F328283

General Info

Members Datasets Scaffolds Average Seq Length
217 180 193 178

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1052696|JGI25160J50197_10526962
Length 206
Sequence MIKPDGFRRALSILQEQCHLLKVVLIWSMTSYRRNFIPGGNFFFTVNLLDRRQSLLTANIDSLRAAFREIRQRHPFTIDAIVILPEHLHTVWTMPDGDADFAKRWRQIKSAFSRNLAPDEPVSASRAARGERGIWQRRYWEHTIRDEEDYARHIDYVHINPVKHGLVKRVRDWAPSSFHRHVELGIYPIDWAGDLSILESDFGERS

Samples

Sample ID Description Type Environment
1 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
2 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
3 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
4 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
5 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
6 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
7 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
8 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
9 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
10 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
11 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
12 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
13 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
14 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
15 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
16 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
17 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
18 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
19 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
175 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
176 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
177 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
178 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
179 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
180 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.64
Metatranscriptomes 2.3
Isolates 11.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.05
Nodule 5.07
Rhizoplane 8.76
Rhizosphere 59.91
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10007770 3300003215 Bacteria 5216
2 JGI25153J46596_10017136 3300003215 Bacteria 2868
3 JGI25160J50197_1052696 3300003354 Bacteria 854
4 Ga0065165_1058865 3300005262 Bacteria 1059
5 Ga0070660_100469818 3300005339 Bacteria 1045
6 Ga0070661_100049209 3300005344 Bacteria 3085
7 Ga0070671_100257406 3300005355 Bacteria 1483
8 Ga0070659_100608983 3300005366 Bacteria 939
9 Ga0070714_100035029 3300005435 Bacteria 4205
10 Ga0070694_101187548 3300005444 Bacteria 639
11 Ga0070663_100251989 3300005455 Bacteria 1397
12 Ga0070663_101183630 3300005455 Bacteria 671
13 Ga0070681_10138189 3300005458 Bacteria 2366
14 Ga0070679_100240136 3300005530 Bacteria 1769
15 Ga0070665_100021472 3300005548 Bacteria 6493
16 Ga0068855_100337397 3300005563 Bacteria 1663
17 Ga0068855_101261765 3300005563 Bacteria 766
18 Ga0070664_100563808 3300005564 Bacteria 1054
19 Ga0068856_100141351 3300005614 Bacteria 2414
20 Ga0068862_100621854 3300005844 Bacteria 1039
21 Ga0070717_10058802 3300006028 Bacteria 3179
22 Ga0075365_10283350 3300006038 Bacteria 1166
23 Ga0075365_10742288 3300006038 Bacteria 693
24 Ga0075364_10583134 3300006051 Bacteria 764
25 Ga0075367_10108878 3300006178 Bacteria 1699
26 Ga0075369_10046871 3300006186 Bacteria 1862
27 Ga0075369_10149496 3300006186 Bacteria 1067
28 Ga0075428_100097838 3300006844 Bacteria 3199
29 Ga0075431_100387987 3300006847 Bacteria 1399
30 Ga0075433_10347052 3300006852 Bacteria 1312
31 Ga0075434_100180855 3300006871 Bacteria 2129
32 Ga0075436_100094604 3300006914 Bacteria 2078
33 Ga0075435_100732239 3300007076 Bacteria 860
34 Ga0099795_10218792 3300007788 Bacteria 810
35 Ga0105240_10312730 3300009093 Bacteria 1793
36 Ga0111539_10407442 3300009094 Unclassified 1584
37 Ga0111539_11646505 3300009094 Bacteria 744
38 Ga0105237_11514740 3300009545 Bacteria 677
39 Ga0105238_10325550 3300009551 Bacteria 1523
40 Ga0105238_10591970 3300009551 Bacteria 1116
41 Ga0105239_10532852 3300010375 Bacteria 1337
42 Ga0157373_10674270 3300013100 Bacteria 756
43 Ga0157369_10658216 3300013105 Bacteria 1080
44 Ga0157378_11065492 3300013297 Bacteria 844
45 Ga0157378_11179347 3300013297 Bacteria 805
46 Ga0157379_11283591 3300014968 Bacteria 707
47 Ga0209673_1016486 3300025273 Bacteria 2759
48 Ga0209564_1017273 3300025295 Bacteria 2822
49 Ga0209758_1000604 3300025297 Bacteria 55558
50 Ga0209758_1001681 3300025297 Bacteria 24938
51 Ga0209758_1004914 3300025297 Bacteria 10746
52 Ga0209256_1002850 3300025299 Bacteria 13179
53 Ga0207426_1047222 3300025302 Bacteria 1300
54 Ga0207647_10296560 3300025904 Bacteria 921
55 Ga0207684_10719746 3300025910 Bacteria 847
56 Ga0207707_10109008 3300025912 Bacteria 2421
57 Ga0207695_10359351 3300025913 Bacteria 1343
58 Ga0207693_10003748 3300025915 Bacteria 12956
59 Ga0207657_10281456 3300025919 Bacteria 1320
60 Ga0207664_10340816 3300025929 Bacteria 1325
61 Ga0207644_10077657 3300025931 Bacteria 2446
62 Ga0207690_10126985 3300025932 Bacteria 1861
63 Ga0207661_10649848 3300025944 Bacteria 969
64 Ga0207667_10275930 3300025949 Bacteria 1718
65 Ga0207677_10512803 3300026023 Bacteria 1039
66 Ga0207698_11199434 3300026142 Bacteria 773
67 Ga0207428_10589689 3300027907 Bacteria 802
68 Ga0268265_10569255 3300028380 Bacteria 1078
69 Ga0307515_10143881 3300028794 Bacteria 2539
70 Ga0265331_10174216 3300031250 Bacteria 972
71 Ga0316575_10095947 3300031665 Bacteria 1204
72 Ga0316575_10102420 3300031665 Bacteria 1165
73 Ga0316579_10014024 3300031691 Bacteria 3455
74 Ga0316576_10010798 3300031727 Bacteria 5950
75 Ga0316578_10005235 3300031728 Bacteria 6257
76 Ga0316578_10541028 3300031728 Bacteria 684
77 Ga0316577_10003526 3300031733 Bacteria 7919
78 Ga0316577_10245679 3300031733 Bacteria 1012
79 Ga0307415_100037682 3300032126 Bacteria 3180
80 Ga0316583_10025260 3300032133 Bacteria 2122
81 Ga0316585_10001167 3300032137 Bacteria 6847
82 Ga0316585_10007165 3300032137 Bacteria 3207
83 Ga0316580_10009998 3300032139 Bacteria 2856
84 Ga0316580_10058935 3300032139 Bacteria 1179
85 Ga0316592_1005676 3300033524 Bacteria 2380
86 Ga0316592_1026787 3300033524 Bacteria 1245
87 Ga0316588_1007061 3300033528 Bacteria 2269
88 Ga0316588_1019011 3300033528 Bacteria 1544
89 Ga0316596_1060362 3300033541 Bacteria 1011
90 Ga0316574_0082113 3300035398 Bacteria 2047
91 Ga0316574_0477128 3300035398 Bacteria 779
92 Ga0373927_0065097 3300035695 Bacteria 2358
93 Ga0316582_0004065 3300036647 Bacteria 7310
94 Ga0316582_0281022 3300036647 Bacteria 1142
95 Ga0316584_0002632 3300036712 Bacteria 11449
96 Ga0316584_0680840 3300036712 Bacteria 706
97 Ga0395900_1306787 3300037418 Bacteria 639
98 Ga0395898_0422627 3300037466 Bacteria 1270
99 Ga0395905_0869917 3300037471 Bacteria 804
100 Ga0316581_0025339 3300037588 Bacteria 1765
101 Ga0436365_0706616 3300039437 Bacteria 6574
102 Ga0451839_0299249 3300041496 Bacteria 789
103 Ga0451576_0413112 3300045051 Bacteria 1415
104 Ga0451576_1311858 3300045051 Bacteria 754
105 Ga0495629_0035382 3300046459 Bacteria 3529
106 Ga0495638_0002950 3300046460 Bacteria 13577
107 Ga0495638_0028036 3300046460 Bacteria 3639
108 Ga0495651_0075309 3300046462 Bacteria 2559
109 Ga0495651_0353837 3300046462 Bacteria 970
110 Ga0495653_0121893 3300046463 Bacteria 1857
111 Ga0495605_0120930 3300046474 Bacteria 1187
112 Ga0495594_0288140 3300046499 Bacteria 936
113 Ga0495606_0013411 3300046507 Bacteria 6473
114 Ga0495648_0002538 3300046524 Bacteria 16738
115 Ga0495648_0025067 3300046524 Bacteria 4046
116 Ga0495652_0044127 3300046529 Bacteria 3840
117 Ga0495640_0020808 3300046533 Bacteria 4822
118 Ga0495625_0197146 3300046660 Bacteria 1331
119 Ga0495635_0487430 3300046663 Bacteria 812
120 Ga0495588_0102469 3300046674 Bacteria 1505
121 Ga0495657_0053696 3300046675 Bacteria 2695
122 Ga0495623_0378883 3300046679 Bacteria 765
123 Ga0495613_0599238 3300046689 Bacteria 733
124 Ga0495624_0020110 3300046690 Bacteria 4447
125 Ga0495671_0409095 3300046692 Bacteria 649
126 Ga0495649_0033270 3300046694 Bacteria 2838
127 Ga0495600_0167760 3300046809 Bacteria 1418
128 Ga0495604_0007448 3300047317 Bacteria 8668
129 Ga0495676_0111617 3300047321 Bacteria 2005
130 Ga0495673_0080482 3300047469 Bacteria 1350
131 Ga0495686_0480417 3300047472 Bacteria 657
132 Ga0495602_0094126 3300048088 Bacteria 2477
133 Ga0495602_0296897 3300048088 Bacteria 1184
134 Ga0496100_0008913 3300048903 Bacteria 5613
135 Ga0496101_0059784 3300048904 Bacteria 2763
136 Ga0496104_0003845 3300048907 Bacteria 12994
137 Ga0496105_0118194 3300048908 Bacteria 2187
138 Ga0496105_0203562 3300048908 Bacteria 1615
139 Ga0496106_0005399 3300048909 Bacteria 9454
140 Ga0496107_0004190 3300048910 Bacteria 9740
141 Ga0496107_0637261 3300048910 Bacteria 786
142 Ga0496108_0090296 3300048911 Bacteria 2604
143 Ga0496109_0002495 3300048912 Bacteria 15424
144 Ga0496109_0708043 3300048912 Bacteria 944
145 Ga0496110_0005976 3300048913 Bacteria 9583
146 Ga0496110_0007541 3300048913 Bacteria 8690
147 Ga0496112_0020450 3300048915 Bacteria 6275
148 Ga0496112_0572401 3300048915 Bacteria 1062
149 Ga0496113_0006711 3300048916 Bacteria 7330
150 Ga0496113_0555964 3300048916 Unclassified 920
151 Ga0496114_0448158 3300048917 Bacteria 1143
152 Ga0496115_0347331 3300048918 Bacteria 1210
153 Ga0496119_0011821 3300048922 Bacteria 7170
154 Ga0496121_0157334 3300048924 Bacteria 1666
155 Ga0496121_0172921 3300048924 Bacteria 1567
156 Ga0496126_0267215 3300048929 Bacteria 1420
157 Ga0501037_0396421 3300049573 Bacteria 947
158 Ga0501070_0513266 3300049586 Unclassified 962
159 Ga0501071_0068325 3300049587 Bacteria 2585
160 Ga0501073_0119291 3300049589 Bacteria 1828
161 Ga0501074_0249230 3300049590 Bacteria 1263
162 Ga0501076_0070475 3300049592 Bacteria 2795
163 Ga0501080_0132610 3300049742 Bacteria 2306
164 Ga0501083_0091253 3300049744 Bacteria 2011
165 Ga0501083_0345459 3300049744 Bacteria 967
166 Ga0501044_0100587 3300049823 Bacteria 2909
167 nmdc:mga00v17_179451_c1 3300050491 Bacteria 1366
168 nmdc:mga0yw44_76869_c1 3300050492 Bacteria 2084
169 nmdc:mga0k408_484716_c1 3300050493 Bacteria 733
170 nmdc:mga06z11_84305_c1 3300050494 Bacteria 1712
171 nmdc:mga07m45_600718_c1 3300050496 Bacteria 635
172 nmdc:mga06r32_702745_c1 3300050510 Bacteria 977
173 nmdc:mga08y16_326434_c1 3300050511 Unclassified 1579
174 nmdc:mga08y16_88736_c1 3300050511 Bacteria 3223
175 nmdc:mga0n895_35264_c1 3300050512 Unclassified 4822
176 nmdc:mga0rr50_11560_c1 3300050513 Bacteria 5657
177 nmdc:mga0a205_18708_c1 3300050515 Bacteria 6519
178 nmdc:mga0a205_51959_c1 3300050515 Bacteria 3956
179 nmdc:mga0sz30_105321_c1 3300050516 Bacteria 1234
180 nmdc:mga0sz30_89404_c1 3300050516 Bacteria 1339
181 Ga0500578_0207079 3300053086 Bacteria 1198
182 Ga0500646_0227108 3300053090 Bacteria 649
183 Ga0500651_0229897 3300053093 Unclassified 1085
184 Ga0500556_0019631 3300053104 Bacteria 2150
185 Ga0500562_005231 3300053108 Bacteria 3259
186 Ga0500595_003543 3300053119 Bacteria 7257
187 Ga0500604_0096413 3300053151 Bacteria 971
188 Ga0500620_186104 3300053155 Bacteria 714
189 Ga0500622_0089991 3300053156 Bacteria 1524
190 Ga0500645_064601 3300053730 Bacteria 1055
191 Ga0500609_005935 3300053731 Bacteria 1666
192 Ga0500601_000969 3300053737 Bacteria 3350
193 Ga0500601_001124 3300053737 Bacteria 3027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_51959_c1 nmdc:mga0a205_51959_c1_1496_1924 142
2 3300009094 Ga0111539_10407442 Ga0111539_104074423 147
3 3300050511 nmdc:mga08y16_326434_c1 nmdc:mga08y16_326434_c1_990_1433 147
4 3300050512 nmdc:mga0n895_35264_c1 nmdc:mga0n895_35264_c1_3668_4111 147
5 3300050513 nmdc:mga0rr50_11560_c1 nmdc:mga0rr50_11560_c1_933_1376 147
6 3300050515 nmdc:mga0a205_18708_c1 nmdc:mga0a205_18708_c1_712_1155 147
7 3300046524 Ga0495648_0002538 Ga0495648_0002538_13463_13915 149
8 3300048910 Ga0496107_0637261 Ga0496107_0637261_319_774 150
9 iso_pu_bacteria 2989392574 2989394424 167
10 iso_pu_bacteria 8001522603 8001523459 170
11 3300031250 Ga0265331_10174216 Ga0265331_101742162 172
12 3300031665 Ga0316575_10095947 Ga0316575_100959472 172
13 3300053093 Ga0500651_0229897 Ga0500651_0229897_44_571 172
14 iso_pu_bacteria 2841941048 2841945000 173
15 iso_pu_bacteria 2885366525 2885373971 173
16 iso_pu_bacteria 8006926726 8006929830 173
17 iso_pu_bacteria 8019648815 8019649038 173
18 3300009094 Ga0111539_11646505 Ga0111539_116465051 174
19 3300050493 nmdc:mga0k408_484716_c1 nmdc:mga0k408_484716_c1_138_665 174
20 iso_pu_bacteria 2824626560 2824634712 174
21 iso_pu_bacteria 2824635225 2824642594 174
22 iso_pu_bacteria 2824644064 2824650386 174
23 iso_pu_bacteria 2824714736 2824720259 174
24 iso_pu_bacteria 2824723954 2824730558 174
25 iso_pu_bacteria 2932801729 2932802421 174
26 iso_pu_bacteria 2936055302 2936060601 174
27 3300006038 Ga0075365_10283350 Ga0075365_102833501 175
28 3300006844 Ga0075428_100097838 Ga0075428_1000978383 175
29 3300006847 Ga0075431_100387987 Ga0075431_1003879872 175
30 3300006852 Ga0075433_10347052 Ga0075433_103470522 175
31 3300006914 Ga0075436_100094604 Ga0075436_1000946042 175
32 3300027907 Ga0207428_10589689 Ga0207428_105896891 175
33 3300045051 Ga0451576_1311858 Ga0451576_1311858_115_642 175
34 3300050492 nmdc:mga0yw44_76869_c1 nmdc:mga0yw44_76869_c1_477_1010 175
35 3300050510 nmdc:mga06r32_702745_c1 nmdc:mga06r32_702745_c1_118_645 175
36 3300050511 nmdc:mga08y16_88736_c1 nmdc:mga08y16_88736_c1_2575_3102 175
37 iso_pu_bacteria 2744054633 2745077026 175
38 3300005548 Ga0070665_100021472 Ga0070665_1000214728 176
39 3300005563 Ga0068855_100337397 Ga0068855_1003373972 176
40 3300009093 Ga0105240_10312730 Ga0105240_103127302 176
41 3300014968 Ga0157379_11283591 Ga0157379_112835911 176
42 3300025910 Ga0207684_10719746 Ga0207684_107197462 176
43 3300025913 Ga0207695_10359351 Ga0207695_103593512 176
44 3300025949 Ga0207667_10275930 Ga0207667_102759302 176
45 3300037466 Ga0395898_0422627 Ga0395898_0422627_300_833 176
46 3300039437 Ga0436365_0706616 Ga0436365_0706616_5517_6050 176
47 3300046460 Ga0495638_0028036 Ga0495638_0028036_1199_1729 176
48 3300049744 Ga0501083_0345459 Ga0501083_0345459_347_877 176
49 3300053090 Ga0500646_0227108 Ga0500646_0227108_43_573 176
50 3300053119 Ga0500595_003543 Ga0500595_003543_1587_2123 176
51 3300053731 Ga0500609_005935 Ga0500609_005935_100_630 176
52 iso_pu_bacteria 2517093001 2517100685 176
53 iso_pu_bacteria 2617270735 2617353516 176
54 iso_pu_bacteria 2791355196 2793061940 176
55 iso_pu_bacteria 2841957949 2841961974 176
56 iso_pu_bacteria 2885409591 2885412601 176
57 iso_pu_bacteria 2906626472 2906627532 176
58 iso_pu_bacteria 3005483717 3005488318 176
59 3300005344 Ga0070661_100049209 Ga0070661_1000492092 177
60 3300005355 Ga0070671_100257406 Ga0070671_1002574062 177
61 3300005435 Ga0070714_100035029 Ga0070714_1000350293 177
62 3300005458 Ga0070681_10138189 Ga0070681_101381894 177
63 3300005530 Ga0070679_100240136 Ga0070679_1002401362 177
64 3300005564 Ga0070664_100563808 Ga0070664_1005638081 177
65 3300005614 Ga0068856_100141351 Ga0068856_1001413513 177
66 3300006028 Ga0070717_10058802 Ga0070717_100588022 177
67 3300006178 Ga0075367_10108878 Ga0075367_101088783 177
68 3300007788 Ga0099795_10218792 Ga0099795_102187922 177
69 3300009551 Ga0105238_10325550 Ga0105238_103255502 177
70 3300013100 Ga0157373_10674270 Ga0157373_106742701 177
71 3300013105 Ga0157369_10658216 Ga0157369_106582162 177
72 3300013297 Ga0157378_11179347 Ga0157378_111793471 177
73 3300025912 Ga0207707_10109008 Ga0207707_101090083 177
74 3300025915 Ga0207693_10003748 Ga0207693_100037487 177
75 3300025929 Ga0207664_10340816 Ga0207664_103408163 177
76 3300025931 Ga0207644_10077657 Ga0207644_100776572 177
77 3300025944 Ga0207661_10649848 Ga0207661_106498481 177
78 3300026142 Ga0207698_11199434 Ga0207698_111994341 177
79 3300031665 Ga0316575_10102420 Ga0316575_101024202 177
80 3300031691 Ga0316579_10014024 Ga0316579_100140244 177
81 3300031727 Ga0316576_10010798 Ga0316576_100107983 177
82 3300031728 Ga0316578_10005235 Ga0316578_100052353 177
83 3300031728 Ga0316578_10541028 Ga0316578_105410281 177
84 3300031733 Ga0316577_10003526 Ga0316577_100035262 177
85 3300031733 Ga0316577_10245679 Ga0316577_102456792 177
86 3300032133 Ga0316583_10025260 Ga0316583_100252605 177
87 3300032137 Ga0316585_10001167 Ga0316585_100011673 177
88 3300032137 Ga0316585_10007165 Ga0316585_100071652 177
89 3300032139 Ga0316580_10009998 Ga0316580_100099983 177
90 3300032139 Ga0316580_10058935 Ga0316580_100589351 177
91 3300033524 Ga0316592_1005676 Ga0316592_10056764 177
92 3300033524 Ga0316592_1026787 Ga0316592_10267872 177
93 3300033528 Ga0316588_1007061 Ga0316588_10070614 177
94 3300033528 Ga0316588_1019011 Ga0316588_10190112 177
95 3300033541 Ga0316596_1060362 Ga0316596_10603622 177
96 3300035398 Ga0316574_0082113 Ga0316574_0082113_290_826 177
97 3300035398 Ga0316574_0477128 Ga0316574_0477128_31_567 177
98 3300035695 Ga0373927_0065097 Ga0373927_0065097_1320_1856 177
99 3300036647 Ga0316582_0004065 Ga0316582_0004065_5640_6176 177
100 3300036647 Ga0316582_0281022 Ga0316582_0281022_171_707 177
101 3300036712 Ga0316584_0002632 Ga0316584_0002632_10509_11045 177
102 3300036712 Ga0316584_0680840 Ga0316584_0680840_65_601 177
103 3300037588 Ga0316581_0025339 Ga0316581_0025339_1192_1728 177
104 3300045051 Ga0451576_0413112 Ga0451576_0413112_288_821 177
105 3300046459 Ga0495629_0035382 Ga0495629_0035382_2064_2597 177
106 3300046462 Ga0495651_0075309 Ga0495651_0075309_1821_2354 177
107 3300046462 Ga0495651_0353837 Ga0495651_0353837_220_762 177
108 3300046463 Ga0495653_0121893 Ga0495653_0121893_550_1083 177
109 3300046499 Ga0495594_0288140 Ga0495594_0288140_17_550 177
110 3300046529 Ga0495652_0044127 Ga0495652_0044127_1245_1778 177
111 3300046533 Ga0495640_0020808 Ga0495640_0020808_2788_3321 177
112 3300046663 Ga0495635_0487430 Ga0495635_0487430_39_572 177
113 3300046674 Ga0495588_0102469 Ga0495588_0102469_59_592 177
114 3300046675 Ga0495657_0053696 Ga0495657_0053696_1161_1694 177
115 3300046679 Ga0495623_0378883 Ga0495623_0378883_172_714 177
116 3300046689 Ga0495613_0599238 Ga0495613_0599238_129_662 177
117 3300046690 Ga0495624_0020110 Ga0495624_0020110_1141_1674 177
118 3300046809 Ga0495600_0167760 Ga0495600_0167760_406_939 177
119 3300047317 Ga0495604_0007448 Ga0495604_0007448_6057_6590 177
120 3300047321 Ga0495676_0111617 Ga0495676_0111617_1122_1655 177
121 3300048088 Ga0495602_0094126 Ga0495602_0094126_163_696 177
122 3300048088 Ga0495602_0296897 Ga0495602_0296897_13_555 177
123 3300048903 Ga0496100_0008913 Ga0496100_0008913_3599_4135 177
124 3300048904 Ga0496101_0059784 Ga0496101_0059784_1263_1799 177
125 3300048907 Ga0496104_0003845 Ga0496104_0003845_5191_5727 177
126 3300048908 Ga0496105_0118194 Ga0496105_0118194_1171_1707 177
127 3300048908 Ga0496105_0203562 Ga0496105_0203562_586_1122 177
128 3300048909 Ga0496106_0005399 Ga0496106_0005399_403_939 177
129 3300048910 Ga0496107_0004190 Ga0496107_0004190_6246_6782 177
130 3300048911 Ga0496108_0090296 Ga0496108_0090296_1807_2343 177
131 3300048912 Ga0496109_0002495 Ga0496109_0002495_7629_8165 177
132 3300048912 Ga0496109_0708043 Ga0496109_0708043_359_895 177
133 3300048913 Ga0496110_0005976 Ga0496110_0005976_8541_9077 177
134 3300048913 Ga0496110_0007541 Ga0496110_0007541_7656_8192 177
135 3300048915 Ga0496112_0020450 Ga0496112_0020450_2773_3309 177
136 3300048915 Ga0496112_0572401 Ga0496112_0572401_392_928 177
137 3300048916 Ga0496113_0006711 Ga0496113_0006711_6168_6704 177
138 3300048916 Ga0496113_0555964 Ga0496113_0555964_175_711 177
139 3300048917 Ga0496114_0448158 Ga0496114_0448158_117_653 177
140 3300048918 Ga0496115_0347331 Ga0496115_0347331_623_1159 177
141 3300048922 Ga0496119_0011821 Ga0496119_0011821_6521_7054 177
142 3300048924 Ga0496121_0172921 Ga0496121_0172921_277_810 177
143 3300048929 Ga0496126_0267215 Ga0496126_0267215_650_1183 177
144 3300049573 Ga0501037_0396421 Ga0501037_0396421_328_861 177
145 3300049586 Ga0501070_0513266 Ga0501070_0513266_14_550 177
146 3300049587 Ga0501071_0068325 Ga0501071_0068325_301_846 177
147 3300049589 Ga0501073_0119291 Ga0501073_0119291_306_851 177
148 3300049590 Ga0501074_0249230 Ga0501074_0249230_57_602 177
149 3300049592 Ga0501076_0070475 Ga0501076_0070475_1682_2227 177
150 3300049742 Ga0501080_0132610 Ga0501080_0132610_243_788 177
151 3300049744 Ga0501083_0091253 Ga0501083_0091253_192_761 177
152 3300049823 Ga0501044_0100587 Ga0501044_0100587_148_684 177
153 3300050494 nmdc:mga06z11_84305_c1 nmdc:mga06z11_84305_c1_217_753 177
154 3300053155 Ga0500620_186104 Ga0500620_186104_129_662 177
155 3300053737 Ga0500601_000969 Ga0500601_000969_1293_1826 177
156 3300003215 JGI25153J46596_10017136 JGI25153J46596_100171362 178
157 3300003354 JGI25160J50197_1052696 JGI25160J50197_10526962 178
158 3300005262 Ga0065165_1058865 Ga0065165_10588652 178
159 3300005444 Ga0070694_101187548 Ga0070694_1011875481 178
160 3300005455 Ga0070663_100251989 Ga0070663_1002519892 178
161 3300006871 Ga0075434_100180855 Ga0075434_1001808552 178
162 3300007076 Ga0075435_100732239 Ga0075435_1007322391 178
163 3300009551 Ga0105238_10591970 Ga0105238_105919702 178
164 3300013297 Ga0157378_11065492 Ga0157378_110654921 178
165 3300025295 Ga0209564_1017273 Ga0209564_10172732 178
166 3300025297 Ga0209758_1000604 Ga0209758_100060458 178
167 3300025297 Ga0209758_1004914 Ga0209758_10049148 178
168 3300025299 Ga0209256_1002850 Ga0209256_10028508 178
169 3300025302 Ga0207426_1047222 Ga0207426_10472221 178
170 3300026023 Ga0207677_10512803 Ga0207677_105128031 178
171 3300028794 Ga0307515_10143881 Ga0307515_101438812 178
172 3300032126 Ga0307415_100037682 Ga0307415_1000376823 178
173 3300037418 Ga0395900_1306787 Ga0395900_1306787_38_574 178
174 3300037471 Ga0395905_0869917 Ga0395905_0869917_93_629 178
175 3300041496 Ga0451839_0299249 Ga0451839_0299249_203_739 178
176 3300046460 Ga0495638_0002950 Ga0495638_0002950_11269_11805 178
177 3300050496 nmdc:mga07m45_600718_c1 nmdc:mga07m45_600718_c1_50_586 178
178 3300053086 Ga0500578_0207079 Ga0500578_0207079_542_1078 178
179 3300053104 Ga0500556_0019631 Ga0500556_0019631_520_1056 178
180 3300053108 Ga0500562_005231 Ga0500562_005231_1788_2324 178
181 3300053151 Ga0500604_0096413 Ga0500604_0096413_35_571 178
182 3300053156 Ga0500622_0089991 Ga0500622_0089991_833_1369 178
183 3300003215 JGI25153J46596_10007770 JGI25153J46596_100077703 180
184 3300005339 Ga0070660_100469818 Ga0070660_1004698181 180
185 3300005366 Ga0070659_100608983 Ga0070659_1006089831 180
186 3300005455 Ga0070663_101183630 Ga0070663_1011836301 180
187 3300005563 Ga0068855_101261765 Ga0068855_1012617651 180
188 3300005844 Ga0068862_100621854 Ga0068862_1006218541 180
189 3300006038 Ga0075365_10742288 Ga0075365_107422881 180
190 3300006051 Ga0075364_10583134 Ga0075364_105831341 180
191 3300006186 Ga0075369_10046871 Ga0075369_100468712 180
192 3300006186 Ga0075369_10149496 Ga0075369_101494962 180
193 3300009545 Ga0105237_11514740 Ga0105237_115147401 180
194 3300010375 Ga0105239_10532852 Ga0105239_105328522 180
195 3300025273 Ga0209673_1016486 Ga0209673_10164863 180
196 3300025297 Ga0209758_1001681 Ga0209758_100168110 180
197 3300025904 Ga0207647_10296560 Ga0207647_102965601 180
198 3300025919 Ga0207657_10281456 Ga0207657_102814562 180
199 3300025932 Ga0207690_10126985 Ga0207690_101269852 180
200 3300028380 Ga0268265_10569255 Ga0268265_105692551 180
201 3300046474 Ga0495605_0120930 Ga0495605_0120930_403_945 180
202 3300046507 Ga0495606_0013411 Ga0495606_0013411_3691_4233 180
203 3300046524 Ga0495648_0025067 Ga0495648_0025067_460_1002 180
204 3300046660 Ga0495625_0197146 Ga0495625_0197146_307_849 180
205 3300046692 Ga0495671_0409095 Ga0495671_0409095_26_568 180
206 3300046694 Ga0495649_0033270 Ga0495649_0033270_1206_1748 180
207 3300047469 Ga0495673_0080482 Ga0495673_0080482_543_1085 180
208 3300047472 Ga0495686_0480417 Ga0495686_0480417_78_620 180
209 3300048924 Ga0496121_0157334 Ga0496121_0157334_14_556 180
210 3300050491 nmdc:mga00v17_179451_c1 nmdc:mga00v17_179451_c1_588_1130 180
211 3300050516 nmdc:mga0sz30_105321_c1 nmdc:mga0sz30_105321_c1_491_1033 180
212 3300050516 nmdc:mga0sz30_89404_c1 nmdc:mga0sz30_89404_c1_545_1087 180
213 3300053730 Ga0500645_064601 Ga0500645_064601_123_665 180
214 3300053737 Ga0500601_001124 Ga0500601_001124_44_586 180
215 iso_pu_bacteria 2935777560 2935784549 180
216 iso_pu_bacteria 8016613128 8016620550 180
217 iso_pu_bacteria 8019538911 8019542382 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01797

Y1_Tnp

Transposase IS200 like

43

160

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.7948 1 174
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.7767 1 174
2r7t-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7207 32 82
2a6o-assembly1.cif.gz_A crystal structure of the ishp608 transposase in complex with stem-loop dna 0.6737 12 124
3ab2-assembly1.cif.gz_D crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.6612 26 80
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7948 1 174 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7767 1 174 3.30.70.1290
af_A0A1D6LBY0_366_425_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.681 15 76 3.30.70.260
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6757 3 114 3.30.70.1290
2a6mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6666 12 124 3.30.70.1290
ID Description Score Start End GO Terms
AF-F9ZDW5-F1-model_v4 Transposase IS200-family protein 0.9701 2 114 GO:0004803
GO:0006313
GO:0043565
AF-A0A4C9EU92-F1-model_v4 Transposase 0.9595 1 79 GO:0004803
GO:0006313
GO:0043565
AF-A0A3S0VKZ3-F1-model_v4 Transposase 0.9556 2 124 GO:0004803
GO:0006313
GO:0043565
AF-A0A450T0D2-F1-model_v4 REP element-mobilizing transposase RayT 0.952 2 101 GO:0004803
GO:0006313
GO:0043565
AF-Q5P3V8-F1-model_v4 Transposase 0.9505 1 107 GO:0004803
GO:0006313
GO:0043565

Feature Viewer

pLDDT pTM Quality
85.47 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map