187 Ga0501076_0013157 3300049592 Bacteria 6196
188 Ga0501080_0154296 3300049742 Bacteria 2121
189 Ga0501044_0447264 3300049823 Bacteria 1199
190 Ga0501045_0079296 3300049824 Bacteria 2421
191 nmdc:mga0yw44_46159_c1 3300050492 Bacteria 2615
192 nmdc:mga05p37_223271_c1 3300050507 Bacteria 2273
193 nmdc:mga05p37_60583_c1 3300050507 Bacteria 4660
194 nmdc:mga05p37_9681_c1 3300050507 Bacteria 11423
195 nmdc:mga09592_432135_c1 3300050508 Bacteria 1137
196 nmdc:mga09592_97064_c1 3300050508 Bacteria 2522
197 nmdc:mga06r32_161484_c1 3300050510 Bacteria 2223
198 nmdc:mga08y16_543922_c1 3300050511 Unclassified 1176
199 nmdc:mga0n895_269113_c1 3300050512 Bacteria 1729
200 nmdc:mga0n895_37777_c1 3300050512 Unclassified 4674
201 nmdc:mga0n895_390739_c1 3300050512 Bacteria 1407
202 nmdc:mga0rr50_275627_c1 3300050513 Unclassified 1403
203 nmdc:mga0rr50_32511_c1 3300050513 Bacteria 3718
204 nmdc:mga0rr50_54630_c1 3300050513 Bacteria 2977
205 nmdc:mga08x19_29632_c1 3300050514 Bacteria 3433
206 nmdc:mga08x19_59652_c1 3300050514 Bacteria 2470
207 nmdc:mga08x19_9099_c1 3300050514 Bacteria 5931
208 nmdc:mga0a205_104888_c2 3300050515 Unclassified 2297
209 nmdc:mga0a205_17257_c1 3300050515 Bacteria 6763
210 nmdc:mga0a205_2766_c2 3300050515 Bacteria 8671
211 nmdc:mga0a205_51457_c1 3300050515 Bacteria 3977
212 nmdc:mga0a205_72617_c1 3300050515 Bacteria 3325
213 Ga0495655_0008016 3300053083 Bacteria 1990
214 Ga0495655_0026636 3300053083 Bacteria 1364
215 Ga0501084_0017680 3300054114 Bacteria 5931
216 Ga0501082_0019207 3300060353 Bacteria 5889
217 Ga0530510_0020205 3300061734 Bacteria 4736
218 Ga0068855_100904706
219 JGI25406J46586_10083573
220 Ga0070660_100017279
221 Ga0070659_100222667
222 Ga0070659_100684059
223 Ga0070714_100004096
224 Ga0070714_100025230
225 Ga0070681_10148574
226 Ga0070706_100210015
227 Ga0070707_100288932
228 Ga0070707_100454953
229 Ga0070698_100189110
230 Ga0070679_100325705
231 Ga0070697_100005160
232 Ga0070695_100048547
233 Ga0070696_100229166
234 Ga0070704_100150933
235 Ga0068855_100072581
236 Ga0068856_100391268
237 Ga0068856_100476083
238 Ga0068866_10037311
239 Ga0068861_100531765
240 Ga0081455_10002959
241 Ga0081538_10022175
242 Ga0081540_1006862
243 Ga0081539_10000062
244 Ga0070717_10124151
245 Ga0075365_10068254
246 Ga0075365_10227587
247 Ga0075432_10007842
248 Ga0075432_10013707
249 Ga0070716_100160737
250 Ga0075428_100029563
251 Ga0075428_100631219
252 Ga0075430_100070097
253 Ga0075431_100105710
254 Ga0075433_10000426
255 Ga0075433_10228301
256 Ga0075434_100000203
257 Ga0075434_100036081
258 Ga0075429_100278715
259 Ga0068865_100220797
260 Ga0068865_100409741
261 Ga0075436_100036477
262 Ga0075436_100071140
263 Ga0075435_100003314
264 Ga0075435_100056822
265 Ga0111539_10022676
266 Ga0111539_10113401
267 Ga0105245_10120791
268 Ga0114129_10009830
269 Ga0114129_10070349
270 Ga0114129_10084319
271 Ga0114129_10096983
272 Ga0114129_10111047
273 Ga0114129_10335956
274 Ga0114129_10464802
275 Ga0114129_10575625
276 Ga0114129_10840898
277 Ga0105243_10425227
278 Ga0105243_10887046
279 Ga0105238_10583453
280 Ga0105249_10008924
281 Ga0105239_10034948
282 Ga0105239_10287305
283 Ga0163162_10149299
284 Ga0163162_10218405
285 Ga0157372_10075246
286 Ga0182008_10091231
287 Ga0157377_10300999
288 Ga0163161_10035374
289 Ga0206353_11563880
290 Ga0207699_10095122
291 Ga0207707_10024075
292 Ga0207663_10221862
293 Ga0207657_10040516
294 Ga0207649_10261548
295 Ga0207652_10018569
296 Ga0207646_10290715
297 Ga0207659_10402356
298 Ga0207687_10012398
299 Ga0207687_10336316
300 Ga0207664_10011689
301 Ga0207706_10006276
302 Ga0207706_10136504
303 Ga0207709_10007173
304 Ga0207669_10130406
305 Ga0207704_10148993
306 Ga0207665_10092262
307 Ga0207665_10247744
308 Ga0207702_10273342
309 Ga0207428_10011705
310 Ga0207428_10045282
311 Ga0268265_10184275
312 Ga0265338_10010089
313 Ga0265327_10009580
314 Ga0307408_100502440
315 Ga0307409_100149884
316 Ga0307416_100032533
317 Ga0307416_100108264
318 Ga0373932_0061138
319 Ga0373960_0021629
320 Ga0395899_0043654
321 Ga0395900_0022614
322 Ga0395900_0099212
323 Ga0395900_0147454
324 Ga0395900_0181679
325 Ga0395900_0258754
326 Ga0395898_0002858
327 Ga0395898_0016777
328 Ga0395898_0155431
329 Ga0395905_0002826
330 Ga0395905_0013078
331 Ga0395901_0007417
332 Ga0395901_0057596
333 Ga0395901_0074709
334 Ga0395901_0096504
335 Ga0395901_0139678
336 Ga0395901_0340454
337 Ga0436360_1049222
338 Ga0436362_0129992
339 Ga0451853_2145451
340 Ga0439450_040732
341 Ga0450910_021276
342 Ga0439458_0016326
343 Ga0466964_0026861
344 Ga0466964_0121076
345 Ga0466959_0128697
346 Ga0466967_0026011
347 Ga0466967_0393808
348 Ga0466967_0573124
349 Ga0466967_0626618
350 Ga0495603_0150105
351 Ga0495605_0126426
352 Ga0495584_0009291
353 Ga0495607_0153296
354 Ga0495644_0011313
355 Ga0495663_0023842
356 Ga0495642_0034433
357 Ga0495598_0005472
358 Ga0495609_0106061
359 Ga0495668_0079025
360 Ga0495611_0088977
361 Ga0495635_0049238
362 Ga0495670_0019723
363 Ga0495636_0070425
364 Ga0495677_0022650
365 Ga0496100_0050093
366 Ga0496100_0077257
367 Ga0496100_0201818
368 Ga0496101_0057013
369 Ga0496101_0085214
370 Ga0496102_0035345
371 Ga0496102_0152192
372 Ga0496104_0114673
373 Ga0496105_0011293
374 Ga0496106_0086939
375 Ga0496107_0000695
376 Ga0496108_0002572
377 Ga0496108_0025399
378 Ga0496108_0227310
379 Ga0496109_0005577
380 Ga0496109_0011970
381 Ga0496109_0094121
382 Ga0496110_0111176
383 Ga0496110_0115075
384 Ga0496110_0132706
385 Ga0496111_0011094
386 Ga0496111_0190782
387 Ga0496112_0006871
388 Ga0496113_0165039
389 Ga0496114_0077876
390 Ga0496115_0027615
391 Ga0496115_0059490
392 Ga0501038_0046391
393 Ga0501040_0080922
394 Ga0501040_0168402
395 Ga0501041_0086815
396 Ga0501043_0024346
397 Ga0501047_0430707
398 Ga0501067_0005121
399 Ga0501069_0129381
400 Ga0501069_0240718
401 Ga0501071_0012379
402 Ga0501072_0241816
403 Ga0501073_0219550
404 Ga0501076_0013157
405 Ga0501080_0154296
406 Ga0501044_0447264
407 Ga0501045_0079296
408 nmdc:mga0yw44_46159_c1
409 nmdc:mga05p37_223271_c1
410 nmdc:mga05p37_60583_c1
411 nmdc:mga05p37_9681_c1
412 nmdc:mga09592_432135_c1
413 nmdc:mga09592_97064_c1
414 nmdc:mga06r32_161484_c1
415 nmdc:mga08y16_543922_c1
416 nmdc:mga0n895_269113_c1
417 nmdc:mga0n895_37777_c1
418 nmdc:mga0n895_390739_c1
419 nmdc:mga0rr50_275627_c1
420 nmdc:mga0rr50_32511_c1
421 nmdc:mga0rr50_54630_c1
422 nmdc:mga08x19_29632_c1
423 nmdc:mga08x19_59652_c1
424 nmdc:mga08x19_9099_c1
425 nmdc:mga0a205_104888_c2
426 nmdc:mga0a205_17257_c1
427 nmdc:mga0a205_2766_c2
428 nmdc:mga0a205_51457_c1
429 nmdc:mga0a205_72617_c1
430 Ga0495655_0008016
431 Ga0495655_0026636
432 Ga0501084_0017680
433 Ga0501082_0019207
434 Ga0530510_0020205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

31

264

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.974 5 265
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9699 3 263
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9497 9 243
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9459 6 243
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9455 5 265
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9748 3 227 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9498 3 227 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9478 6 227 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.947 6 243 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9193 13 263 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A536EGJ4-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9964 3 264 GO:0016829
AF-A0A7W1D5C7-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9946 6 119 GO:0016829
AF-A0A538MBF2-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.994 6 264 GO:0016829
AF-A0A538M4Z8-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9915 34 264 GO:0016829
AF-A0A2V6PFR3-F1-model_v4 2-methylisocitrate lyase 0.9898 24 178 GO:0016829

Map