F328414

General Info

Members Datasets Scaffolds Average Seq Length
217 174 185 435

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100044961|Ga0070660_1000449613
Length 527
Sequence MHHHGHDQAVLHTADSDRSTFTRPGRGSARRLRIPVRRGSRRYTCGQAFAEPPEAATLGVWTARPTSKSSATPTGGGTGSVPDLQGRERRPAGTVGGIRVTWQVADRHLIRYAGRFHPRVIERAAGSYMYDTDGNAILDFTSGQMSAVLGHSHPDIVAAVARSVATLDHIYSGMISPPLVELAESIAATLPPSLSKIQLLTTGAESNEAALKIAKLATGKYEVVSFDRSWHGMTSGAASATYSAGRAGYGPHMPGSFALPTPDAYRSPFRMPDGSYDWEGELAYGFAMIDAQSAGSLAAVLVEPVLSSGGVIEPPPGYFRKLKQMCAERGMLLILDEAQTGLGRTGQMYAFERDGAVPDILTLSKTLGAGLPVAMVVTSAEIEEACYERGYLFYTTHVSDPLAAAVARTVLAVIERDGLVARARTLGKVMAGRFADMKTRYEIVGDVRGRGLLQGIELVTSKATRQPAPGLGAEVTANCLERGLHTNIVQLPGAGASIIRIAPPLTISDEDMAKGLDILDKSIEATR

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
4 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
5 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
6 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
7 2808606394 Promicromonospora sp. C35 Isolate Unclassified
8 2808606448 Streptomyces sp. 193411 Isolate Unclassified
9 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
10 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
11 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
12 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
13 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
14 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
15 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
16 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
17 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
18 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
19 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
20 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
21 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
22 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
23 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
167 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
168 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
169 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
170 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
171 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
172 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
173 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
174 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 0
Isolates 14.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.83
Nodule 2.3
Rhizoplane 14.29
Rhizosphere 60.83
Stem 0
Stem Tuber 0
Unclassified 14.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1003449 3300003792 Bacteria 7637
2 Ga0055540_1004113 3300003792 Bacteria 6730
3 Ga0070658_10021603 3300005327 Bacteria 5158
4 Ga0070658_10124970 3300005327 Bacteria 2140
5 Ga0070682_100016727 3300005337 Bacteria 4268
6 Ga0068868_100031729 3300005338 Bacteria 4061
7 Ga0070660_100044961 3300005339 Bacteria 3379
8 Ga0070671_100085480 3300005355 Bacteria 2639
9 Ga0070714_100283859 3300005435 Bacteria 1539
10 Ga0070713_100266251 3300005436 Bacteria 1568
11 Ga0070710_10027405 3300005437 Bacteria 3037
12 Ga0070711_100102418 3300005439 Bacteria 2085
13 Ga0070663_100089443 3300005455 Bacteria 2279
14 Ga0070663_100092906 3300005455 Bacteria 2238
15 Ga0070663_100117104 3300005455 Bacteria 2009
16 Ga0070678_100137469 3300005456 Bacteria 1950
17 Ga0070681_10013343 3300005458 Bacteria 8165
18 Ga0070679_100010991 3300005530 Bacteria 8604
19 Ga0068853_100013280 3300005539 Bacteria 6725
20 Ga0070696_100019212 3300005546 Bacteria 4626
21 Ga0070665_100003602 3300005548 Bacteria 16403
22 Ga0070665_100038423 3300005548 Bacteria 4811
23 Ga0070665_100183498 3300005548 Bacteria 2093
24 Ga0070704_100122193 3300005549 Bacteria 2003
25 Ga0068857_100150375 3300005577 Bacteria 2109
26 Ga0068854_100036258 3300005578 Bacteria 3457
27 Ga0068852_100016360 3300005616 Bacteria 5780
28 Ga0068859_100031138 3300005617 Bacteria 5355
29 Ga0068859_100094764 3300005617 Bacteria 3037
30 Ga0068864_100040313 3300005618 Bacteria 3995
31 Ga0068861_100018307 3300005719 Bacteria 4989
32 Ga0068863_100055802 3300005841 Bacteria 3740
33 Ga0068858_100144645 3300005842 Bacteria 2232
34 Ga0068858_100237739 3300005842 Bacteria 1728
35 Ga0068860_100025771 3300005843 Bacteria 5672
36 Ga0068860_100037184 3300005843 Bacteria 4660
37 Ga0068860_100315780 3300005843 Bacteria 1533
38 Ga0081540_1002506 3300005983 Bacteria 14929
39 Ga0075365_10003089 3300006038 Bacteria 8461
40 Ga0075363_100057962 3300006048 Bacteria 2080
41 Ga0075364_10042717 3300006051 Bacteria 2945
42 Ga0070716_100056646 3300006173 Bacteria 2248
43 Ga0075362_10059640 3300006177 Bacteria 1723
44 Ga0075369_10002327 3300006186 Bacteria 6761
45 Ga0097621_100096075 3300006237 Bacteria 2486
46 Ga0075433_10026465 3300006852 Bacteria 4910
47 Ga0075434_100079453 3300006871 Bacteria 3276
48 Ga0068865_100162344 3300006881 Bacteria 1706
49 Ga0097620_100031136 3300006931 Bacteria 5355
50 Ga0097620_100094767 3300006931 Bacteria 3037
51 Ga0079104_1000010 3300006946 Bacteria 366021
52 Ga0111539_10158621 3300009094 Bacteria 2647
53 Ga0105247_10055205 3300009101 Bacteria 2452
54 Ga0105241_10005195 3300009174 Bacteria 9610
55 Ga0105248_10108542 3300009177 Bacteria 3130
56 Ga0105237_10032406 3300009545 Bacteria 5291
57 Ga0105238_10164238 3300009551 Bacteria 2196
58 Ga0105238_10315405 3300009551 Bacteria 1549
59 Ga0105239_10012797 3300010375 Bacteria 9333
60 Ga0105239_10017933 3300010375 Bacteria 7828
61 Ga0105246_10108188 3300011119 Bacteria 2038
62 Ga0157370_10186040 3300013104 Bacteria 1928
63 Ga0157369_10038845 3300013105 Bacteria 5204
64 Ga0157369_10279226 3300013105 Bacteria 1740
65 Ga0157378_10167205 3300013297 Bacteria 2061
66 Ga0163162_10205102 3300013306 Bacteria 2100
67 Ga0163162_10251105 3300013306 Bacteria 1901
68 Ga0157372_10000004 3300013307 Bacteria 435659
69 Ga0157375_10024924 3300013308 Bacteria 5546
70 Ga0157375_10200589 3300013308 Bacteria 2151
71 Ga0157377_10028291 3300014745 Bacteria 3016
72 Ga0209051_1000765 3300025303 Bacteria 34214
73 Ga0209051_1001295 3300025303 Bacteria 22036
74 Ga0209051_1002142 3300025303 Bacteria 14689
75 Ga0207688_10013818 3300025901 Bacteria 4388
76 Ga0207705_10042301 3300025909 Bacteria 3271
77 Ga0207705_10117662 3300025909 Bacteria 1969
78 Ga0207671_10013176 3300025914 Bacteria 6601
79 Ga0207693_10011233 3300025915 Bacteria 7250
80 Ga0207662_10027139 3300025918 Bacteria 3305
81 Ga0207657_10016498 3300025919 Bacteria 7123
82 Ga0207657_10061017 3300025919 Bacteria 3235
83 Ga0207657_10119876 3300025919 Bacteria 2165
84 Ga0207694_10144021 3300025924 Bacteria 1917
85 Ga0207687_10018937 3300025927 Bacteria 4554
86 Ga0207687_10032563 3300025927 Bacteria 3531
87 Ga0207687_10086968 3300025927 Bacteria 2271
88 Ga0207664_10192421 3300025929 Bacteria 1756
89 Ga0207644_10009238 3300025931 Bacteria 6469
90 Ga0207690_10124126 3300025932 Bacteria 1880
91 Ga0207706_10085515 3300025933 Bacteria 2773
92 Ga0207686_10038084 3300025934 Bacteria 2907
93 Ga0207704_10034710 3300025938 Bacteria 2881
94 Ga0207704_10076591 3300025938 Bacteria 2144
95 Ga0207665_10071646 3300025939 Bacteria 2366
96 Ga0207679_10057757 3300025945 Bacteria 2872
97 Ga0207651_10065034 3300025960 Bacteria 2556
98 Ga0207703_10033088 3300026035 Bacteria 4096
99 Ga0207639_10009297 3300026041 Bacteria 6776
100 Ga0207678_10004277 3300026067 Bacteria 12806
101 Ga0207678_10051918 3300026067 Bacteria 3538
102 Ga0207678_10090946 3300026067 Bacteria 2608
103 Ga0207708_10068069 3300026075 Bacteria 2725
104 Ga0207708_10082855 3300026075 Bacteria 2466
105 Ga0207674_10148833 3300026116 Bacteria 2299
106 Ga0207675_100030596 3300026118 Bacteria 5015
107 Ga0207675_100052093 3300026118 Bacteria 3819
108 Ga0207683_10044244 3300026121 Bacteria 3892
109 Ga0207698_10012695 3300026142 Bacteria 5525
110 Ga0209281_1000078 3300027111 Bacteria 261622
111 Ga0268266_10111440 3300028379 Bacteria 2425
112 Ga0268264_10214119 3300028381 Bacteria 1770
113 Ga0265338_10005051 3300028800 Bacteria 17409
114 Ga0307513_10001342 3300031456 Bacteria 35584
115 Ga0307416_100212000 3300032002 Bacteria 1849
116 Ga0373949_0007624 3300035090 Bacteria 2371
117 Ga0395901_0104056 3300038443 Bacteria 2979
118 Ga0439465_0000280 3300041413 Bacteria 14305
119 Ga0451793_1682602 3300041452 Bacteria 3624
120 Ga0439445_0002347 3300042004 Bacteria 4208
121 Ga0495650_0052010 3300046471 Bacteria 1684
122 Ga0495582_0051763 3300046473 Bacteria 2264
123 Ga0495583_0022180 3300046506 Bacteria 3247
124 Ga0495606_0033189 3300046507 Bacteria 3564
125 Ga0495648_0014130 3300046524 Bacteria 5862
126 Ga0495665_0067928 3300046531 Bacteria 1880
127 Ga0495640_0024630 3300046533 Bacteria 4377
128 Ga0495611_0019693 3300046648 Bacteria 2900
129 Ga0495658_0023509 3300046683 Bacteria 3272
130 Ga0495624_0038458 3300046690 Bacteria 3074
131 Ga0495671_0016812 3300046692 Bacteria 3901
132 Ga0495672_0004361 3300047320 Bacteria 11623
133 Ga0495673_0007331 3300047469 Bacteria 6361
134 Ga0495686_0024193 3300047472 Bacteria 3994
135 Ga0496100_0007139 3300048903 Bacteria 6136
136 Ga0496100_0047655 3300048903 Bacteria 2763
137 Ga0496100_0139794 3300048903 Bacteria 1715
138 Ga0496101_0000595 3300048904 Bacteria 22001
139 Ga0496101_0039012 3300048904 Bacteria 3375
140 Ga0496102_0000001 3300048905 Bacteria 873433
141 Ga0496103_0000007 3300048906 Bacteria 354915
142 Ga0496104_0018254 3300048907 Bacteria 6399
143 Ga0496104_0021699 3300048907 Bacteria 5898
144 Ga0496105_0004586 3300048908 Bacteria 10406
145 Ga0496105_0009671 3300048908 Bacteria 7548
146 Ga0496105_0015602 3300048908 Bacteria 6058
147 Ga0496106_0012726 3300048909 Bacteria 6215
148 Ga0496106_0063179 3300048909 Bacteria 2813
149 Ga0496107_0029296 3300048910 Bacteria 3916
150 Ga0496108_0037337 3300048911 Bacteria 4045
151 Ga0496108_0044286 3300048911 Bacteria 3716
152 Ga0496108_0305281 3300048911 Bacteria 1386
153 Ga0496109_0017165 3300048912 Bacteria 6338
154 Ga0496110_0068521 3300048913 Bacteria 3140
155 Ga0496110_0086367 3300048913 Bacteria 2801
156 Ga0496111_0002927 3300048914 Bacteria 10439
157 Ga0496112_0018355 3300048915 Bacteria 6585
158 Ga0496113_0010321 3300048916 Bacteria 6172
159 Ga0496114_0002238 3300048917 Bacteria 14736
160 Ga0496114_0003739 3300048917 Bacteria 11722
161 Ga0496114_0045235 3300048917 Bacteria 3656
162 Ga0496114_0319736 3300048917 Bacteria 1371
163 Ga0496115_0047901 3300048918 Bacteria 3419
164 Ga0496116_0000823 3300048919 Bacteria 39132
165 Ga0496117_0000015 3300048920 Bacteria 583316
166 Ga0496118_0000012 3300048921 Bacteria 583316
167 Ga0496119_0050045 3300048922 Bacteria 2578
168 Ga0496120_0058712 3300048923 Bacteria 2159
169 Ga0496121_0004356 3300048924 Bacteria 19131
170 Ga0496121_0011173 3300048924 Bacteria 10012
171 Ga0496123_0004871 3300048926 Bacteria 13806
172 Ga0496126_0011613 3300048929 Bacteria 9090
173 Ga0501031_0053040 3300049568 Bacteria 2642
174 Ga0501038_0126436 3300049574 Bacteria 2104
175 Ga0501039_0074346 3300049575 Bacteria 2641
176 Ga0501043_0145049 3300049579 Bacteria 1859
177 Ga0501072_0257386 3300049588 Bacteria 1390
178 nmdc:mga00v17_3920_c1 3300050491 Bacteria 7675
179 nmdc:mga0yw44_73476_c1 3300050492 Bacteria 2127
180 nmdc:mga0sz30_14696_c1 3300050516 Bacteria 3086
181 Ga0495619_0076084 3300053085 Bacteria 2253
182 Ga0500643_005798 3300053087 Bacteria 5264
183 Ga0500573_0000220 3300053140 Bacteria 23454
184 Ga0500573_0019118 3300053140 Bacteria 3918
185 Ga0500616_0000305 3300053153 Bacteria 70598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100283859 Ga0070714_1002838591 416
2 3300006173 Ga0070716_100056646 Ga0070716_1000566462 416
3 iso_pu_bacteria 2582580736 2583152874 418
4 iso_pu_bacteria 8056207758 8056212546 419
5 3300005355 Ga0070671_100085480 Ga0070671_1000854802 421
6 3300005548 Ga0070665_100003602 Ga0070665_10000360211 421
7 3300005843 Ga0068860_100037184 Ga0068860_1000371845 421
8 3300025931 Ga0207644_10009238 Ga0207644_100092382 421
9 3300047472 Ga0495686_0024193 Ga0495686_0024193_590_1903 422
10 3300005327 Ga0070658_10124970 Ga0070658_101249702 423
11 3300005337 Ga0070682_100016727 Ga0070682_1000167273 423
12 3300005456 Ga0070678_100137469 Ga0070678_1001374691 423
13 3300005616 Ga0068852_100016360 Ga0068852_1000163602 423
14 3300005617 Ga0068859_100031138 Ga0068859_1000311383 423
15 3300005842 Ga0068858_100144645 Ga0068858_1001446452 423
16 3300005843 Ga0068860_100315780 Ga0068860_1003157802 423
17 3300006931 Ga0097620_100031136 Ga0097620_1000311363 423
18 3300009551 Ga0105238_10315405 Ga0105238_103154051 423
19 3300010375 Ga0105239_10012797 Ga0105239_100127972 423
20 3300013105 Ga0157369_10279226 Ga0157369_102792261 423
21 3300013297 Ga0157378_10167205 Ga0157378_101672052 423
22 3300013308 Ga0157375_10200589 Ga0157375_102005891 423
23 3300014745 Ga0157377_10028291 Ga0157377_100282912 423
24 3300025901 Ga0207688_10013818 Ga0207688_100138183 423
25 3300025909 Ga0207705_10042301 Ga0207705_100423012 423
26 3300025918 Ga0207662_10027139 Ga0207662_100271393 423
27 3300025919 Ga0207657_10119876 Ga0207657_101198762 423
28 3300025927 Ga0207687_10086968 Ga0207687_100869682 423
29 3300025932 Ga0207690_10124126 Ga0207690_101241262 423
30 3300025933 Ga0207706_10085515 Ga0207706_100855152 423
31 3300025938 Ga0207704_10076591 Ga0207704_100765912 423
32 3300025945 Ga0207679_10057757 Ga0207679_100577572 423
33 3300026067 Ga0207678_10004277 Ga0207678_100042775 423
34 3300026075 Ga0207708_10068069 Ga0207708_100680692 423
35 3300026142 Ga0207698_10012695 Ga0207698_100126952 423
36 3300028381 Ga0268264_10214119 Ga0268264_102141192 423
37 3300048911 Ga0496108_0044286 Ga0496108_0044286_2181_3464 423
38 3300048913 Ga0496110_0086367 Ga0496110_0086367_1016_2299 423
39 3300048903 Ga0496100_0047655 Ga0496100_0047655_1000_2286 424
40 3300048908 Ga0496105_0009671 Ga0496105_0009671_4380_5666 424
41 3300048917 Ga0496114_0002238 Ga0496114_0002238_9166_10452 424
42 3300053140 Ga0500573_0000220 Ga0500573_0000220_3607_4932 424
43 3300046471 Ga0495650_0052010 Ga0495650_0052010_86_1375 425
44 iso_pu_bacteria 2738541272 2738695235 426
45 iso_pu_bacteria 2738543027 2739326405 426
46 iso_pu_bacteria 2739367654 2739606140 426
47 iso_pu_bacteria 2758568522 2760307006 426
48 iso_pu_bacteria 2808606394 2809029367 426
49 iso_pu_bacteria 2895427314 2895429591 426
50 3300005338 Ga0068868_100031729 Ga0068868_1000317292 427
51 3300005455 Ga0070663_100092906 Ga0070663_1000929062 427
52 3300006237 Ga0097621_100096075 Ga0097621_1000960751 427
53 3300009101 Ga0105247_10055205 Ga0105247_100552052 427
54 3300009174 Ga0105241_10005195 Ga0105241_100051956 427
55 3300011119 Ga0105246_10108188 Ga0105246_101081882 427
56 3300013307 Ga0157372_10000004 Ga0157372_10000004120 427
57 3300013308 Ga0157375_10024924 Ga0157375_100249245 427
58 3300025915 Ga0207693_10011233 Ga0207693_100112335 427
59 3300025919 Ga0207657_10016498 Ga0207657_100164983 427
60 3300025924 Ga0207694_10144021 Ga0207694_101440211 427
61 3300026075 Ga0207708_10082855 Ga0207708_100828552 427
62 3300026121 Ga0207683_10044244 Ga0207683_100442442 427
63 3300048907 Ga0496104_0018254 Ga0496104_0018254_3406_4698 427
64 3300048908 Ga0496105_0015602 Ga0496105_0015602_1905_3197 427
65 3300048909 Ga0496106_0063179 Ga0496106_0063179_1226_2518 427
66 3300048911 Ga0496108_0037337 Ga0496108_0037337_1788_3080 427
67 3300048913 Ga0496110_0068521 Ga0496110_0068521_914_2206 427
68 3300048915 Ga0496112_0018355 Ga0496112_0018355_4004_5296 427
69 iso_pu_bacteria 2643221687 2644490178 427
70 iso_pu_bacteria 2808606448 2809229245 427
71 iso_pu_bacteria 2816332139 2816507668 427
72 iso_pu_bacteria 2837268691 2837271046 427
73 iso_pu_bacteria 2902792274 2902794990 427
74 iso_pu_bacteria 2902837492 2902839010 427
75 iso_pu_bacteria 2929212328 2929218315 427
76 iso_pu_bacteria 8023623736 8023626486 427
77 iso_pu_bacteria 8048127548 8048134304 427
78 iso_pu_bacteria 2857733635 2857734210 428
79 iso_pu_bacteria 2990044586 2990047529 428
80 iso_pu_bacteria 8008485437 8008491117 428
81 iso_pu_bacteria 8025524527 8025530446 428
82 3300005327 Ga0070658_10021603 Ga0070658_100216034 429
83 iso_pu_bacteria 2866612099 2866613244 429
84 3300006946 Ga0079104_1000010 Ga0079104_1000010137 430
85 3300025909 Ga0207705_10117662 Ga0207705_101176621 430
86 3300027111 Ga0209281_1000078 Ga0209281_100007819 430
87 3300048924 Ga0496121_0011173 Ga0496121_0011173_864_2192 430
88 3300048926 Ga0496123_0004871 Ga0496123_0004871_2351_3688 430
89 3300053153 Ga0500616_0000305 Ga0500616_0000305_24522_25814 430
90 iso_pu_bacteria 2821123053 2821124089 430
91 iso_pu_bacteria 2838736955 2838738885 430
92 iso_pu_bacteria 2841840854 2841842784 430
93 iso_pu_bacteria 2842140634 2842142564 430
94 iso_pu_bacteria 2857531043 2857531652 430
95 iso_pu_bacteria 2867346516 2867351109 430
96 3300003792 Ga0055540_1003449 Ga0055540_10034492 431
97 3300003792 Ga0055540_1004113 Ga0055540_10041135 431
98 3300005339 Ga0070660_100044961 Ga0070660_1000449613 431
99 3300005436 Ga0070713_100266251 Ga0070713_1002662511 431
100 3300005437 Ga0070710_10027405 Ga0070710_100274052 431
101 3300005439 Ga0070711_100102418 Ga0070711_1001024182 431
102 3300005455 Ga0070663_100089443 Ga0070663_1000894431 431
103 3300005455 Ga0070663_100117104 Ga0070663_1001171041 431
104 3300005458 Ga0070681_10013343 Ga0070681_100133439 431
105 3300005530 Ga0070679_100010991 Ga0070679_1000109912 431
106 3300005539 Ga0068853_100013280 Ga0068853_1000132802 431
107 3300005546 Ga0070696_100019212 Ga0070696_1000192122 431
108 3300005548 Ga0070665_100038423 Ga0070665_1000384235 431
109 3300005548 Ga0070665_100183498 Ga0070665_1001834981 431
110 3300005549 Ga0070704_100122193 Ga0070704_1001221931 431
111 3300005577 Ga0068857_100150375 Ga0068857_1001503752 431
112 3300005578 Ga0068854_100036258 Ga0068854_1000362583 431
113 3300005617 Ga0068859_100094764 Ga0068859_1000947642 431
114 3300005618 Ga0068864_100040313 Ga0068864_1000403134 431
115 3300005719 Ga0068861_100018307 Ga0068861_1000183074 431
116 3300005841 Ga0068863_100055802 Ga0068863_1000558023 431
117 3300005842 Ga0068858_100237739 Ga0068858_1002377391 431
118 3300005843 Ga0068860_100025771 Ga0068860_1000257716 431
119 3300005983 Ga0081540_1002506 Ga0081540_10025062 431
120 3300006038 Ga0075365_10003089 Ga0075365_100030895 431
121 3300006048 Ga0075363_100057962 Ga0075363_1000579622 431
122 3300006051 Ga0075364_10042717 Ga0075364_100427173 431
123 3300006177 Ga0075362_10059640 Ga0075362_100596402 431
124 3300006186 Ga0075369_10002327 Ga0075369_100023271 431
125 3300006852 Ga0075433_10026465 Ga0075433_100264656 431
126 3300006871 Ga0075434_100079453 Ga0075434_1000794531 431
127 3300006881 Ga0068865_100162344 Ga0068865_1001623442 431
128 3300006931 Ga0097620_100094767 Ga0097620_1000947672 431
129 3300009094 Ga0111539_10158621 Ga0111539_101586212 431
130 3300009177 Ga0105248_10108542 Ga0105248_101085422 431
131 3300009545 Ga0105237_10032406 Ga0105237_100324065 431
132 3300009551 Ga0105238_10164238 Ga0105238_101642382 431
133 3300010375 Ga0105239_10017933 Ga0105239_100179335 431
134 3300013104 Ga0157370_10186040 Ga0157370_101860402 431
135 3300013105 Ga0157369_10038845 Ga0157369_100388455 431
136 3300013306 Ga0163162_10205102 Ga0163162_102051022 431
137 3300013306 Ga0163162_10251105 Ga0163162_102511052 431
138 3300025303 Ga0209051_1000765 Ga0209051_100076522 431
139 3300025303 Ga0209051_1001295 Ga0209051_10012957 431
140 3300025303 Ga0209051_1002142 Ga0209051_10021422 431
141 3300025914 Ga0207671_10013176 Ga0207671_100131765 431
142 3300025919 Ga0207657_10061017 Ga0207657_100610173 431
143 3300025927 Ga0207687_10018937 Ga0207687_100189373 431
144 3300025927 Ga0207687_10032563 Ga0207687_100325633 431
145 3300025929 Ga0207664_10192421 Ga0207664_101924211 431
146 3300025934 Ga0207686_10038084 Ga0207686_100380842 431
147 3300025938 Ga0207704_10034710 Ga0207704_100347103 431
148 3300025939 Ga0207665_10071646 Ga0207665_100716462 431
149 3300025960 Ga0207651_10065034 Ga0207651_100650342 431
150 3300026035 Ga0207703_10033088 Ga0207703_100330883 431
151 3300026041 Ga0207639_10009297 Ga0207639_100092974 431
152 3300026067 Ga0207678_10051918 Ga0207678_100519182 431
153 3300026067 Ga0207678_10090946 Ga0207678_100909462 431
154 3300026116 Ga0207674_10148833 Ga0207674_101488334 431
155 3300026118 Ga0207675_100030596 Ga0207675_1000305964 431
156 3300026118 Ga0207675_100052093 Ga0207675_1000520932 431
157 3300028379 Ga0268266_10111440 Ga0268266_101114402 431
158 3300028800 Ga0265338_10005051 Ga0265338_100050518 431
159 3300031456 Ga0307513_10001342 Ga0307513_100013427 431
160 3300032002 Ga0307416_100212000 Ga0307416_1002120002 431
161 3300035090 Ga0373949_0007624 Ga0373949_0007624_69_1373 431
162 3300038443 Ga0395901_0104056 Ga0395901_0104056_756_2123 431
163 3300041413 Ga0439465_0000280 Ga0439465_0000280_19_1317 431
164 3300041452 Ga0451793_1682602 Ga0451793_1682602_348_1643 431
165 3300042004 Ga0439445_0002347 Ga0439445_0002347_762_2060 431
166 3300046473 Ga0495582_0051763 Ga0495582_0051763_923_2227 431
167 3300046506 Ga0495583_0022180 Ga0495583_0022180_20_1330 431
168 3300046507 Ga0495606_0033189 Ga0495606_0033189_1756_3057 431
169 3300046524 Ga0495648_0014130 Ga0495648_0014130_2636_3946 431
170 3300046531 Ga0495665_0067928 Ga0495665_0067928_134_1432 431
171 3300046533 Ga0495640_0024630 Ga0495640_0024630_1898_3202 431
172 3300046648 Ga0495611_0019693 Ga0495611_0019693_603_1913 431
173 3300046683 Ga0495658_0023509 Ga0495658_0023509_688_1992 431
174 3300046690 Ga0495624_0038458 Ga0495624_0038458_1012_2316 431
175 3300046692 Ga0495671_0016812 Ga0495671_0016812_1871_3181 431
176 3300047320 Ga0495672_0004361 Ga0495672_0004361_2636_3946 431
177 3300047469 Ga0495673_0007331 Ga0495673_0007331_2045_3355 431
178 3300048903 Ga0496100_0007139 Ga0496100_0007139_4467_5777 431
179 3300048903 Ga0496100_0139794 Ga0496100_0139794_37_1341 431
180 3300048904 Ga0496101_0000595 Ga0496101_0000595_4045_5355 431
181 3300048904 Ga0496101_0039012 Ga0496101_0039012_1605_2909 431
182 3300048905 Ga0496102_0000001 Ga0496102_0000001_33337_34647 431
183 3300048906 Ga0496103_0000007 Ga0496103_0000007_321042_322352 431
184 3300048907 Ga0496104_0021699 Ga0496104_0021699_2026_3330 431
185 3300048908 Ga0496105_0004586 Ga0496105_0004586_5161_6465 431
186 3300048909 Ga0496106_0012726 Ga0496106_0012726_2771_4075 431
187 3300048910 Ga0496107_0029296 Ga0496107_0029296_698_2002 431
188 3300048911 Ga0496108_0305281 Ga0496108_0305281_54_1358 431
189 3300048912 Ga0496109_0017165 Ga0496109_0017165_3729_5033 431
190 3300048914 Ga0496111_0002927 Ga0496111_0002927_4512_5816 431
191 3300048916 Ga0496113_0010321 Ga0496113_0010321_2034_3341 431
192 3300048917 Ga0496114_0003739 Ga0496114_0003739_4465_5811 431
193 3300048917 Ga0496114_0045235 Ga0496114_0045235_2332_3630 431
194 3300048917 Ga0496114_0319736 Ga0496114_0319736_16_1314 431
195 3300048918 Ga0496115_0047901 Ga0496115_0047901_1642_2940 431
196 3300048919 Ga0496116_0000823 Ga0496116_0000823_5334_6644 431
197 3300048920 Ga0496117_0000015 Ga0496117_0000015_548129_549439 431
198 3300048921 Ga0496118_0000012 Ga0496118_0000012_548129_549439 431
199 3300048922 Ga0496119_0050045 Ga0496119_0050045_979_2289 431
200 3300048923 Ga0496120_0058712 Ga0496120_0058712_459_1769 431
201 3300048924 Ga0496121_0004356 Ga0496121_0004356_4045_5355 431
202 3300048929 Ga0496126_0011613 Ga0496126_0011613_4083_5393 431
203 3300049568 Ga0501031_0053040 Ga0501031_0053040_1147_2451 431
204 3300049574 Ga0501038_0126436 Ga0501038_0126436_470_1774 431
205 3300049575 Ga0501039_0074346 Ga0501039_0074346_198_1502 431
206 3300049579 Ga0501043_0145049 Ga0501043_0145049_58_1410 431
207 3300049588 Ga0501072_0257386 Ga0501072_0257386_50_1354 431
208 3300050491 nmdc:mga00v17_3920_c1 nmdc:mga00v17_3920_c1_2824_4128 431
209 3300050492 nmdc:mga0yw44_73476_c1 nmdc:mga0yw44_73476_c1_719_2026 431
210 3300050516 nmdc:mga0sz30_14696_c1 nmdc:mga0sz30_14696_c1_1759_3066 431
211 3300053085 Ga0495619_0076084 Ga0495619_0076084_546_1850 431
212 3300053087 Ga0500643_005798 Ga0500643_005798_3189_4490 431
213 3300053140 Ga0500573_0019118 Ga0500573_0019118_1130_2434 431
214 iso_pu_bacteria 8047893842 8047900952 431
215 iso_pu_bacteria 8048356638 8048357949 431
216 iso_pu_bacteria 8048369669 8048377894 431
217 iso_pu_bacteria 8048379754 8048386992 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

111

523

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d7r-assembly1.cif.gz_A crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa 0.9592 2 431
1z3z-assembly1.cif.gz_A the crystal structure of a dgd mutant: q52a 0.9589 2 431
1dgd-assembly1.cif.gz_A an alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase 0.9576 2 431
1dka-assembly1.cif.gz_A dialkylglycine decarboxylase structure: bifunctional active site and alkali metal binding sites 0.9574 2 431
5m49-assembly1.cif.gz_A-2 alpha-amino epsilon-caprolactam racemase in complex with plp and d/l alpha amino epsilon-caprolactam (internal aldimine) 0.926 7 430
ID Description Score Start End Superfamily
af_Q2G1Y4_328_438_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9717 328 429 3.90.1150.10
1d7rA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9571 323 431 3.90.1150.10
1dgeA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9548 58 321 3.40.640.10
af_Q65WV6_290_384_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.952 328 422 3.90.1150.10
af_I1JL13_371_474_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9512 328 428 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A352RFZ0-F1-model_v4 Aspartate aminotransferase family protein (EC 2.6.1.19) 0.978 332 430 GO:0030170
GO:0034386
AF-A0A1V8TSG9-F1-model_v4 2,2-dialkylglycine decarboxylase 0.9684 3 430 GO:0005739
GO:0008483
GO:0030170
AF-M2Q8U3-F1-model_v4 Siderophore biosynthesis diaminobutyrate--2-oxoglutarate aminotransferase 0.9681 2 430 GO:0008483
GO:0017000
GO:0030170
AF-W9DIF6-F1-model_v4 Aminotransferase III 0.9673 202 430 GO:0008483
GO:0030170
AF-A0A3M1JQS2-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.967 306 430 GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
89.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map