F328414
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 217 | 174 | 185 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100044961|Ga0070660_1000449613 |
| Length | 527 |
| Sequence | MHHHGHDQAVLHTADSDRSTFTRPGRGSARRLRIPVRRGSRRYTCGQAFAEPPEAATLGVWTARPTSKSSATPTGGGTGSVPDLQGRERRPAGTVGGIRVTWQVADRHLIRYAGRFHPRVIERAAGSYMYDTDGNAILDFTSGQMSAVLGHSHPDIVAAVARSVATLDHIYSGMISPPLVELAESIAATLPPSLSKIQLLTTGAESNEAALKIAKLATGKYEVVSFDRSWHGMTSGAASATYSAGRAGYGPHMPGSFALPTPDAYRSPFRMPDGSYDWEGELAYGFAMIDAQSAGSLAAVLVEPVLSSGGVIEPPPGYFRKLKQMCAERGMLLILDEAQTGLGRTGQMYAFERDGAVPDILTLSKTLGAGLPVAMVVTSAEIEEACYERGYLFYTTHVSDPLAAAVARTVLAVIERDGLVARARTLGKVMAGRFADMKTRYEIVGDVRGRGLLQGIELVTSKATRQPAPGLGAEVTANCLERGLHTNIVQLPGAGASIIRIAPPLTISDEDMAKGLDILDKSIEATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 2 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 3 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 4 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 5 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 6 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 7 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 8 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 9 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 10 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 11 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 12 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 13 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 14 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 15 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 16 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 17 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 18 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 19 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 20 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 21 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 22 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 23 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 114 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 115 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 147 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 148 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 149 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 150 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 164 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 165 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 166 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 167 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 168 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 169 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 170 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 171 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 172 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 173 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 174 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.25 |
| Metatranscriptomes | 0 |
| Isolates | 14.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.83 |
| Nodule | 2.3 |
| Rhizoplane | 14.29 |
| Rhizosphere | 60.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1003449 | 3300003792 | Bacteria | 7637 |
| 2 | Ga0055540_1004113 | 3300003792 | Bacteria | 6730 |
| 3 | Ga0070658_10021603 | 3300005327 | Bacteria | 5158 |
| 4 | Ga0070658_10124970 | 3300005327 | Bacteria | 2140 |
| 5 | Ga0070682_100016727 | 3300005337 | Bacteria | 4268 |
| 6 | Ga0068868_100031729 | 3300005338 | Bacteria | 4061 |
| 7 | Ga0070660_100044961 | 3300005339 | Bacteria | 3379 |
| 8 | Ga0070671_100085480 | 3300005355 | Bacteria | 2639 |
| 9 | Ga0070714_100283859 | 3300005435 | Bacteria | 1539 |
| 10 | Ga0070713_100266251 | 3300005436 | Bacteria | 1568 |
| 11 | Ga0070710_10027405 | 3300005437 | Bacteria | 3037 |
| 12 | Ga0070711_100102418 | 3300005439 | Bacteria | 2085 |
| 13 | Ga0070663_100089443 | 3300005455 | Bacteria | 2279 |
| 14 | Ga0070663_100092906 | 3300005455 | Bacteria | 2238 |
| 15 | Ga0070663_100117104 | 3300005455 | Bacteria | 2009 |
| 16 | Ga0070678_100137469 | 3300005456 | Bacteria | 1950 |
| 17 | Ga0070681_10013343 | 3300005458 | Bacteria | 8165 |
| 18 | Ga0070679_100010991 | 3300005530 | Bacteria | 8604 |
| 19 | Ga0068853_100013280 | 3300005539 | Bacteria | 6725 |
| 20 | Ga0070696_100019212 | 3300005546 | Bacteria | 4626 |
| 21 | Ga0070665_100003602 | 3300005548 | Bacteria | 16403 |
| 22 | Ga0070665_100038423 | 3300005548 | Bacteria | 4811 |
| 23 | Ga0070665_100183498 | 3300005548 | Bacteria | 2093 |
| 24 | Ga0070704_100122193 | 3300005549 | Bacteria | 2003 |
| 25 | Ga0068857_100150375 | 3300005577 | Bacteria | 2109 |
| 26 | Ga0068854_100036258 | 3300005578 | Bacteria | 3457 |
| 27 | Ga0068852_100016360 | 3300005616 | Bacteria | 5780 |
| 28 | Ga0068859_100031138 | 3300005617 | Bacteria | 5355 |
| 29 | Ga0068859_100094764 | 3300005617 | Bacteria | 3037 |
| 30 | Ga0068864_100040313 | 3300005618 | Bacteria | 3995 |
| 31 | Ga0068861_100018307 | 3300005719 | Bacteria | 4989 |
| 32 | Ga0068863_100055802 | 3300005841 | Bacteria | 3740 |
| 33 | Ga0068858_100144645 | 3300005842 | Bacteria | 2232 |
| 34 | Ga0068858_100237739 | 3300005842 | Bacteria | 1728 |
| 35 | Ga0068860_100025771 | 3300005843 | Bacteria | 5672 |
| 36 | Ga0068860_100037184 | 3300005843 | Bacteria | 4660 |
| 37 | Ga0068860_100315780 | 3300005843 | Bacteria | 1533 |
| 38 | Ga0081540_1002506 | 3300005983 | Bacteria | 14929 |
| 39 | Ga0075365_10003089 | 3300006038 | Bacteria | 8461 |
| 40 | Ga0075363_100057962 | 3300006048 | Bacteria | 2080 |
| 41 | Ga0075364_10042717 | 3300006051 | Bacteria | 2945 |
| 42 | Ga0070716_100056646 | 3300006173 | Bacteria | 2248 |
| 43 | Ga0075362_10059640 | 3300006177 | Bacteria | 1723 |
| 44 | Ga0075369_10002327 | 3300006186 | Bacteria | 6761 |
| 45 | Ga0097621_100096075 | 3300006237 | Bacteria | 2486 |
| 46 | Ga0075433_10026465 | 3300006852 | Bacteria | 4910 |
| 47 | Ga0075434_100079453 | 3300006871 | Bacteria | 3276 |
| 48 | Ga0068865_100162344 | 3300006881 | Bacteria | 1706 |
| 49 | Ga0097620_100031136 | 3300006931 | Bacteria | 5355 |
| 50 | Ga0097620_100094767 | 3300006931 | Bacteria | 3037 |
| 51 | Ga0079104_1000010 | 3300006946 | Bacteria | 366021 |
| 52 | Ga0111539_10158621 | 3300009094 | Bacteria | 2647 |
| 53 | Ga0105247_10055205 | 3300009101 | Bacteria | 2452 |
| 54 | Ga0105241_10005195 | 3300009174 | Bacteria | 9610 |
| 55 | Ga0105248_10108542 | 3300009177 | Bacteria | 3130 |
| 56 | Ga0105237_10032406 | 3300009545 | Bacteria | 5291 |
| 57 | Ga0105238_10164238 | 3300009551 | Bacteria | 2196 |
| 58 | Ga0105238_10315405 | 3300009551 | Bacteria | 1549 |
| 59 | Ga0105239_10012797 | 3300010375 | Bacteria | 9333 |
| 60 | Ga0105239_10017933 | 3300010375 | Bacteria | 7828 |
| 61 | Ga0105246_10108188 | 3300011119 | Bacteria | 2038 |
| 62 | Ga0157370_10186040 | 3300013104 | Bacteria | 1928 |
| 63 | Ga0157369_10038845 | 3300013105 | Bacteria | 5204 |
| 64 | Ga0157369_10279226 | 3300013105 | Bacteria | 1740 |
| 65 | Ga0157378_10167205 | 3300013297 | Bacteria | 2061 |
| 66 | Ga0163162_10205102 | 3300013306 | Bacteria | 2100 |
| 67 | Ga0163162_10251105 | 3300013306 | Bacteria | 1901 |
| 68 | Ga0157372_10000004 | 3300013307 | Bacteria | 435659 |
| 69 | Ga0157375_10024924 | 3300013308 | Bacteria | 5546 |
| 70 | Ga0157375_10200589 | 3300013308 | Bacteria | 2151 |
| 71 | Ga0157377_10028291 | 3300014745 | Bacteria | 3016 |
| 72 | Ga0209051_1000765 | 3300025303 | Bacteria | 34214 |
| 73 | Ga0209051_1001295 | 3300025303 | Bacteria | 22036 |
| 74 | Ga0209051_1002142 | 3300025303 | Bacteria | 14689 |
| 75 | Ga0207688_10013818 | 3300025901 | Bacteria | 4388 |
| 76 | Ga0207705_10042301 | 3300025909 | Bacteria | 3271 |
| 77 | Ga0207705_10117662 | 3300025909 | Bacteria | 1969 |
| 78 | Ga0207671_10013176 | 3300025914 | Bacteria | 6601 |
| 79 | Ga0207693_10011233 | 3300025915 | Bacteria | 7250 |
| 80 | Ga0207662_10027139 | 3300025918 | Bacteria | 3305 |
| 81 | Ga0207657_10016498 | 3300025919 | Bacteria | 7123 |
| 82 | Ga0207657_10061017 | 3300025919 | Bacteria | 3235 |
| 83 | Ga0207657_10119876 | 3300025919 | Bacteria | 2165 |
| 84 | Ga0207694_10144021 | 3300025924 | Bacteria | 1917 |
| 85 | Ga0207687_10018937 | 3300025927 | Bacteria | 4554 |
| 86 | Ga0207687_10032563 | 3300025927 | Bacteria | 3531 |
| 87 | Ga0207687_10086968 | 3300025927 | Bacteria | 2271 |
| 88 | Ga0207664_10192421 | 3300025929 | Bacteria | 1756 |
| 89 | Ga0207644_10009238 | 3300025931 | Bacteria | 6469 |
| 90 | Ga0207690_10124126 | 3300025932 | Bacteria | 1880 |
| 91 | Ga0207706_10085515 | 3300025933 | Bacteria | 2773 |
| 92 | Ga0207686_10038084 | 3300025934 | Bacteria | 2907 |
| 93 | Ga0207704_10034710 | 3300025938 | Bacteria | 2881 |
| 94 | Ga0207704_10076591 | 3300025938 | Bacteria | 2144 |
| 95 | Ga0207665_10071646 | 3300025939 | Bacteria | 2366 |
| 96 | Ga0207679_10057757 | 3300025945 | Bacteria | 2872 |
| 97 | Ga0207651_10065034 | 3300025960 | Bacteria | 2556 |
| 98 | Ga0207703_10033088 | 3300026035 | Bacteria | 4096 |
| 99 | Ga0207639_10009297 | 3300026041 | Bacteria | 6776 |
| 100 | Ga0207678_10004277 | 3300026067 | Bacteria | 12806 |
| 101 | Ga0207678_10051918 | 3300026067 | Bacteria | 3538 |
| 102 | Ga0207678_10090946 | 3300026067 | Bacteria | 2608 |
| 103 | Ga0207708_10068069 | 3300026075 | Bacteria | 2725 |
| 104 | Ga0207708_10082855 | 3300026075 | Bacteria | 2466 |
| 105 | Ga0207674_10148833 | 3300026116 | Bacteria | 2299 |
| 106 | Ga0207675_100030596 | 3300026118 | Bacteria | 5015 |
| 107 | Ga0207675_100052093 | 3300026118 | Bacteria | 3819 |
| 108 | Ga0207683_10044244 | 3300026121 | Bacteria | 3892 |
| 109 | Ga0207698_10012695 | 3300026142 | Bacteria | 5525 |
| 110 | Ga0209281_1000078 | 3300027111 | Bacteria | 261622 |
| 111 | Ga0268266_10111440 | 3300028379 | Bacteria | 2425 |
| 112 | Ga0268264_10214119 | 3300028381 | Bacteria | 1770 |
| 113 | Ga0265338_10005051 | 3300028800 | Bacteria | 17409 |
| 114 | Ga0307513_10001342 | 3300031456 | Bacteria | 35584 |
| 115 | Ga0307416_100212000 | 3300032002 | Bacteria | 1849 |
| 116 | Ga0373949_0007624 | 3300035090 | Bacteria | 2371 |
| 117 | Ga0395901_0104056 | 3300038443 | Bacteria | 2979 |
| 118 | Ga0439465_0000280 | 3300041413 | Bacteria | 14305 |
| 119 | Ga0451793_1682602 | 3300041452 | Bacteria | 3624 |
| 120 | Ga0439445_0002347 | 3300042004 | Bacteria | 4208 |
| 121 | Ga0495650_0052010 | 3300046471 | Bacteria | 1684 |
| 122 | Ga0495582_0051763 | 3300046473 | Bacteria | 2264 |
| 123 | Ga0495583_0022180 | 3300046506 | Bacteria | 3247 |
| 124 | Ga0495606_0033189 | 3300046507 | Bacteria | 3564 |
| 125 | Ga0495648_0014130 | 3300046524 | Bacteria | 5862 |
| 126 | Ga0495665_0067928 | 3300046531 | Bacteria | 1880 |
| 127 | Ga0495640_0024630 | 3300046533 | Bacteria | 4377 |
| 128 | Ga0495611_0019693 | 3300046648 | Bacteria | 2900 |
| 129 | Ga0495658_0023509 | 3300046683 | Bacteria | 3272 |
| 130 | Ga0495624_0038458 | 3300046690 | Bacteria | 3074 |
| 131 | Ga0495671_0016812 | 3300046692 | Bacteria | 3901 |
| 132 | Ga0495672_0004361 | 3300047320 | Bacteria | 11623 |
| 133 | Ga0495673_0007331 | 3300047469 | Bacteria | 6361 |
| 134 | Ga0495686_0024193 | 3300047472 | Bacteria | 3994 |
| 135 | Ga0496100_0007139 | 3300048903 | Bacteria | 6136 |
| 136 | Ga0496100_0047655 | 3300048903 | Bacteria | 2763 |
| 137 | Ga0496100_0139794 | 3300048903 | Bacteria | 1715 |
| 138 | Ga0496101_0000595 | 3300048904 | Bacteria | 22001 |
| 139 | Ga0496101_0039012 | 3300048904 | Bacteria | 3375 |
| 140 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 141 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 142 | Ga0496104_0018254 | 3300048907 | Bacteria | 6399 |
| 143 | Ga0496104_0021699 | 3300048907 | Bacteria | 5898 |
| 144 | Ga0496105_0004586 | 3300048908 | Bacteria | 10406 |
| 145 | Ga0496105_0009671 | 3300048908 | Bacteria | 7548 |
| 146 | Ga0496105_0015602 | 3300048908 | Bacteria | 6058 |
| 147 | Ga0496106_0012726 | 3300048909 | Bacteria | 6215 |
| 148 | Ga0496106_0063179 | 3300048909 | Bacteria | 2813 |
| 149 | Ga0496107_0029296 | 3300048910 | Bacteria | 3916 |
| 150 | Ga0496108_0037337 | 3300048911 | Bacteria | 4045 |
| 151 | Ga0496108_0044286 | 3300048911 | Bacteria | 3716 |
| 152 | Ga0496108_0305281 | 3300048911 | Bacteria | 1386 |
| 153 | Ga0496109_0017165 | 3300048912 | Bacteria | 6338 |
| 154 | Ga0496110_0068521 | 3300048913 | Bacteria | 3140 |
| 155 | Ga0496110_0086367 | 3300048913 | Bacteria | 2801 |
| 156 | Ga0496111_0002927 | 3300048914 | Bacteria | 10439 |
| 157 | Ga0496112_0018355 | 3300048915 | Bacteria | 6585 |
| 158 | Ga0496113_0010321 | 3300048916 | Bacteria | 6172 |
| 159 | Ga0496114_0002238 | 3300048917 | Bacteria | 14736 |
| 160 | Ga0496114_0003739 | 3300048917 | Bacteria | 11722 |
| 161 | Ga0496114_0045235 | 3300048917 | Bacteria | 3656 |
| 162 | Ga0496114_0319736 | 3300048917 | Bacteria | 1371 |
| 163 | Ga0496115_0047901 | 3300048918 | Bacteria | 3419 |
| 164 | Ga0496116_0000823 | 3300048919 | Bacteria | 39132 |
| 165 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 166 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 167 | Ga0496119_0050045 | 3300048922 | Bacteria | 2578 |
| 168 | Ga0496120_0058712 | 3300048923 | Bacteria | 2159 |
| 169 | Ga0496121_0004356 | 3300048924 | Bacteria | 19131 |
| 170 | Ga0496121_0011173 | 3300048924 | Bacteria | 10012 |
| 171 | Ga0496123_0004871 | 3300048926 | Bacteria | 13806 |
| 172 | Ga0496126_0011613 | 3300048929 | Bacteria | 9090 |
| 173 | Ga0501031_0053040 | 3300049568 | Bacteria | 2642 |
| 174 | Ga0501038_0126436 | 3300049574 | Bacteria | 2104 |
| 175 | Ga0501039_0074346 | 3300049575 | Bacteria | 2641 |
| 176 | Ga0501043_0145049 | 3300049579 | Bacteria | 1859 |
| 177 | Ga0501072_0257386 | 3300049588 | Bacteria | 1390 |
| 178 | nmdc:mga00v17_3920_c1 | 3300050491 | Bacteria | 7675 |
| 179 | nmdc:mga0yw44_73476_c1 | 3300050492 | Bacteria | 2127 |
| 180 | nmdc:mga0sz30_14696_c1 | 3300050516 | Bacteria | 3086 |
| 181 | Ga0495619_0076084 | 3300053085 | Bacteria | 2253 |
| 182 | Ga0500643_005798 | 3300053087 | Bacteria | 5264 |
| 183 | Ga0500573_0000220 | 3300053140 | Bacteria | 23454 |
| 184 | Ga0500573_0019118 | 3300053140 | Bacteria | 3918 |
| 185 | Ga0500616_0000305 | 3300053153 | Bacteria | 70598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100283859 | Ga0070714_1002838591 | 416 |
| 2 | 3300006173 | Ga0070716_100056646 | Ga0070716_1000566462 | 416 |
| 3 | iso_pu_bacteria | 2582580736 | 2583152874 | 418 |
| 4 | iso_pu_bacteria | 8056207758 | 8056212546 | 419 |
| 5 | 3300005355 | Ga0070671_100085480 | Ga0070671_1000854802 | 421 |
| 6 | 3300005548 | Ga0070665_100003602 | Ga0070665_10000360211 | 421 |
| 7 | 3300005843 | Ga0068860_100037184 | Ga0068860_1000371845 | 421 |
| 8 | 3300025931 | Ga0207644_10009238 | Ga0207644_100092382 | 421 |
| 9 | 3300047472 | Ga0495686_0024193 | Ga0495686_0024193_590_1903 | 422 |
| 10 | 3300005327 | Ga0070658_10124970 | Ga0070658_101249702 | 423 |
| 11 | 3300005337 | Ga0070682_100016727 | Ga0070682_1000167273 | 423 |
| 12 | 3300005456 | Ga0070678_100137469 | Ga0070678_1001374691 | 423 |
| 13 | 3300005616 | Ga0068852_100016360 | Ga0068852_1000163602 | 423 |
| 14 | 3300005617 | Ga0068859_100031138 | Ga0068859_1000311383 | 423 |
| 15 | 3300005842 | Ga0068858_100144645 | Ga0068858_1001446452 | 423 |
| 16 | 3300005843 | Ga0068860_100315780 | Ga0068860_1003157802 | 423 |
| 17 | 3300006931 | Ga0097620_100031136 | Ga0097620_1000311363 | 423 |
| 18 | 3300009551 | Ga0105238_10315405 | Ga0105238_103154051 | 423 |
| 19 | 3300010375 | Ga0105239_10012797 | Ga0105239_100127972 | 423 |
| 20 | 3300013105 | Ga0157369_10279226 | Ga0157369_102792261 | 423 |
| 21 | 3300013297 | Ga0157378_10167205 | Ga0157378_101672052 | 423 |
| 22 | 3300013308 | Ga0157375_10200589 | Ga0157375_102005891 | 423 |
| 23 | 3300014745 | Ga0157377_10028291 | Ga0157377_100282912 | 423 |
| 24 | 3300025901 | Ga0207688_10013818 | Ga0207688_100138183 | 423 |
| 25 | 3300025909 | Ga0207705_10042301 | Ga0207705_100423012 | 423 |
| 26 | 3300025918 | Ga0207662_10027139 | Ga0207662_100271393 | 423 |
| 27 | 3300025919 | Ga0207657_10119876 | Ga0207657_101198762 | 423 |
| 28 | 3300025927 | Ga0207687_10086968 | Ga0207687_100869682 | 423 |
| 29 | 3300025932 | Ga0207690_10124126 | Ga0207690_101241262 | 423 |
| 30 | 3300025933 | Ga0207706_10085515 | Ga0207706_100855152 | 423 |
| 31 | 3300025938 | Ga0207704_10076591 | Ga0207704_100765912 | 423 |
| 32 | 3300025945 | Ga0207679_10057757 | Ga0207679_100577572 | 423 |
| 33 | 3300026067 | Ga0207678_10004277 | Ga0207678_100042775 | 423 |
| 34 | 3300026075 | Ga0207708_10068069 | Ga0207708_100680692 | 423 |
| 35 | 3300026142 | Ga0207698_10012695 | Ga0207698_100126952 | 423 |
| 36 | 3300028381 | Ga0268264_10214119 | Ga0268264_102141192 | 423 |
| 37 | 3300048911 | Ga0496108_0044286 | Ga0496108_0044286_2181_3464 | 423 |
| 38 | 3300048913 | Ga0496110_0086367 | Ga0496110_0086367_1016_2299 | 423 |
| 39 | 3300048903 | Ga0496100_0047655 | Ga0496100_0047655_1000_2286 | 424 |
| 40 | 3300048908 | Ga0496105_0009671 | Ga0496105_0009671_4380_5666 | 424 |
| 41 | 3300048917 | Ga0496114_0002238 | Ga0496114_0002238_9166_10452 | 424 |
| 42 | 3300053140 | Ga0500573_0000220 | Ga0500573_0000220_3607_4932 | 424 |
| 43 | 3300046471 | Ga0495650_0052010 | Ga0495650_0052010_86_1375 | 425 |
| 44 | iso_pu_bacteria | 2738541272 | 2738695235 | 426 |
| 45 | iso_pu_bacteria | 2738543027 | 2739326405 | 426 |
| 46 | iso_pu_bacteria | 2739367654 | 2739606140 | 426 |
| 47 | iso_pu_bacteria | 2758568522 | 2760307006 | 426 |
| 48 | iso_pu_bacteria | 2808606394 | 2809029367 | 426 |
| 49 | iso_pu_bacteria | 2895427314 | 2895429591 | 426 |
| 50 | 3300005338 | Ga0068868_100031729 | Ga0068868_1000317292 | 427 |
| 51 | 3300005455 | Ga0070663_100092906 | Ga0070663_1000929062 | 427 |
| 52 | 3300006237 | Ga0097621_100096075 | Ga0097621_1000960751 | 427 |
| 53 | 3300009101 | Ga0105247_10055205 | Ga0105247_100552052 | 427 |
| 54 | 3300009174 | Ga0105241_10005195 | Ga0105241_100051956 | 427 |
| 55 | 3300011119 | Ga0105246_10108188 | Ga0105246_101081882 | 427 |
| 56 | 3300013307 | Ga0157372_10000004 | Ga0157372_10000004120 | 427 |
| 57 | 3300013308 | Ga0157375_10024924 | Ga0157375_100249245 | 427 |
| 58 | 3300025915 | Ga0207693_10011233 | Ga0207693_100112335 | 427 |
| 59 | 3300025919 | Ga0207657_10016498 | Ga0207657_100164983 | 427 |
| 60 | 3300025924 | Ga0207694_10144021 | Ga0207694_101440211 | 427 |
| 61 | 3300026075 | Ga0207708_10082855 | Ga0207708_100828552 | 427 |
| 62 | 3300026121 | Ga0207683_10044244 | Ga0207683_100442442 | 427 |
| 63 | 3300048907 | Ga0496104_0018254 | Ga0496104_0018254_3406_4698 | 427 |
| 64 | 3300048908 | Ga0496105_0015602 | Ga0496105_0015602_1905_3197 | 427 |
| 65 | 3300048909 | Ga0496106_0063179 | Ga0496106_0063179_1226_2518 | 427 |
| 66 | 3300048911 | Ga0496108_0037337 | Ga0496108_0037337_1788_3080 | 427 |
| 67 | 3300048913 | Ga0496110_0068521 | Ga0496110_0068521_914_2206 | 427 |
| 68 | 3300048915 | Ga0496112_0018355 | Ga0496112_0018355_4004_5296 | 427 |
| 69 | iso_pu_bacteria | 2643221687 | 2644490178 | 427 |
| 70 | iso_pu_bacteria | 2808606448 | 2809229245 | 427 |
| 71 | iso_pu_bacteria | 2816332139 | 2816507668 | 427 |
| 72 | iso_pu_bacteria | 2837268691 | 2837271046 | 427 |
| 73 | iso_pu_bacteria | 2902792274 | 2902794990 | 427 |
| 74 | iso_pu_bacteria | 2902837492 | 2902839010 | 427 |
| 75 | iso_pu_bacteria | 2929212328 | 2929218315 | 427 |
| 76 | iso_pu_bacteria | 8023623736 | 8023626486 | 427 |
| 77 | iso_pu_bacteria | 8048127548 | 8048134304 | 427 |
| 78 | iso_pu_bacteria | 2857733635 | 2857734210 | 428 |
| 79 | iso_pu_bacteria | 2990044586 | 2990047529 | 428 |
| 80 | iso_pu_bacteria | 8008485437 | 8008491117 | 428 |
| 81 | iso_pu_bacteria | 8025524527 | 8025530446 | 428 |
| 82 | 3300005327 | Ga0070658_10021603 | Ga0070658_100216034 | 429 |
| 83 | iso_pu_bacteria | 2866612099 | 2866613244 | 429 |
| 84 | 3300006946 | Ga0079104_1000010 | Ga0079104_1000010137 | 430 |
| 85 | 3300025909 | Ga0207705_10117662 | Ga0207705_101176621 | 430 |
| 86 | 3300027111 | Ga0209281_1000078 | Ga0209281_100007819 | 430 |
| 87 | 3300048924 | Ga0496121_0011173 | Ga0496121_0011173_864_2192 | 430 |
| 88 | 3300048926 | Ga0496123_0004871 | Ga0496123_0004871_2351_3688 | 430 |
| 89 | 3300053153 | Ga0500616_0000305 | Ga0500616_0000305_24522_25814 | 430 |
| 90 | iso_pu_bacteria | 2821123053 | 2821124089 | 430 |
| 91 | iso_pu_bacteria | 2838736955 | 2838738885 | 430 |
| 92 | iso_pu_bacteria | 2841840854 | 2841842784 | 430 |
| 93 | iso_pu_bacteria | 2842140634 | 2842142564 | 430 |
| 94 | iso_pu_bacteria | 2857531043 | 2857531652 | 430 |
| 95 | iso_pu_bacteria | 2867346516 | 2867351109 | 430 |
| 96 | 3300003792 | Ga0055540_1003449 | Ga0055540_10034492 | 431 |
| 97 | 3300003792 | Ga0055540_1004113 | Ga0055540_10041135 | 431 |
| 98 | 3300005339 | Ga0070660_100044961 | Ga0070660_1000449613 | 431 |
| 99 | 3300005436 | Ga0070713_100266251 | Ga0070713_1002662511 | 431 |
| 100 | 3300005437 | Ga0070710_10027405 | Ga0070710_100274052 | 431 |
| 101 | 3300005439 | Ga0070711_100102418 | Ga0070711_1001024182 | 431 |
| 102 | 3300005455 | Ga0070663_100089443 | Ga0070663_1000894431 | 431 |
| 103 | 3300005455 | Ga0070663_100117104 | Ga0070663_1001171041 | 431 |
| 104 | 3300005458 | Ga0070681_10013343 | Ga0070681_100133439 | 431 |
| 105 | 3300005530 | Ga0070679_100010991 | Ga0070679_1000109912 | 431 |
| 106 | 3300005539 | Ga0068853_100013280 | Ga0068853_1000132802 | 431 |
| 107 | 3300005546 | Ga0070696_100019212 | Ga0070696_1000192122 | 431 |
| 108 | 3300005548 | Ga0070665_100038423 | Ga0070665_1000384235 | 431 |
| 109 | 3300005548 | Ga0070665_100183498 | Ga0070665_1001834981 | 431 |
| 110 | 3300005549 | Ga0070704_100122193 | Ga0070704_1001221931 | 431 |
| 111 | 3300005577 | Ga0068857_100150375 | Ga0068857_1001503752 | 431 |
| 112 | 3300005578 | Ga0068854_100036258 | Ga0068854_1000362583 | 431 |
| 113 | 3300005617 | Ga0068859_100094764 | Ga0068859_1000947642 | 431 |
| 114 | 3300005618 | Ga0068864_100040313 | Ga0068864_1000403134 | 431 |
| 115 | 3300005719 | Ga0068861_100018307 | Ga0068861_1000183074 | 431 |
| 116 | 3300005841 | Ga0068863_100055802 | Ga0068863_1000558023 | 431 |
| 117 | 3300005842 | Ga0068858_100237739 | Ga0068858_1002377391 | 431 |
| 118 | 3300005843 | Ga0068860_100025771 | Ga0068860_1000257716 | 431 |
| 119 | 3300005983 | Ga0081540_1002506 | Ga0081540_10025062 | 431 |
| 120 | 3300006038 | Ga0075365_10003089 | Ga0075365_100030895 | 431 |
| 121 | 3300006048 | Ga0075363_100057962 | Ga0075363_1000579622 | 431 |
| 122 | 3300006051 | Ga0075364_10042717 | Ga0075364_100427173 | 431 |
| 123 | 3300006177 | Ga0075362_10059640 | Ga0075362_100596402 | 431 |
| 124 | 3300006186 | Ga0075369_10002327 | Ga0075369_100023271 | 431 |
| 125 | 3300006852 | Ga0075433_10026465 | Ga0075433_100264656 | 431 |
| 126 | 3300006871 | Ga0075434_100079453 | Ga0075434_1000794531 | 431 |
| 127 | 3300006881 | Ga0068865_100162344 | Ga0068865_1001623442 | 431 |
| 128 | 3300006931 | Ga0097620_100094767 | Ga0097620_1000947672 | 431 |
| 129 | 3300009094 | Ga0111539_10158621 | Ga0111539_101586212 | 431 |
| 130 | 3300009177 | Ga0105248_10108542 | Ga0105248_101085422 | 431 |
| 131 | 3300009545 | Ga0105237_10032406 | Ga0105237_100324065 | 431 |
| 132 | 3300009551 | Ga0105238_10164238 | Ga0105238_101642382 | 431 |
| 133 | 3300010375 | Ga0105239_10017933 | Ga0105239_100179335 | 431 |
| 134 | 3300013104 | Ga0157370_10186040 | Ga0157370_101860402 | 431 |
| 135 | 3300013105 | Ga0157369_10038845 | Ga0157369_100388455 | 431 |
| 136 | 3300013306 | Ga0163162_10205102 | Ga0163162_102051022 | 431 |
| 137 | 3300013306 | Ga0163162_10251105 | Ga0163162_102511052 | 431 |
| 138 | 3300025303 | Ga0209051_1000765 | Ga0209051_100076522 | 431 |
| 139 | 3300025303 | Ga0209051_1001295 | Ga0209051_10012957 | 431 |
| 140 | 3300025303 | Ga0209051_1002142 | Ga0209051_10021422 | 431 |
| 141 | 3300025914 | Ga0207671_10013176 | Ga0207671_100131765 | 431 |
| 142 | 3300025919 | Ga0207657_10061017 | Ga0207657_100610173 | 431 |
| 143 | 3300025927 | Ga0207687_10018937 | Ga0207687_100189373 | 431 |
| 144 | 3300025927 | Ga0207687_10032563 | Ga0207687_100325633 | 431 |
| 145 | 3300025929 | Ga0207664_10192421 | Ga0207664_101924211 | 431 |
| 146 | 3300025934 | Ga0207686_10038084 | Ga0207686_100380842 | 431 |
| 147 | 3300025938 | Ga0207704_10034710 | Ga0207704_100347103 | 431 |
| 148 | 3300025939 | Ga0207665_10071646 | Ga0207665_100716462 | 431 |
| 149 | 3300025960 | Ga0207651_10065034 | Ga0207651_100650342 | 431 |
| 150 | 3300026035 | Ga0207703_10033088 | Ga0207703_100330883 | 431 |
| 151 | 3300026041 | Ga0207639_10009297 | Ga0207639_100092974 | 431 |
| 152 | 3300026067 | Ga0207678_10051918 | Ga0207678_100519182 | 431 |
| 153 | 3300026067 | Ga0207678_10090946 | Ga0207678_100909462 | 431 |
| 154 | 3300026116 | Ga0207674_10148833 | Ga0207674_101488334 | 431 |
| 155 | 3300026118 | Ga0207675_100030596 | Ga0207675_1000305964 | 431 |
| 156 | 3300026118 | Ga0207675_100052093 | Ga0207675_1000520932 | 431 |
| 157 | 3300028379 | Ga0268266_10111440 | Ga0268266_101114402 | 431 |
| 158 | 3300028800 | Ga0265338_10005051 | Ga0265338_100050518 | 431 |
| 159 | 3300031456 | Ga0307513_10001342 | Ga0307513_100013427 | 431 |
| 160 | 3300032002 | Ga0307416_100212000 | Ga0307416_1002120002 | 431 |
| 161 | 3300035090 | Ga0373949_0007624 | Ga0373949_0007624_69_1373 | 431 |
| 162 | 3300038443 | Ga0395901_0104056 | Ga0395901_0104056_756_2123 | 431 |
| 163 | 3300041413 | Ga0439465_0000280 | Ga0439465_0000280_19_1317 | 431 |
| 164 | 3300041452 | Ga0451793_1682602 | Ga0451793_1682602_348_1643 | 431 |
| 165 | 3300042004 | Ga0439445_0002347 | Ga0439445_0002347_762_2060 | 431 |
| 166 | 3300046473 | Ga0495582_0051763 | Ga0495582_0051763_923_2227 | 431 |
| 167 | 3300046506 | Ga0495583_0022180 | Ga0495583_0022180_20_1330 | 431 |
| 168 | 3300046507 | Ga0495606_0033189 | Ga0495606_0033189_1756_3057 | 431 |
| 169 | 3300046524 | Ga0495648_0014130 | Ga0495648_0014130_2636_3946 | 431 |
| 170 | 3300046531 | Ga0495665_0067928 | Ga0495665_0067928_134_1432 | 431 |
| 171 | 3300046533 | Ga0495640_0024630 | Ga0495640_0024630_1898_3202 | 431 |
| 172 | 3300046648 | Ga0495611_0019693 | Ga0495611_0019693_603_1913 | 431 |
| 173 | 3300046683 | Ga0495658_0023509 | Ga0495658_0023509_688_1992 | 431 |
| 174 | 3300046690 | Ga0495624_0038458 | Ga0495624_0038458_1012_2316 | 431 |
| 175 | 3300046692 | Ga0495671_0016812 | Ga0495671_0016812_1871_3181 | 431 |
| 176 | 3300047320 | Ga0495672_0004361 | Ga0495672_0004361_2636_3946 | 431 |
| 177 | 3300047469 | Ga0495673_0007331 | Ga0495673_0007331_2045_3355 | 431 |
| 178 | 3300048903 | Ga0496100_0007139 | Ga0496100_0007139_4467_5777 | 431 |
| 179 | 3300048903 | Ga0496100_0139794 | Ga0496100_0139794_37_1341 | 431 |
| 180 | 3300048904 | Ga0496101_0000595 | Ga0496101_0000595_4045_5355 | 431 |
| 181 | 3300048904 | Ga0496101_0039012 | Ga0496101_0039012_1605_2909 | 431 |
| 182 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_33337_34647 | 431 |
| 183 | 3300048906 | Ga0496103_0000007 | Ga0496103_0000007_321042_322352 | 431 |
| 184 | 3300048907 | Ga0496104_0021699 | Ga0496104_0021699_2026_3330 | 431 |
| 185 | 3300048908 | Ga0496105_0004586 | Ga0496105_0004586_5161_6465 | 431 |
| 186 | 3300048909 | Ga0496106_0012726 | Ga0496106_0012726_2771_4075 | 431 |
| 187 | 3300048910 | Ga0496107_0029296 | Ga0496107_0029296_698_2002 | 431 |
| 188 | 3300048911 | Ga0496108_0305281 | Ga0496108_0305281_54_1358 | 431 |
| 189 | 3300048912 | Ga0496109_0017165 | Ga0496109_0017165_3729_5033 | 431 |
| 190 | 3300048914 | Ga0496111_0002927 | Ga0496111_0002927_4512_5816 | 431 |
| 191 | 3300048916 | Ga0496113_0010321 | Ga0496113_0010321_2034_3341 | 431 |
| 192 | 3300048917 | Ga0496114_0003739 | Ga0496114_0003739_4465_5811 | 431 |
| 193 | 3300048917 | Ga0496114_0045235 | Ga0496114_0045235_2332_3630 | 431 |
| 194 | 3300048917 | Ga0496114_0319736 | Ga0496114_0319736_16_1314 | 431 |
| 195 | 3300048918 | Ga0496115_0047901 | Ga0496115_0047901_1642_2940 | 431 |
| 196 | 3300048919 | Ga0496116_0000823 | Ga0496116_0000823_5334_6644 | 431 |
| 197 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_548129_549439 | 431 |
| 198 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_548129_549439 | 431 |
| 199 | 3300048922 | Ga0496119_0050045 | Ga0496119_0050045_979_2289 | 431 |
| 200 | 3300048923 | Ga0496120_0058712 | Ga0496120_0058712_459_1769 | 431 |
| 201 | 3300048924 | Ga0496121_0004356 | Ga0496121_0004356_4045_5355 | 431 |
| 202 | 3300048929 | Ga0496126_0011613 | Ga0496126_0011613_4083_5393 | 431 |
| 203 | 3300049568 | Ga0501031_0053040 | Ga0501031_0053040_1147_2451 | 431 |
| 204 | 3300049574 | Ga0501038_0126436 | Ga0501038_0126436_470_1774 | 431 |
| 205 | 3300049575 | Ga0501039_0074346 | Ga0501039_0074346_198_1502 | 431 |
| 206 | 3300049579 | Ga0501043_0145049 | Ga0501043_0145049_58_1410 | 431 |
| 207 | 3300049588 | Ga0501072_0257386 | Ga0501072_0257386_50_1354 | 431 |
| 208 | 3300050491 | nmdc:mga00v17_3920_c1 | nmdc:mga00v17_3920_c1_2824_4128 | 431 |
| 209 | 3300050492 | nmdc:mga0yw44_73476_c1 | nmdc:mga0yw44_73476_c1_719_2026 | 431 |
| 210 | 3300050516 | nmdc:mga0sz30_14696_c1 | nmdc:mga0sz30_14696_c1_1759_3066 | 431 |
| 211 | 3300053085 | Ga0495619_0076084 | Ga0495619_0076084_546_1850 | 431 |
| 212 | 3300053087 | Ga0500643_005798 | Ga0500643_005798_3189_4490 | 431 |
| 213 | 3300053140 | Ga0500573_0019118 | Ga0500573_0019118_1130_2434 | 431 |
| 214 | iso_pu_bacteria | 8047893842 | 8047900952 | 431 |
| 215 | iso_pu_bacteria | 8048356638 | 8048357949 | 431 |
| 216 | iso_pu_bacteria | 8048369669 | 8048377894 | 431 |
| 217 | iso_pu_bacteria | 8048379754 | 8048386992 | 431 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d7r-assembly1.cif.gz_A | crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa | 0.9592 | 2 | 431 |
| 1z3z-assembly1.cif.gz_A | the crystal structure of a dgd mutant: q52a | 0.9589 | 2 | 431 |
| 1dgd-assembly1.cif.gz_A | an alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase | 0.9576 | 2 | 431 |
| 1dka-assembly1.cif.gz_A | dialkylglycine decarboxylase structure: bifunctional active site and alkali metal binding sites | 0.9574 | 2 | 431 |
| 5m49-assembly1.cif.gz_A-2 | alpha-amino epsilon-caprolactam racemase in complex with plp and d/l alpha amino epsilon-caprolactam (internal aldimine) | 0.926 | 7 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1Y4_328_438_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9717 | 328 | 429 | 3.90.1150.10 |
| 1d7rA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9571 | 323 | 431 | 3.90.1150.10 |
| 1dgeA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9548 | 58 | 321 | 3.40.640.10 |
| af_Q65WV6_290_384_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.952 | 328 | 422 | 3.90.1150.10 |
| af_I1JL13_371_474_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9512 | 328 | 428 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352RFZ0-F1-model_v4 | Aspartate aminotransferase family protein (EC 2.6.1.19) | 0.978 | 332 | 430 |
GO:0030170
GO:0034386 |
| AF-A0A1V8TSG9-F1-model_v4 | 2,2-dialkylglycine decarboxylase | 0.9684 | 3 | 430 |
GO:0005739
GO:0008483 GO:0030170 |
| AF-M2Q8U3-F1-model_v4 | Siderophore biosynthesis diaminobutyrate--2-oxoglutarate aminotransferase | 0.9681 | 2 | 430 |
GO:0008483
GO:0017000 GO:0030170 |
| AF-W9DIF6-F1-model_v4 | Aminotransferase III | 0.9673 | 202 | 430 |
GO:0008483
GO:0030170 |
| AF-A0A3M1JQS2-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.967 | 306 | 430 |
GO:0008483
GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar