F328523

General Info

Members Datasets Scaffolds Average Seq Length
217 157 434 127

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100405074|Ga0070697_1004050742
Length 146
Sequence MTRTHVGSSLHQNPTKEATAMPKVSRDSATQGGDFGPVVDRSDELEGYSVNFTTFREDIDATPLMKGLPDDRCQCPHWGYVVTGKLTFRYADREEVFEAGDAFYTPPGHVPVKHEPGTELLMFSPADELHKTEAVMMKNMQVMQAG

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 0
Rhizoplane 7.37
Rhizosphere 86.18
Stem 0
Stem Tuber 0
Unclassified 13.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100405074 3300005536 Unclassified 1184
2 JGI24735J21928_10226843 3300002067 Bacteria 543
3 JGI25406J46586_10060982 3300003203 Unclassified 1218
4 JGI25406J46586_10123040 3300003203 Bacteria 763
5 rootH1_10298538 3300003323 Unclassified 1127
6 Ga0070658_11285008 3300005327 Unclassified 636
7 Ga0070683_101177206 3300005329 Bacteria 736
8 Ga0070680_100014276 3300005336 Bacteria 6203
9 Ga0070660_100024847 3300005339 Bacteria 4450
10 Ga0070668_100007892 3300005347 Bacteria 7902
11 Ga0070659_100499179 3300005366 Unclassified 1037
12 Ga0070659_100967677 3300005366 Bacteria 746
13 Ga0070667_100009060 3300005367 Bacteria 8238
14 Ga0070710_10693632 3300005437 Bacteria 718
15 Ga0070711_101410864 3300005439 Unclassified 606
16 Ga0070705_100528652 3300005440 Bacteria 900
17 Ga0070705_100642548 3300005440 Unclassified 826
18 Ga0070678_102168671 3300005456 Unclassified 527
19 Ga0070681_10151590 3300005458 Bacteria 2244
20 Ga0070681_10194267 3300005458 Bacteria 1949
21 Ga0068867_100807560 3300005459 Bacteria 837
22 Ga0070698_100694152 3300005471 Bacteria 960
23 Ga0070679_100017423 3300005530 Bacteria 6953
24 Ga0070679_100268311 3300005530 Bacteria 1661
25 Ga0070679_100293610 3300005530 Bacteria 1577
26 Ga0070684_100699142 3300005535 Bacteria 945
27 Ga0070672_100318304 3300005543 Bacteria 1322
28 Ga0070665_100020853 3300005548 Bacteria 6587
29 Ga0070665_102489622 3300005548 Bacteria 519
30 Ga0068857_100911154 3300005577 Bacteria 843
31 Ga0068852_101745236 3300005616 Bacteria 645
32 Ga0068859_100091917 3300005617 Bacteria 3086
33 Ga0068866_11020783 3300005718 Bacteria 589
34 Ga0068863_100530398 3300005841 Bacteria 1161
35 Ga0068860_100353979 3300005843 Bacteria 1445
36 Ga0068862_100008547 3300005844 Bacteria 8470
37 Ga0081455_10122074 3300005937 Unclassified 2051
38 Ga0081455_10184379 3300005937 Bacteria 1577
39 Ga0081539_10006803 3300005985 Bacteria 10712
40 Ga0081539_10023996 3300005985 Bacteria 3973
41 Ga0075368_10002368 3300006042 Bacteria 6132
42 Ga0075368_10510226 3300006042 Bacteria 537
43 Ga0075363_100003388 3300006048 Bacteria 6775
44 Ga0075363_100259978 3300006048 Bacteria 1001
45 Ga0075363_100303940 3300006048 Bacteria 926
46 Ga0075367_10038137 3300006178 Unclassified 2796
47 Ga0075367_10065076 3300006178 Bacteria 2182
48 Ga0068871_101554094 3300006358 Bacteria 626
49 Ga0075430_100709951 3300006846 Bacteria 829
50 Ga0075431_101029707 3300006847 Unclassified 789
51 Ga0075433_10026977 3300006852 Unclassified 4868
52 Ga0075434_100301588 3300006871 Bacteria 1622
53 Ga0068865_101215406 3300006881 Bacteria 667
54 Ga0075436_100291448 3300006914 Unclassified 1168
55 Ga0097620_100091915 3300006931 Bacteria 3086
56 Ga0111539_10018540 3300009094 Bacteria 8620
57 Ga0111539_11425048 3300009094 Bacteria 804
58 Ga0111539_12528823 3300009094 Unclassified 595
59 Ga0105245_10441331 3300009098 Bacteria 1308
60 Ga0105247_10260126 3300009101 Bacteria 1190
61 Ga0105243_12832224 3300009148 Bacteria 525
62 Ga0105242_12577901 3300009176 Bacteria 557
63 Ga0105248_11453960 3300009177 Bacteria 776
64 Ga0105249_10013583 3300009553 Bacteria 7194
65 Ga0105249_12782161 3300009553 Bacteria 561
66 Ga0105246_10508929 3300011119 Bacteria 1024
67 Ga0105246_11280862 3300011119 Bacteria 678
68 Ga0157369_10816902 3300013105 Bacteria 957
69 Ga0157374_10237594 3300013296 Unclassified 1791
70 Ga0163162_10089477 3300013306 Bacteria 3159
71 Ga0157377_10979215 3300014745 Bacteria 639
72 Ga0157379_10004438 3300014968 Bacteria 12029
73 Ga0157379_12606320 3300014968 Bacteria 506
74 Ga0206354_10337384 3300020081 Bacteria 1342
75 Ga0206353_11387456 3300020082 Bacteria 1762
76 Ga0207647_10196685 3300025904 Bacteria 1167
77 Ga0207643_10277066 3300025908 Bacteria 1039
78 Ga0207705_10697116 3300025909 Unclassified 789
79 Ga0207707_10057189 3300025912 Bacteria 3395
80 Ga0207707_10297562 3300025912 Bacteria 1396
81 Ga0207663_11052519 3300025916 Bacteria 653
82 Ga0207660_10133238 3300025917 Bacteria 1893
83 Ga0207657_10058178 3300025919 Bacteria 3327
84 Ga0207652_10041558 3300025921 Bacteria 3909
85 Ga0207652_10314037 3300025921 Bacteria 1415
86 Ga0207652_10687347 3300025921 Bacteria 914
87 Ga0207650_10662002 3300025925 Bacteria 881
88 Ga0207700_11649397 3300025928 Bacteria 566
89 Ga0207664_10601356 3300025929 Bacteria 988
90 Ga0207709_10317186 3300025935 Bacteria 1165
91 Ga0207661_10823493 3300025944 Bacteria 855
92 Ga0207679_10787871 3300025945 Bacteria 866
93 Ga0207712_10232764 3300025961 Bacteria 1480
94 Ga0207640_11333396 3300025981 Bacteria 641
95 Ga0207658_10007124 3300025986 Bacteria 7615
96 Ga0207677_11001313 3300026023 Bacteria 758
97 Ga0207703_10591974 3300026035 Bacteria 1048
98 Ga0207708_10497272 3300026075 Bacteria 1021
99 Ga0207676_10583364 3300026095 Bacteria 1072
100 Ga0207676_10958080 3300026095 Bacteria 842
101 Ga0209813_10200796 3300027866 Unclassified 738
102 Ga0209813_10396700 3300027866 Bacteria 555
103 Ga0207428_10261175 3300027907 Bacteria 1290
104 Ga0268265_11470293 3300028380 Bacteria 684
105 Ga0268264_10021711 3300028381 Bacteria 5241
106 Ga0268264_11278085 3300028381 Unclassified 744
107 Ga0307408_100003901 3300031548 Bacteria 10156
108 Ga0307408_100513631 3300031548 Bacteria 1051
109 Ga0307408_100663658 3300031548 Bacteria 934
110 Ga0307405_10100164 3300031731 Bacteria 1941
111 Ga0307410_10001931 3300031852 Bacteria 9724
112 Ga0307410_11504664 3300031852 Bacteria 593
113 Ga0307406_10000514 3300031901 Bacteria 22283
114 Ga0307406_10258835 3300031901 Bacteria 1315
115 Ga0307407_10006467 3300031903 Bacteria 5211
116 Ga0307407_11674592 3300031903 Bacteria 506
117 Ga0307409_100000805 3300031995 Bacteria 14339
118 Ga0307409_101269178 3300031995 Bacteria 761
119 Ga0307416_100000565 3300032002 Bacteria 18929
120 Ga0307416_100495474 3300032002 Bacteria 1285
121 Ga0307416_100600328 3300032002 Bacteria 1180
122 Ga0307411_10077702 3300032005 Bacteria 2273
123 Ga0307415_100001662 3300032126 Bacteria 10796
124 Ga0307415_100518159 3300032126 Bacteria 1046
125 Ga0307415_100981466 3300032126 Bacteria 784
126 Ga0373928_0079227 3300035084 Bacteria 826
127 Ga0373952_0118818 3300035092 Bacteria 715
128 Ga0373932_0061856 3300035112 Bacteria 1140
129 Ga0373962_0140024 3300035242 Bacteria 785
130 Ga0373931_0009973 3300035691 Bacteria 4554
131 Ga0373935_0525998 3300035692 Bacteria 860
132 Ga0373947_0144335 3300035725 Bacteria 1529
133 Ga0395899_0250394 3300037312 Bacteria 1216
134 Ga0395900_1225946 3300037418 Bacteria 665
135 Ga0395898_0263994 3300037466 Bacteria 1642
136 Ga0395901_0034513 3300038443 Bacteria 5224
137 Ga0395901_0447281 3300038443 Unclassified 1322
138 Ga0395901_0965552 3300038443 Bacteria 830
139 Ga0395901_1875350 3300038443 Bacteria 547
140 Ga0451802_2164703 3300041460 Unclassified 676
141 Ga0451839_1492882 3300041496 Bacteria 720
142 Ga0439448_0046885 3300042005 Bacteria 1409
143 Ga0439455_0015729 3300042012 Bacteria 1742
144 Ga0439464_0044601 3300042439 Unclassified 1270
145 Ga0439460_0005781 3300042461 Bacteria 3047
146 Ga0466972_0034771 3300044658 Bacteria 2467
147 Ga0466961_0025924 3300044693 Bacteria 3768
148 Ga0466961_0521483 3300044693 Bacteria 717
149 Ga0466963_0002518 3300044694 Bacteria 10256
150 Ga0466964_0010790 3300044706 Unclassified 3449
151 Ga0466964_0064807 3300044706 Bacteria 1529
152 Ga0466964_0578303 3300044706 Bacteria 613
153 Ga0466971_0474847 3300044719 Bacteria 615
154 Ga0466971_0581328 3300044719 Bacteria 557
155 Ga0466968_0272738 3300044735 Bacteria 808
156 Ga0466970_0120753 3300044765 Bacteria 1435
157 Ga0466957_0069966 3300044842 Bacteria 2168
158 Ga0466959_0411755 3300045049 Unclassified 918
159 Ga0466958_0011558 3300045836 Bacteria 4974
160 Ga0466958_0038483 3300045836 Bacteria 2870
161 Ga0466958_0071785 3300045836 Bacteria 2120
162 Ga0466967_0066267 3300045976 Bacteria 3217
163 Ga0466967_0103257 3300045976 Bacteria 2608
164 Ga0466967_0124127 3300045976 Bacteria 2390
165 Ga0466967_0456816 3300045976 Bacteria 1249
166 Ga0466967_0532933 3300045976 Bacteria 1155
167 Ga0466967_0861142 3300045976 Bacteria 901
168 Ga0466967_1478523 3300045976 Bacteria 677
169 Ga0495603_0298745 3300046455 Bacteria 925
170 Ga0495641_0372607 3300046461 Bacteria 647
171 Ga0495639_0110855 3300046475 Bacteria 1302
172 Ga0495584_0242412 3300046491 Bacteria 917
173 Ga0495628_0759137 3300046516 Bacteria 681
174 Ga0495599_0219186 3300046678 Bacteria 1165
175 Ga0495672_0146748 3300047320 Unclassified 1227
176 Ga0495684_0310606 3300047471 Bacteria 1130
177 Ga0496100_0222178 3300048903 Bacteria 1387
178 Ga0496101_1291038 3300048904 Bacteria 571
179 Ga0496104_0112123 3300048907 Bacteria 2615
180 Ga0496104_0297653 3300048907 Unclassified 1526
181 Ga0496104_0522444 3300048907 Bacteria 1098
182 Ga0496105_1179298 3300048908 Unclassified 565
183 Ga0496108_0038859 3300048911 Bacteria 3966
184 Ga0496108_1549647 3300048911 Bacteria 550
185 Ga0496109_0056302 3300048912 Bacteria 3588
186 Ga0496109_0435396 3300048912 Bacteria 1239
187 Ga0496109_0879921 3300048912 Bacteria 834
188 Ga0496110_0521185 3300048913 Bacteria 1081
189 Ga0496110_1163123 3300048913 Bacteria 680
190 Ga0496111_0063448 3300048914 Bacteria 2679
191 Ga0496112_1509820 3300048915 Bacteria 586
192 Ga0501036_0728270 3300049572 Bacteria 819
193 Ga0501036_1595245 3300049572 Bacteria 527
194 Ga0501067_0011843 3300049583 Bacteria 4833
195 Ga0501067_0048709 3300049583 Unclassified 2350
196 Ga0501068_0265849 3300049584 Unclassified 1095
197 Ga0501069_0011768 3300049585 Bacteria 4639
198 Ga0501069_0025140 3300049585 Bacteria 3253
199 Ga0501070_0756542 3300049586 Bacteria 765
200 Ga0501071_0852618 3300049587 Bacteria 703
201 Ga0501076_0444697 3300049592 Bacteria 1067
202 Ga0501202_243702 3300049652 Bacteria 504
203 nmdc:mga03n38_268805_c1 3300050490 Bacteria 906
204 nmdc:mga06z11_167396_c1 3300050494 Bacteria 1260
205 nmdc:mga04h51_80545_c1 3300050495 Bacteria 1155
206 nmdc:mga0qj67_223797_c1 3300050509 Bacteria 1527
207 nmdc:mga06r32_1333548_c1 3300050510 Unclassified 661
208 nmdc:mga08y16_35532_c1 3300050511 Bacteria 5233
209 nmdc:mga08y16_397255_c1 3300050511 Bacteria 1411
210 nmdc:mga0n895_282721_c1 3300050512 Bacteria 1682
211 nmdc:mga08x19_316647_c1 3300050514 Unclassified 1085
212 nmdc:mga0a205_352868_c1 3300050515 Bacteria 1338
213 Ga0495601_0277021 3300053077 Bacteria 1094
214 Ga0495619_0100817 3300053085 Bacteria 1965
215 Ga0466962_0113778 3300061719 Bacteria 1303
216 Ga0466962_0515956 3300061719 Bacteria 605
217 Ga0530510_0509100 3300061734 Bacteria 913
218 Ga0070697_100405074
219 JGI24735J21928_10226843
220 JGI25406J46586_10060982
221 JGI25406J46586_10123040
222 rootH1_10298538
223 Ga0070658_11285008
224 Ga0070683_101177206
225 Ga0070680_100014276
226 Ga0070660_100024847
227 Ga0070668_100007892
228 Ga0070659_100499179
229 Ga0070659_100967677
230 Ga0070667_100009060
231 Ga0070710_10693632
232 Ga0070711_101410864
233 Ga0070705_100528652
234 Ga0070705_100642548
235 Ga0070678_102168671
236 Ga0070681_10151590
237 Ga0070681_10194267
238 Ga0068867_100807560
239 Ga0070698_100694152
240 Ga0070679_100017423
241 Ga0070679_100268311
242 Ga0070679_100293610
243 Ga0070684_100699142
244 Ga0070672_100318304
245 Ga0070665_100020853
246 Ga0070665_102489622
247 Ga0068857_100911154
248 Ga0068852_101745236
249 Ga0068859_100091917
250 Ga0068866_11020783
251 Ga0068863_100530398
252 Ga0068860_100353979
253 Ga0068862_100008547
254 Ga0081455_10122074
255 Ga0081455_10184379
256 Ga0081539_10006803
257 Ga0081539_10023996
258 Ga0075368_10002368
259 Ga0075368_10510226
260 Ga0075363_100003388
261 Ga0075363_100259978
262 Ga0075363_100303940
263 Ga0075367_10038137
264 Ga0075367_10065076
265 Ga0068871_101554094
266 Ga0075430_100709951
267 Ga0075431_101029707
268 Ga0075433_10026977
269 Ga0075434_100301588
270 Ga0068865_101215406
271 Ga0075436_100291448
272 Ga0097620_100091915
273 Ga0111539_10018540
274 Ga0111539_11425048
275 Ga0111539_12528823
276 Ga0105245_10441331
277 Ga0105247_10260126
278 Ga0105243_12832224
279 Ga0105242_12577901
280 Ga0105248_11453960
281 Ga0105249_10013583
282 Ga0105249_12782161
283 Ga0105246_10508929
284 Ga0105246_11280862
285 Ga0157369_10816902
286 Ga0157374_10237594
287 Ga0163162_10089477
288 Ga0157377_10979215
289 Ga0157379_10004438
290 Ga0157379_12606320
291 Ga0206354_10337384
292 Ga0206353_11387456
293 Ga0207647_10196685
294 Ga0207643_10277066
295 Ga0207705_10697116
296 Ga0207707_10057189
297 Ga0207707_10297562
298 Ga0207663_11052519
299 Ga0207660_10133238
300 Ga0207657_10058178
301 Ga0207652_10041558
302 Ga0207652_10314037
303 Ga0207652_10687347
304 Ga0207650_10662002
305 Ga0207700_11649397
306 Ga0207664_10601356
307 Ga0207709_10317186
308 Ga0207661_10823493
309 Ga0207679_10787871
310 Ga0207712_10232764
311 Ga0207640_11333396
312 Ga0207658_10007124
313 Ga0207677_11001313
314 Ga0207703_10591974
315 Ga0207708_10497272
316 Ga0207676_10583364
317 Ga0207676_10958080
318 Ga0209813_10200796
319 Ga0209813_10396700
320 Ga0207428_10261175
321 Ga0268265_11470293
322 Ga0268264_10021711
323 Ga0268264_11278085
324 Ga0307408_100003901
325 Ga0307408_100513631
326 Ga0307408_100663658
327 Ga0307405_10100164
328 Ga0307410_10001931
329 Ga0307410_11504664
330 Ga0307406_10000514
331 Ga0307406_10258835
332 Ga0307407_10006467
333 Ga0307407_11674592
334 Ga0307409_100000805
335 Ga0307409_101269178
336 Ga0307416_100000565
337 Ga0307416_100495474
338 Ga0307416_100600328
339 Ga0307411_10077702
340 Ga0307415_100001662
341 Ga0307415_100518159
342 Ga0307415_100981466
343 Ga0373928_0079227
344 Ga0373952_0118818
345 Ga0373932_0061856
346 Ga0373962_0140024
347 Ga0373931_0009973
348 Ga0373935_0525998
349 Ga0373947_0144335
350 Ga0395899_0250394
351 Ga0395900_1225946
352 Ga0395898_0263994
353 Ga0395901_0034513
354 Ga0395901_0447281
355 Ga0395901_0965552
356 Ga0395901_1875350
357 Ga0451802_2164703
358 Ga0451839_1492882
359 Ga0439448_0046885
360 Ga0439455_0015729
361 Ga0439464_0044601
362 Ga0439460_0005781
363 Ga0466972_0034771
364 Ga0466961_0025924
365 Ga0466961_0521483
366 Ga0466963_0002518
367 Ga0466964_0010790
368 Ga0466964_0064807
369 Ga0466964_0578303
370 Ga0466971_0474847
371 Ga0466971_0581328
372 Ga0466968_0272738
373 Ga0466970_0120753
374 Ga0466957_0069966
375 Ga0466959_0411755
376 Ga0466958_0011558
377 Ga0466958_0038483
378 Ga0466958_0071785
379 Ga0466967_0066267
380 Ga0466967_0103257
381 Ga0466967_0124127
382 Ga0466967_0456816
383 Ga0466967_0532933
384 Ga0466967_0861142
385 Ga0466967_1478523
386 Ga0495603_0298745
387 Ga0495641_0372607
388 Ga0495639_0110855
389 Ga0495584_0242412
390 Ga0495628_0759137
391 Ga0495599_0219186
392 Ga0495672_0146748
393 Ga0495684_0310606
394 Ga0496100_0222178
395 Ga0496101_1291038
396 Ga0496104_0112123
397 Ga0496104_0297653
398 Ga0496104_0522444
399 Ga0496105_1179298
400 Ga0496108_0038859
401 Ga0496108_1549647
402 Ga0496109_0056302
403 Ga0496109_0435396
404 Ga0496109_0879921
405 Ga0496110_0521185
406 Ga0496110_1163123
407 Ga0496111_0063448
408 Ga0496112_1509820
409 Ga0501036_0728270
410 Ga0501036_1595245
411 Ga0501067_0011843
412 Ga0501067_0048709
413 Ga0501068_0265849
414 Ga0501069_0011768
415 Ga0501069_0025140
416 Ga0501070_0756542
417 Ga0501071_0852618
418 Ga0501076_0444697
419 Ga0501202_243702
420 nmdc:mga03n38_268805_c1
421 nmdc:mga06z11_167396_c1
422 nmdc:mga04h51_80545_c1
423 nmdc:mga0qj67_223797_c1
424 nmdc:mga06r32_1333548_c1
425 nmdc:mga08y16_35532_c1
426 nmdc:mga08y16_397255_c1
427 nmdc:mga0n895_282721_c1
428 nmdc:mga08x19_316647_c1
429 nmdc:mga0a205_352868_c1
430 Ga0495601_0277021
431 Ga0495619_0100817
432 Ga0466962_0113778
433 Ga0466962_0515956
434 Ga0530510_0509100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

73

119

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i45-assembly1.cif.gz_A crystal structure of protein nmb1881 from neisseria meningitidis 0.7643 19 104
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.7583 19 104
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.7558 9 105
7w2h-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7508 18 120
7w2h-assembly5.cif.gz_M error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7497 18 120
ID Description Score Start End Superfamily
1qwrB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7504 12 102 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7492 10 105 2.60.120.10
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7487 18 104 2.60.120.10
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7382 32 107 2.60.120.10
af_A0A1D6L414_250_358_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7336 18 106 2.60.120.10
ID Description Score Start End GO Terms
AF-I0I142-F1-model_v4 Cupin type-2 domain-containing protein 0.9831 13 123
AF-A0A7V9I3Q4-F1-model_v4 Cupin domain-containing protein 0.979 1 111
AF-A0A535YRN8-F1-model_v4 Cupin domain-containing protein 0.9781 1 123
AF-A0A139CP31-F1-model_v4 Cupin domain-containing protein 0.9775 3 123
AF-A0A4R6KL93-F1-model_v4 Cupin domain-containing protein 0.9768 1 121

Map