F328449

General Info

Members Datasets Scaffolds Average Seq Length
217 121 216 254

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100022958|Ga0070667_1000229587
Length 244
Sequence VSRWTAFLLAGSRPKGDPLAQSMMLGHKALIPVAGEPMVLRPLRALLASPEVGKVIVLTQTPEDLRPVLPDDERVSIRKSGGTIAQEFPVLVVTADHALLDPAMVAEFTRQAEGADLAIAVVESKPLLARFPHTKRTWIGFKGGRYSGANLFAFGSDKVLPAVGRWGQVEQDRKKGWRLLAALGPALLLGAVLKLRTIHESATAIGRKLGIAIRIVEMSNPIAAIDVDKPLDHALVEDIIAGRA

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
120 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.38
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1001216 3300002076 Bacteria 3658
2 Ga0065715_10002451 3300005293 Bacteria 6564
3 Ga0070658_10381385 3300005327 Bacteria 1209
4 Ga0070683_100067982 3300005329 Bacteria 3319
5 Ga0070670_100002912 3300005331 Bacteria 14169
6 Ga0070670_100004461 3300005331 Bacteria 11725
7 Ga0070677_10014739 3300005333 Bacteria 2757
8 Ga0070661_100279462 3300005344 Bacteria 1295
9 Ga0070668_100001233 3300005347 Bacteria 18223
10 Ga0070668_100069802 3300005347 Bacteria 2734
11 Ga0070668_100077837 3300005347 Bacteria 2593
12 Ga0070669_100001336 3300005353 Bacteria 17789
13 Ga0070669_100030104 3300005353 Bacteria 3915
14 Ga0070675_100018057 3300005354 Bacteria 5614
15 Ga0070671_100006778 3300005355 Bacteria 9164
16 Ga0070671_100007152 3300005355 Bacteria 8920
17 Ga0070671_100170257 3300005355 Bacteria 1842
18 Ga0070674_100002530 3300005356 Bacteria 10127
19 Ga0070673_100181122 3300005364 Bacteria 1804
20 Ga0070667_100019142 3300005367 Bacteria 5677
21 Ga0070667_100022958 3300005367 Bacteria 5173
22 Ga0070705_100113139 3300005440 Bacteria 1738
23 Ga0070662_100010496 3300005457 Bacteria 6081
24 Ga0070662_100166832 3300005457 Bacteria 1726
25 Ga0070681_10024986 3300005458 Bacteria 6010
26 Ga0070681_10220129 3300005458 Bacteria 1813
27 Ga0068867_100207695 3300005459 Bacteria 1571
28 Ga0070679_100315484 3300005530 Bacteria 1513
29 Ga0070684_100002906 3300005535 Bacteria 12729
30 Ga0070684_100016900 3300005535 Bacteria 5976
31 Ga0068853_100171579 3300005539 Bacteria 1963
32 Ga0070672_100003449 3300005543 Bacteria 10241
33 Ga0070686_100129337 3300005544 Bacteria 1744
34 Ga0070693_100076299 3300005547 Bacteria 1986
35 Ga0068855_100074145 3300005563 Bacteria 3953
36 Ga0070664_100000738 3300005564 Bacteria 25207
37 Ga0070664_100022704 3300005564 Bacteria 5174
38 Ga0068857_100121861 3300005577 Bacteria 2348
39 Ga0068857_100386696 3300005577 Bacteria 1300
40 Ga0068854_100215666 3300005578 Bacteria 1516
41 Ga0068854_100222947 3300005578 Bacteria 1492
42 Ga0068856_100546525 3300005614 Bacteria 1179
43 Ga0068852_100024031 3300005616 Bacteria 4918
44 Ga0068859_100205101 3300005617 Bacteria 2056
45 Ga0068864_100144736 3300005618 Bacteria 2148
46 Ga0068861_100010148 3300005719 Bacteria 6532
47 Ga0068863_100000124 3300005841 Bacteria 80821
48 Ga0068860_100418149 3300005843 Bacteria 1328
49 Ga0068862_100005615 3300005844 Bacteria 10483
50 Ga0068862_100107633 3300005844 Bacteria 2444
51 Ga0068862_100111076 3300005844 Bacteria 2406
52 Ga0068862_100182133 3300005844 Bacteria 1886
53 Ga0068862_100210674 3300005844 Bacteria 1756
54 Ga0081539_10089000 3300005985 Bacteria 1600
55 Ga0097620_100205109 3300006931 Bacteria 2056
56 Ga0105240_10122662 3300009093 Bacteria 3127
57 Ga0111539_10076568 3300009094 Bacteria 3939
58 Ga0105243_10153493 3300009148 Bacteria 1978
59 Ga0105248_10213377 3300009177 Bacteria 2175
60 Ga0105249_10014300 3300009553 Bacteria 7018
61 Ga0157373_10055379 3300013100 Bacteria 2817
62 Ga0157373_10222940 3300013100 Bacteria 1330
63 Ga0157371_10071442 3300013102 Bacteria 2457
64 Ga0157371_10250459 3300013102 Bacteria 1275
65 Ga0157371_10312155 3300013102 Bacteria 1140
66 Ga0157371_10379999 3300013102 Bacteria 1031
67 Ga0157370_10200971 3300013104 Bacteria 1849
68 Ga0157369_10022824 3300013105 Bacteria 6977
69 Ga0157369_10372564 3300013105 Bacteria 1482
70 Ga0157369_10494357 3300013105 Bacteria 1266
71 Ga0157372_10472466 3300013307 Bacteria 1462
72 Ga0157375_10092566 3300013308 Bacteria 3087
73 Ga0157375_10784831 3300013308 Bacteria 1102
74 Ga0157380_10000643 3300014326 Bacteria 21584
75 Ga0157380_10122235 3300014326 Bacteria 2207
76 Ga0157380_10260850 3300014326 Bacteria 1574
77 Ga0206356_11573067 3300020070 Bacteria 1219
78 Ga0206354_10559906 3300020081 Bacteria 1653
79 Ga0206353_11864049 3300020082 Bacteria 2482
80 Ga0207697_10000539 3300025315 Bacteria 21478
81 Ga0207682_10000642 3300025893 Bacteria 16290
82 Ga0207680_10331191 3300025903 Bacteria 1066
83 Ga0207647_10090457 3300025904 Bacteria 1826
84 Ga0207705_10002088 3300025909 Bacteria 15529
85 Ga0207707_10034836 3300025912 Bacteria 4404
86 Ga0207707_10083448 3300025912 Bacteria 2790
87 Ga0207660_10004417 3300025917 Bacteria 9165
88 Ga0207660_10216099 3300025917 Bacteria 1503
89 Ga0207657_10120206 3300025919 Bacteria 2162
90 Ga0207657_10214748 3300025919 Bacteria 1542
91 Ga0207649_10139862 3300025920 Bacteria 1655
92 Ga0207681_10188917 3300025923 Bacteria 1574
93 Ga0207650_10003074 3300025925 Bacteria 11492
94 Ga0207650_10004132 3300025925 Bacteria 9920
95 Ga0207650_10008625 3300025925 Bacteria 6961
96 Ga0207644_10000063 3300025931 Bacteria 78017
97 Ga0207644_10004118 3300025931 Bacteria 9426
98 Ga0207644_10189629 3300025931 Bacteria 1616
99 Ga0207706_10000181 3300025933 Bacteria 70177
100 Ga0207691_10004598 3300025940 Bacteria 13362
101 Ga0207661_10016987 3300025944 Bacteria 5375
102 Ga0207679_10000677 3300025945 Bacteria 22872
103 Ga0207679_10026998 3300025945 Bacteria 3966
104 Ga0207667_10046983 3300025949 Bacteria 4571
105 Ga0207667_10396005 3300025949 Bacteria 1406
106 Ga0207712_10045152 3300025961 Bacteria 3050
107 Ga0207712_10312392 3300025961 Bacteria 1294
108 Ga0207668_10036332 3300025972 Bacteria 3286
109 Ga0207668_10057231 3300025972 Bacteria 2719
110 Ga0207668_10094595 3300025972 Bacteria 2203
111 Ga0207640_10123265 3300025981 Bacteria 1861
112 Ga0207640_10125867 3300025981 Bacteria 1845
113 Ga0207640_10374065 3300025981 Bacteria 1152
114 Ga0207658_10072815 3300025986 Bacteria 2606
115 Ga0207678_10049415 3300026067 Bacteria 3635
116 Ga0207708_10283165 3300026075 Bacteria 1344
117 Ga0207702_10015308 3300026078 Bacteria 6358
118 Ga0207641_10000193 3300026088 Bacteria 83308
119 Ga0207648_10097439 3300026089 Bacteria 2574
120 Ga0207676_10813079 3300026095 Bacteria 912
121 Ga0207674_10193292 3300026116 Bacteria 1985
122 Ga0207674_10256952 3300026116 Bacteria 1694
123 Ga0207674_10390218 3300026116 Bacteria 1346
124 Ga0207675_100017788 3300026118 Bacteria 6632
125 Ga0207698_10062073 3300026142 Bacteria 2916
126 Ga0207698_10387304 3300026142 Bacteria 1332
127 Ga0209974_10006288 3300027876 Bacteria 4150
128 Ga0268265_10165253 3300028380 Bacteria 1885
129 Ga0268265_10168044 3300028380 Bacteria 1871
130 Ga0307408_100179803 3300031548 Bacteria 1695
131 Ga0307405_10004103 3300031731 Bacteria 6845
132 Ga0307405_10030332 3300031731 Bacteria 3170
133 Ga0307405_10073395 3300031731 Bacteria 2209
134 Ga0307405_10125932 3300031731 Bacteria 1761
135 Ga0307405_10170990 3300031731 Bacteria 1550
136 Ga0307413_10006135 3300031824 Bacteria 5455
137 Ga0307413_10023605 3300031824 Bacteria 3335
138 Ga0307413_10052679 3300031824 Bacteria 2459
139 Ga0307413_10124547 3300031824 Bacteria 1752
140 Ga0307413_10367156 3300031824 Bacteria 1116
141 Ga0307410_10035238 3300031852 Bacteria 3248
142 Ga0307406_10064241 3300031901 Bacteria 2381
143 Ga0307406_10213554 3300031901 Bacteria 1429
144 Ga0307407_10005573 3300031903 Bacteria 5482
145 Ga0307407_10069905 3300031903 Bacteria 2085
146 Ga0307407_10102958 3300031903 Bacteria 1776
147 Ga0307407_10115004 3300031903 Bacteria 1695
148 Ga0307407_10153509 3300031903 Bacteria 1499
149 Ga0307407_10224859 3300031903 Bacteria 1271
150 Ga0307412_10024395 3300031911 Bacteria 3732
151 Ga0307412_10049498 3300031911 Bacteria 2769
152 Ga0307412_10053966 3300031911 Bacteria 2666
153 Ga0307412_10068927 3300031911 Bacteria 2406
154 Ga0307412_10109945 3300031911 Bacteria 1966
155 Ga0307412_10178304 3300031911 Bacteria 1595
156 Ga0307412_10473405 3300031911 Bacteria 1037
157 Ga0307409_100007426 3300031995 Bacteria 6554
158 Ga0307409_100118511 3300031995 Bacteria 2236
159 Ga0307409_100135895 3300031995 Bacteria 2110
160 Ga0307409_100175546 3300031995 Bacteria 1890
161 Ga0307409_100194630 3300031995 Bacteria 1808
162 Ga0307409_100245584 3300031995 Bacteria 1633
163 Ga0307409_100488361 3300031995 Bacteria 1196
164 Ga0307416_100063669 3300032002 Bacteria 3021
165 Ga0307416_100082527 3300032002 Bacteria 2723
166 Ga0307416_100106276 3300032002 Bacteria 2460
167 Ga0307416_100396209 3300032002 Bacteria 1416
168 Ga0307414_10000431 3300032004 Bacteria 22356
169 Ga0307414_10006788 3300032004 Bacteria 6403
170 Ga0307414_10032283 3300032004 Bacteria 3446
171 Ga0307414_10253146 3300032004 Bacteria 1465
172 Ga0307414_10735968 3300032004 Bacteria 895
173 Ga0307411_10003375 3300032005 Bacteria 7396
174 Ga0307411_10011156 3300032005 Bacteria 4833
175 Ga0307411_10021216 3300032005 Bacteria 3795
176 Ga0307411_10068510 3300032005 Bacteria 2392
177 Ga0307411_10130872 3300032005 Bacteria 1833
178 Ga0307411_10344357 3300032005 Bacteria 1212
179 Ga0307411_10417610 3300032005 Bacteria 1113
180 Ga0307411_10517110 3300032005 Bacteria 1012
181 Ga0307415_100034129 3300032126 Bacteria 3309
182 Ga0307415_100105723 3300032126 Bacteria 2076
183 Ga0307415_100314875 3300032126 Bacteria 1302
184 Ga0395899_0027658 3300037312 Bacteria 4273
185 Ga0395899_0039265 3300037312 Bacteria 3544
186 Ga0395900_0000336 3300037418 Bacteria 69212
187 Ga0395900_0005712 3300037418 Bacteria 13000
188 Ga0395900_0037239 3300037418 Bacteria 5017
189 Ga0395898_0089811 3300037466 Bacteria 2956
190 Ga0395905_0001121 3300037471 Bacteria 33589
191 Ga0395905_0018628 3300037471 Bacteria 6584
192 Ga0395905_0039720 3300037471 Bacteria 4415
193 Ga0395901_0000398 3300038443 Bacteria 51885
194 Ga0395901_0002173 3300038443 Bacteria 20032
195 Ga0395901_0006187 3300038443 Bacteria 12128
196 Ga0395901_0299820 3300038443 Bacteria 1666
197 Ga0439453_0026581 3300041408 Bacteria 1073
198 Ga0439445_0000343 3300042004 Bacteria 9186
199 Ga0439464_0017860 3300042439 Bacteria 1927
200 Ga0466967_0022731 3300045976 Bacteria 5124
201 Ga0495621_0007593 3300046539 Bacteria 3218
202 Ga0495668_0030159 3300046616 Bacteria 3064
203 Ga0495659_0024685 3300046664 Bacteria 2052
204 Ga0495659_0027313 3300046664 Bacteria 1968
205 Ga0495669_0013815 3300046684 Bacteria 3447
206 Ga0495670_0008019 3300046691 Bacteria 5190
207 Ga0495670_0027257 3300046691 Bacteria 2830
208 Ga0495636_0231852 3300047318 Bacteria 850
209 Ga0495677_0032070 3300047445 Bacteria 1913
210 Ga0496108_0000483 3300048911 Bacteria 31924
211 Ga0496122_0001118 3300048925 Bacteria 46231
212 Ga0496123_0004885 3300048926 Bacteria 13779
213 Ga0496124_0010035 3300048927 Bacteria 9664
214 Ga0501249_029246 3300049679 Bacteria 1225
215 Ga0501268_001568 3300049765 Bacteria 2874
216 nmdc:mga0n895_588057_c1 3300050512 Bacteria 1116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10813079 Ga0207676_108130792 224
2 3300005327 Ga0070658_10381385 Ga0070658_103813852 232
3 3300005985 Ga0081539_10089000 Ga0081539_100890002 233
4 3300031995 Ga0307409_100245584 Ga0307409_1002455842 240
5 3300032004 Ga0307414_10000431 Ga0307414_100004313 240
6 3300032005 Ga0307411_10011156 Ga0307411_100111563 240
7 3300005367 Ga0070667_100022958 Ga0070667_1000229587 244
8 3300025903 Ga0207680_10331191 Ga0207680_103311912 244
9 3300025986 Ga0207658_10072815 Ga0207658_100728152 244
10 3300013105 Ga0157369_10372564 Ga0157369_103725642 248
11 3300031548 Ga0307408_100179803 Ga0307408_1001798032 248
12 3300031731 Ga0307405_10030332 Ga0307405_100303323 248
13 iso_pu_bacteria 2896429255 2896431428 251
14 3300031731 Ga0307405_10125932 Ga0307405_101259322 253
15 3300031824 Ga0307413_10124547 Ga0307413_101245472 253
16 3300031995 Ga0307409_100488361 Ga0307409_1004883611 253
17 3300032005 Ga0307411_10517110 Ga0307411_105171102 253
18 3300032126 Ga0307415_100105723 Ga0307415_1001057232 253
19 3300005329 Ga0070683_100067982 Ga0070683_1000679823 254
20 3300005458 Ga0070681_10024986 Ga0070681_100249866 254
21 3300005530 Ga0070679_100315484 Ga0070679_1003154842 254
22 3300005535 Ga0070684_100002906 Ga0070684_1000029064 254
23 3300005535 Ga0070684_100016900 Ga0070684_1000169007 254
24 3300005563 Ga0068855_100074145 Ga0068855_1000741452 254
25 3300005578 Ga0068854_100222947 Ga0068854_1002229472 254
26 3300005616 Ga0068852_100024031 Ga0068852_1000240315 254
27 3300005844 Ga0068862_100111076 Ga0068862_1001110762 254
28 3300005844 Ga0068862_100182133 Ga0068862_1001821332 254
29 3300005844 Ga0068862_100210674 Ga0068862_1002106743 254
30 3300009093 Ga0105240_10122662 Ga0105240_101226623 254
31 3300009177 Ga0105248_10213377 Ga0105248_102133772 254
32 3300013100 Ga0157373_10055379 Ga0157373_100553792 254
33 3300013102 Ga0157371_10071442 Ga0157371_100714422 254
34 3300013102 Ga0157371_10379999 Ga0157371_103799992 254
35 3300013104 Ga0157370_10200971 Ga0157370_102009712 254
36 3300013105 Ga0157369_10022824 Ga0157369_100228242 254
37 3300013105 Ga0157369_10494357 Ga0157369_104943572 254
38 3300013307 Ga0157372_10472466 Ga0157372_104724662 254
39 3300014326 Ga0157380_10000643 Ga0157380_100006437 254
40 3300020070 Ga0206356_11573067 Ga0206356_115730671 254
41 3300020081 Ga0206354_10559906 Ga0206354_105599062 254
42 3300020082 Ga0206353_11864049 Ga0206353_118640493 254
43 3300025904 Ga0207647_10090457 Ga0207647_100904572 254
44 3300025909 Ga0207705_10002088 Ga0207705_1000208811 254
45 3300025912 Ga0207707_10034836 Ga0207707_100348366 254
46 3300025917 Ga0207660_10004417 Ga0207660_100044177 254
47 3300025917 Ga0207660_10216099 Ga0207660_102160992 254
48 3300025919 Ga0207657_10120206 Ga0207657_101202063 254
49 3300025920 Ga0207649_10139862 Ga0207649_101398622 254
50 3300025944 Ga0207661_10016987 Ga0207661_100169872 254
51 3300025949 Ga0207667_10046983 Ga0207667_100469835 254
52 3300025949 Ga0207667_10396005 Ga0207667_103960052 254
53 3300026142 Ga0207698_10062073 Ga0207698_100620733 254
54 3300028380 Ga0268265_10168044 Ga0268265_101680442 254
55 3300031731 Ga0307405_10004103 Ga0307405_100041033 254
56 3300031731 Ga0307405_10073395 Ga0307405_100733952 254
57 3300031824 Ga0307413_10023605 Ga0307413_100236052 254
58 3300031824 Ga0307413_10052679 Ga0307413_100526792 254
59 3300031852 Ga0307410_10035238 Ga0307410_100352382 254
60 3300031901 Ga0307406_10064241 Ga0307406_100642412 254
61 3300031903 Ga0307407_10069905 Ga0307407_100699053 254
62 3300031903 Ga0307407_10115004 Ga0307407_101150042 254
63 3300031903 Ga0307407_10153509 Ga0307407_101535092 254
64 3300031911 Ga0307412_10049498 Ga0307412_100494983 254
65 3300031911 Ga0307412_10178304 Ga0307412_101783042 254
66 3300031911 Ga0307412_10473405 Ga0307412_104734051 254
67 3300031995 Ga0307409_100175546 Ga0307409_1001755462 254
68 3300032002 Ga0307416_100063669 Ga0307416_1000636692 254
69 3300032002 Ga0307416_100106276 Ga0307416_1001062762 254
70 3300032004 Ga0307414_10032283 Ga0307414_100322833 254
71 3300032004 Ga0307414_10735968 Ga0307414_107359681 254
72 3300032005 Ga0307411_10021216 Ga0307411_100212163 254
73 3300032005 Ga0307411_10130872 Ga0307411_101308722 254
74 3300032005 Ga0307411_10344357 Ga0307411_103443572 254
75 3300032126 Ga0307415_100314875 Ga0307415_1003148752 254
76 3300037312 Ga0395899_0039265 Ga0395899_0039265_1113_1877 254
77 3300037418 Ga0395900_0000336 Ga0395900_0000336_10941_11705 254
78 3300037418 Ga0395900_0005712 Ga0395900_0005712_10537_11301 254
79 3300037418 Ga0395900_0037239 Ga0395900_0037239_570_1334 254
80 3300037466 Ga0395898_0089811 Ga0395898_0089811_246_1010 254
81 3300037471 Ga0395905_0018628 Ga0395905_0018628_2342_3106 254
82 3300037471 Ga0395905_0039720 Ga0395905_0039720_2339_3103 254
83 3300038443 Ga0395901_0000398 Ga0395901_0000398_25936_26700 254
84 3300038443 Ga0395901_0002173 Ga0395901_0002173_8152_8916 254
85 3300038443 Ga0395901_0299820 Ga0395901_0299820_65_829 254
86 3300042004 Ga0439445_0000343 Ga0439445_0000343_2123_2887 254
87 3300042439 Ga0439464_0017860 Ga0439464_0017860_421_1185 254
88 3300046539 Ga0495621_0007593 Ga0495621_0007593_368_1132 254
89 3300046664 Ga0495659_0027313 Ga0495659_0027313_944_1708 254
90 3300049765 Ga0501268_001568 Ga0501268_001568_1781_2545 254
91 3300002076 JGI24749J21850_1001216 JGI24749J21850_10012163 255
92 3300005293 Ga0065715_10002451 Ga0065715_100024512 255
93 3300005331 Ga0070670_100002912 Ga0070670_1000029126 255
94 3300005331 Ga0070670_100004461 Ga0070670_1000044615 255
95 3300005333 Ga0070677_10014739 Ga0070677_100147393 255
96 3300005344 Ga0070661_100279462 Ga0070661_1002794622 255
97 3300005347 Ga0070668_100001233 Ga0070668_10000123311 255
98 3300005347 Ga0070668_100069802 Ga0070668_1000698024 255
99 3300005347 Ga0070668_100077837 Ga0070668_1000778372 255
100 3300005353 Ga0070669_100001336 Ga0070669_1000013363 255
101 3300005353 Ga0070669_100030104 Ga0070669_1000301042 255
102 3300005354 Ga0070675_100018057 Ga0070675_1000180576 255
103 3300005355 Ga0070671_100006778 Ga0070671_1000067782 255
104 3300005355 Ga0070671_100007152 Ga0070671_1000071523 255
105 3300005355 Ga0070671_100170257 Ga0070671_1001702572 255
106 3300005356 Ga0070674_100002530 Ga0070674_1000025309 255
107 3300005364 Ga0070673_100181122 Ga0070673_1001811222 255
108 3300005367 Ga0070667_100019142 Ga0070667_1000191426 255
109 3300005440 Ga0070705_100113139 Ga0070705_1001131392 255
110 3300005457 Ga0070662_100010496 Ga0070662_1000104963 255
111 3300005457 Ga0070662_100166832 Ga0070662_1001668322 255
112 3300005458 Ga0070681_10220129 Ga0070681_102201292 255
113 3300005459 Ga0068867_100207695 Ga0068867_1002076952 255
114 3300005539 Ga0068853_100171579 Ga0068853_1001715792 255
115 3300005543 Ga0070672_100003449 Ga0070672_1000034496 255
116 3300005544 Ga0070686_100129337 Ga0070686_1001293372 255
117 3300005547 Ga0070693_100076299 Ga0070693_1000762992 255
118 3300005564 Ga0070664_100000738 Ga0070664_10000073825 255
119 3300005564 Ga0070664_100022704 Ga0070664_1000227044 255
120 3300005577 Ga0068857_100121861 Ga0068857_1001218613 255
121 3300005577 Ga0068857_100386696 Ga0068857_1003866962 255
122 3300005578 Ga0068854_100215666 Ga0068854_1002156662 255
123 3300005614 Ga0068856_100546525 Ga0068856_1005465252 255
124 3300005617 Ga0068859_100205101 Ga0068859_1002051013 255
125 3300005618 Ga0068864_100144736 Ga0068864_1001447363 255
126 3300005719 Ga0068861_100010148 Ga0068861_1000101482 255
127 3300005841 Ga0068863_100000124 Ga0068863_1000001243 255
128 3300005843 Ga0068860_100418149 Ga0068860_1004181492 255
129 3300005844 Ga0068862_100005615 Ga0068862_1000056159 255
130 3300005844 Ga0068862_100107633 Ga0068862_1001076333 255
131 3300006931 Ga0097620_100205109 Ga0097620_1002051092 255
132 3300009094 Ga0111539_10076568 Ga0111539_100765682 255
133 3300009148 Ga0105243_10153493 Ga0105243_101534932 255
134 3300009553 Ga0105249_10014300 Ga0105249_100143003 255
135 3300013100 Ga0157373_10222940 Ga0157373_102229402 255
136 3300013102 Ga0157371_10250459 Ga0157371_102504592 255
137 3300013102 Ga0157371_10312155 Ga0157371_103121552 255
138 3300013308 Ga0157375_10092566 Ga0157375_100925663 255
139 3300013308 Ga0157375_10784831 Ga0157375_107848311 255
140 3300014326 Ga0157380_10122235 Ga0157380_101222354 255
141 3300014326 Ga0157380_10260850 Ga0157380_102608502 255
142 3300025315 Ga0207697_10000539 Ga0207697_1000053914 255
143 3300025893 Ga0207682_10000642 Ga0207682_100006424 255
144 3300025912 Ga0207707_10083448 Ga0207707_100834484 255
145 3300025919 Ga0207657_10214748 Ga0207657_102147482 255
146 3300025923 Ga0207681_10188917 Ga0207681_101889172 255
147 3300025925 Ga0207650_10003074 Ga0207650_100030745 255
148 3300025925 Ga0207650_10004132 Ga0207650_100041327 255
149 3300025925 Ga0207650_10008625 Ga0207650_100086254 255
150 3300025931 Ga0207644_10000063 Ga0207644_1000006379 255
151 3300025931 Ga0207644_10004118 Ga0207644_100041187 255
152 3300025931 Ga0207644_10189629 Ga0207644_101896292 255
153 3300025933 Ga0207706_10000181 Ga0207706_1000018147 255
154 3300025940 Ga0207691_10004598 Ga0207691_100045984 255
155 3300025945 Ga0207679_10000677 Ga0207679_100006778 255
156 3300025945 Ga0207679_10026998 Ga0207679_100269984 255
157 3300025961 Ga0207712_10045152 Ga0207712_100451522 255
158 3300025961 Ga0207712_10312392 Ga0207712_103123923 255
159 3300025972 Ga0207668_10036332 Ga0207668_100363324 255
160 3300025972 Ga0207668_10057231 Ga0207668_100572313 255
161 3300025972 Ga0207668_10094595 Ga0207668_100945952 255
162 3300025981 Ga0207640_10123265 Ga0207640_101232652 255
163 3300025981 Ga0207640_10125867 Ga0207640_101258672 255
164 3300025981 Ga0207640_10374065 Ga0207640_103740652 255
165 3300026067 Ga0207678_10049415 Ga0207678_100494152 255
166 3300026075 Ga0207708_10283165 Ga0207708_102831652 255
167 3300026078 Ga0207702_10015308 Ga0207702_100153088 255
168 3300026088 Ga0207641_10000193 Ga0207641_1000019386 255
169 3300026089 Ga0207648_10097439 Ga0207648_100974393 255
170 3300026116 Ga0207674_10193292 Ga0207674_101932921 255
171 3300026116 Ga0207674_10256952 Ga0207674_102569522 255
172 3300026116 Ga0207674_10390218 Ga0207674_103902182 255
173 3300026118 Ga0207675_100017788 Ga0207675_1000177882 255
174 3300026142 Ga0207698_10387304 Ga0207698_103873042 255
175 3300027876 Ga0209974_10006288 Ga0209974_100062883 255
176 3300028380 Ga0268265_10165253 Ga0268265_101652532 255
177 3300031731 Ga0307405_10170990 Ga0307405_101709902 255
178 3300031824 Ga0307413_10006135 Ga0307413_100061353 255
179 3300031824 Ga0307413_10367156 Ga0307413_103671562 255
180 3300031901 Ga0307406_10213554 Ga0307406_102135542 255
181 3300031903 Ga0307407_10005573 Ga0307407_100055735 255
182 3300031903 Ga0307407_10102958 Ga0307407_101029582 255
183 3300031903 Ga0307407_10224859 Ga0307407_102248592 255
184 3300031911 Ga0307412_10024395 Ga0307412_100243953 255
185 3300031911 Ga0307412_10053966 Ga0307412_100539662 255
186 3300031911 Ga0307412_10068927 Ga0307412_100689273 255
187 3300031911 Ga0307412_10109945 Ga0307412_101099452 255
188 3300031995 Ga0307409_100007426 Ga0307409_1000074263 255
189 3300031995 Ga0307409_100118511 Ga0307409_1001185112 255
190 3300031995 Ga0307409_100135895 Ga0307409_1001358952 255
191 3300031995 Ga0307409_100194630 Ga0307409_1001946302 255
192 3300032002 Ga0307416_100082527 Ga0307416_1000825273 255
193 3300032002 Ga0307416_100396209 Ga0307416_1003962092 255
194 3300032004 Ga0307414_10006788 Ga0307414_100067886 255
195 3300032004 Ga0307414_10253146 Ga0307414_102531462 255
196 3300032005 Ga0307411_10003375 Ga0307411_100033757 255
197 3300032005 Ga0307411_10068510 Ga0307411_100685102 255
198 3300032005 Ga0307411_10417610 Ga0307411_104176102 255
199 3300032126 Ga0307415_100034129 Ga0307415_1000341293 255
200 3300037312 Ga0395899_0027658 Ga0395899_0027658_2811_3578 255
201 3300037471 Ga0395905_0001121 Ga0395905_0001121_5653_6420 255
202 3300038443 Ga0395901_0006187 Ga0395901_0006187_5094_5861 255
203 3300041408 Ga0439453_0026581 Ga0439453_0026581_162_929 255
204 3300045976 Ga0466967_0022731 Ga0466967_0022731_1797_2564 255
205 3300046616 Ga0495668_0030159 Ga0495668_0030159_1567_2334 255
206 3300046664 Ga0495659_0024685 Ga0495659_0024685_1261_2028 255
207 3300046684 Ga0495669_0013815 Ga0495669_0013815_2182_2949 255
208 3300046691 Ga0495670_0008019 Ga0495670_0008019_2361_3128 255
209 3300046691 Ga0495670_0027257 Ga0495670_0027257_1951_2718 255
210 3300047318 Ga0495636_0231852 Ga0495636_0231852_33_800 255
211 3300047445 Ga0495677_0032070 Ga0495677_0032070_244_1011 255
212 3300048911 Ga0496108_0000483 Ga0496108_0000483_14048_14815 255
213 3300048925 Ga0496122_0001118 Ga0496122_0001118_925_1719 255
214 3300048926 Ga0496123_0004885 Ga0496123_0004885_8809_9603 255
215 3300048927 Ga0496124_0010035 Ga0496124_0010035_4727_5521 255
216 3300049679 Ga0501249_029246 Ga0501249_029246_132_899 255
217 3300050512 nmdc:mga0n895_588057_c1 nmdc:mga0n895_588057_c1_32_799 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

8

187

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dpw-assembly1.cif.gz_A hpothetical transferase structure from thermus thermophilus 0.8398 2 244
2dpw-assembly1.cif.gz_A hpothetical transferase structure from thermus thermophilus 0.8332 2 244
2yc3-assembly1.cif.gz_A-2 inhibitors of the herbicidal target ispd 0.7296 2 252
5hs2-assembly1.cif.gz_A crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution 0.7281 2 253
5ddv-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7267 2 252
ID Description Score Start End Superfamily
2dpwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8413 3 244 3.90.550.10
2dpwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8346 3 244 3.90.550.10
af_Q8I273_188_280_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7837 2 69 3.90.550.10
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7401 2 248 3.90.550.10
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7294 2 248 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2W5C037-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9486 2 113 GO:0016779
AF-A0A6G7ZIN9-F1-model_v4 NTP transferase domain-containing protein 0.9451 1 255 GO:0016779
AF-A0A6G7ZIN9-F1-model_v4 NTP transferase domain-containing protein 0.9379 1 255 GO:0016779
AF-A0A494TEY1-F1-model_v4 4-diphosphocytidyl-2C-methyl-D-erythritol synthase 0.936 3 254 GO:0016020
AF-A0A6G7YQJ3-F1-model_v4 NTP transferase domain-containing protein 0.9355 2 255 GO:0016779

Feature Viewer

pLDDT pTM Quality
87.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map