F328027

General Info

Members Datasets Scaffolds Average Seq Length
216 143 432 507

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0005260|Ga0496119_0005260_5202_7037
Length 583
Sequence MAAFSFTSERINEGELRKQLQDPAAGGYASFEGWVRNHNEGLPVRHLEYEAFEPLAIKEGERIVAEAIKRFGIEHAACVHRIGDLDIGEMAVWVGVSARHRAEAFAACRYIIDEVKHRVPIWKKEHYENGDSGWVNCERCAAPNTDHVEQVPGTDRGHVAGAHDHSHHAHGSTARAGADASTNRQGQTLSPAAASALASIHGRDAKHLDHGAXXXXRHDAGTVAVAATHARIGAPVPDYSRQMALKEVGAAGQAKLRASRVLVVGCGGLGVPVISYLAGAGIGRLSLIDSDHLEPSNLHRQTMYALADVGKPKAQLAAERVRALNPDVDVRAYTTRLDALNAPDLIAQHDLVIDCTDNFSTKFLLNDYCVQLGKPVVFASVYQYEGQLQIVQPGSACLRCVWPEATRDGIVGNCSEAGVLGPVPGIFGGLQAFEAMKLLLDLPGQLKDELLVLDLLTLSTSRVRTKRASTCPEHAVSRATATSPLELSFDTLDQAYDAGFDIVDIREPHELEETPTPSAHARSLPMAQLLHGQPPFKPNRKTVLVCATGRRSIAATQELRERGIADVYSLRGGVKGLQARLFT

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 1.39
Rhizosphere 83.8
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0005260 3300048922 Bacteria 12476
2 JGI25406J46586_10008598 3300003203 Bacteria 4612
3 rootL2_10131677 3300003322 Bacteria 3290
4 Ga0070683_100035411 3300005329 Bacteria 4563
5 Ga0070690_100035092 3300005330 Bacteria 3146
6 Ga0070677_10001814 3300005333 Bacteria 6739
7 Ga0070666_10045872 3300005335 Bacteria 2930
8 Ga0070682_100033409 3300005337 Bacteria 3125
9 Ga0070682_100079719 3300005337 Bacteria 2115
10 Ga0070675_100044751 3300005354 Bacteria 3620
11 Ga0070667_100002510 3300005367 Bacteria 16008
12 Ga0070667_100005695 3300005367 Bacteria 10404
13 Ga0070713_100130491 3300005436 Bacteria 2215
14 Ga0070678_100019646 3300005456 Bacteria 4412
15 Ga0070681_10011807 3300005458 Bacteria 8660
16 Ga0070681_10049800 3300005458 Bacteria 4182
17 Ga0070681_10050339 3300005458 Bacteria 4157
18 Ga0070681_10122136 3300005458 Bacteria 2538
19 Ga0068867_100141705 3300005459 Bacteria 1880
20 Ga0070679_100008335 3300005530 Bacteria 9750
21 Ga0068853_100154762 3300005539 Bacteria 2065
22 Ga0070672_100024711 3300005543 Bacteria 4445
23 Ga0070672_100113157 3300005543 Bacteria 2215
24 Ga0070686_100009103 3300005544 Bacteria 5571
25 Ga0070665_100003982 3300005548 Bacteria 15579
26 Ga0070665_100009848 3300005548 Bacteria 9660
27 Ga0070665_100020957 3300005548 Bacteria 6569
28 Ga0070665_100023264 3300005548 Bacteria 6240
29 Ga0070665_100041998 3300005548 Bacteria 4597
30 Ga0068855_100005663 3300005563 Bacteria 15250
31 Ga0068855_100006200 3300005563 Bacteria 14580
32 Ga0068855_100014913 3300005563 Bacteria 9362
33 Ga0068854_100044399 3300005578 Unclassified 3154
34 Ga0068856_100006499 3300005614 Bacteria 11464
35 Ga0068856_100077838 3300005614 Bacteria 3287
36 Ga0068852_100094470 3300005616 Unclassified 2682
37 Ga0068859_100030593 3300005617 Bacteria 5402
38 Ga0068864_100113892 3300005618 Bacteria 2411
39 Ga0068863_100000134 3300005841 Bacteria 78372
40 Ga0068863_100000954 3300005841 Bacteria 28992
41 Ga0068858_100000113 3300005842 Bacteria 84912
42 Ga0068858_100003189 3300005842 Bacteria 16383
43 Ga0068858_100142691 3300005842 Unclassified 2249
44 Ga0068860_100000405 3300005843 Bacteria 56140
45 Ga0068860_100000635 3300005843 Bacteria 41333
46 Ga0068860_100073887 3300005843 Bacteria 3241
47 Ga0068862_100017971 3300005844 Bacteria 5890
48 Ga0068862_100052323 3300005844 Unclassified 3494
49 Ga0081455_10000289 3300005937 Bacteria 66552
50 Ga0081539_10000016 3300005985 Bacteria 381648
51 Ga0068871_100007848 3300006358 Bacteria 7648
52 Ga0097620_100030593 3300006931 Bacteria 5402
53 Ga0105240_10010607 3300009093 Bacteria 12947
54 Ga0105240_10012163 3300009093 Bacteria 11915
55 Ga0105240_10034621 3300009093 Bacteria 6513
56 Ga0105240_10038843 3300009093 Bacteria 6103
57 Ga0105240_10057109 3300009093 Bacteria 4879
58 Ga0105240_10086929 3300009093 Bacteria 3829
59 Ga0105240_10090772 3300009093 Bacteria 3733
60 Ga0111539_10014515 3300009094 Bacteria 9836
61 Ga0105248_10092983 3300009177 Bacteria 3396
62 Ga0105237_10078604 3300009545 Bacteria 3289
63 Ga0105238_10042978 3300009551 Bacteria 4573
64 Ga0105238_10117010 3300009551 Unclassified 2646
65 Ga0105249_10078362 3300009553 Bacteria 3066
66 Ga0105249_10094249 3300009553 Bacteria 2806
67 Ga0105239_10060639 3300010375 Bacteria 4152
68 Ga0105239_10131703 3300010375 Bacteria 2782
69 Ga0157370_10018139 3300013104 Bacteria 7084
70 Ga0157369_10005257 3300013105 Bacteria 15095
71 Ga0157369_10145096 3300013105 Unclassified 2510
72 Ga0163162_10168304 3300013306 Bacteria 2315
73 Ga0157372_10017829 3300013307 Bacteria 7624
74 Ga0157372_10259482 3300013307 Unclassified 2018
75 Ga0163163_10070943 3300014325 Bacteria 3470
76 Ga0157380_10015926 3300014326 Bacteria 5533
77 Ga0157379_10082812 3300014968 Unclassified 2875
78 Ga0207680_10005586 3300025903 Bacteria 6016
79 Ga0207654_10034765 3300025911 Unclassified 2802
80 Ga0207707_10000130 3300025912 Bacteria 77776
81 Ga0207695_10006882 3300025913 Bacteria 14633
82 Ga0207695_10022344 3300025913 Bacteria 7183
83 Ga0207695_10148662 3300025913 Bacteria 2284
84 Ga0207671_10033116 3300025914 Bacteria 3846
85 Ga0207671_10077140 3300025914 Bacteria 2494
86 Ga0207694_10000576 3300025924 Bacteria 33196
87 Ga0207694_10019231 3300025924 Bacteria 5163
88 Ga0207694_10024634 3300025924 Bacteria 4570
89 Ga0207694_10091405 3300025924 Bacteria 2402
90 Ga0207659_10013329 3300025926 Bacteria 5261
91 Ga0207700_10096635 3300025928 Unclassified 2346
92 Ga0207644_10009476 3300025931 Bacteria 6396
93 Ga0207669_10126749 3300025937 Bacteria 1745
94 Ga0207691_10003322 3300025940 Bacteria 15662
95 Ga0207691_10005210 3300025940 Bacteria 12554
96 Ga0207691_10118731 3300025940 Bacteria 2346
97 Ga0207689_10017026 3300025942 Bacteria 6150
98 Ga0207661_10116066 3300025944 Bacteria 2272
99 Ga0207667_10002287 3300025949 Bacteria 24077
100 Ga0207667_10006605 3300025949 Bacteria 14022
101 Ga0207667_10018485 3300025949 Bacteria 7815
102 Ga0207712_10060648 3300025961 Bacteria 2682
103 Ga0207668_10034953 3300025972 Bacteria 3342
104 Ga0207658_10081295 3300025986 Bacteria 2484
105 Ga0207639_10113260 3300026041 Bacteria 2215
106 Ga0207678_10068421 3300026067 Unclassified 3047
107 Ga0207708_10035003 3300026075 Bacteria 3821
108 Ga0207708_10047500 3300026075 Bacteria 3267
109 Ga0207702_10080239 3300026078 Bacteria 2830
110 Ga0207702_10163295 3300026078 Bacteria 2036
111 Ga0207641_10000076 3300026088 Bacteria 145031
112 Ga0207641_10000201 3300026088 Bacteria 80061
113 Ga0207676_10068436 3300026095 Bacteria 2840
114 Ga0207675_100009880 3300026118 Bacteria 8927
115 Ga0207683_10005552 3300026121 Bacteria 10803
116 Ga0207683_10021315 3300026121 Bacteria 5546
117 Ga0268266_10000191 3300028379 Bacteria 107606
118 Ga0268266_10004002 3300028379 Bacteria 14258
119 Ga0268266_10012358 3300028379 Bacteria 7384
120 Ga0268266_10052789 3300028379 Bacteria 3491
121 Ga0268265_10080989 3300028380 Bacteria 2562
122 Ga0268264_10000183 3300028381 Bacteria 133803
123 Ga0268264_10000334 3300028381 Bacteria 72930
124 Ga0307515_10017594 3300028794 Bacteria 13002
125 Ga0307515_10163944 3300028794 Bacteria 2251
126 Ga0265338_10041318 3300028800 Bacteria 4314
127 Ga0307511_10004268 3300030521 Bacteria 14595
128 Ga0307511_10006624 3300030521 Bacteria 11674
129 Ga0265331_10014057 3300031250 Bacteria 4277
130 Ga0307513_10004214 3300031456 Bacteria 19230
131 Ga0307513_10005881 3300031456 Bacteria 16106
132 Ga0307513_10027478 3300031456 Bacteria 6533
133 Ga0307513_10030144 3300031456 Bacteria 6167
134 Ga0307513_10032907 3300031456 Bacteria 5838
135 Ga0307509_10000025 3300031507 Bacteria 235550
136 Ga0307509_10006926 3300031507 Bacteria 15040
137 Ga0307509_10047019 3300031507 Bacteria 4643
138 Ga0307408_100052760 3300031548 Bacteria 2934
139 Ga0307413_10069815 3300031824 Bacteria 2206
140 Ga0307410_10008978 3300031852 Bacteria 5577
141 Ga0307406_10021699 3300031901 Bacteria 3802
142 Ga0307407_10076360 3300031903 Bacteria 2011
143 Ga0307409_100004649 3300031995 Bacteria 7757
144 Ga0307409_100062594 3300031995 Bacteria 2914
145 Ga0307416_100043300 3300032002 Bacteria 3524
146 Ga0307416_100163865 3300032002 Bacteria 2059
147 Ga0307411_10103429 3300032005 Bacteria 2020
148 Ga0307510_10000002 3300033180 Bacteria 801565
149 Ga0307510_10027830 3300033180 Bacteria 6467
150 Ga0373936_0002033 3300035113 Bacteria 7487
151 Ga0316574_0027073 3300035398 Bacteria 3452
152 Ga0395898_0041612 3300037466 Bacteria 4538
153 Ga0436365_1798471 3300039437 Bacteria 5716
154 Ga0436361_1197009 3300039447 Bacteria 6088
155 Ga0451791_0055130 3300041451 Bacteria 4272
156 Ga0451800_0668162 3300041459 Bacteria 1974
157 Ga0451807_1491438 3300041486 Bacteria 5081
158 Ga0451577_0119665 3300042876 Bacteria 2358
159 Ga0466969_0002572 3300044656 Bacteria 9699
160 Ga0466966_0029918 3300044684 Bacteria 3540
161 Ga0466966_0072119 3300044684 Bacteria 2163
162 Ga0466966_0092285 3300044684 Bacteria 1879
163 Ga0466971_0011329 3300044719 Bacteria 3904
164 Ga0466957_0002146 3300044842 Bacteria 10557
165 Ga0466959_0000434 3300045049 Bacteria 24359
166 Ga0466959_0011155 3300045049 Bacteria 6449
167 Ga0495638_0000932 3300046460 Bacteria 29683
168 Ga0495638_0016744 3300046460 Bacteria 4901
169 Ga0495638_0028822 3300046460 Bacteria 3583
170 Ga0495616_0000669 3300046513 Bacteria 25410
171 Ga0495643_0033741 3300046522 Bacteria 2829
172 Ga0495656_0014411 3300046615 Bacteria 2964
173 Ga0495625_0012810 3300046660 Bacteria 6780
174 Ga0495625_0014050 3300046660 Bacteria 6410
175 Ga0495649_0002216 3300046694 Bacteria 13861
176 Ga0495672_0035866 3300047320 Bacteria 3051
177 Ga0496117_0000054 3300048920 Bacteria 278013
178 Ga0496118_0000045 3300048921 Bacteria 275165
179 Ga0496119_0002807 3300048922 Bacteria 18645
180 Ga0496120_0000379 3300048923 Bacteria 71960
181 Ga0496121_0015196 3300048924 Bacteria 8093
182 Ga0496125_0000391 3300048928 Bacteria 81560
183 Ga0496126_0012836 3300048929 Bacteria 8561
184 Ga0496126_0012926 3300048929 Bacteria 8523
185 Ga0501033_0006151 3300049570 Bacteria 9414
186 Ga0501036_0003102 3300049572 Bacteria 13257
187 Ga0501037_0032610 3300049573 Bacteria 3847
188 Ga0501039_0019310 3300049575 Bacteria 5225
189 Ga0501040_0004304 3300049576 Bacteria 9248
190 Ga0501042_0011497 3300049578 Bacteria 5976
191 Ga0501042_0094028 3300049578 Bacteria 2153
192 Ga0501046_0013962 3300049580 Bacteria 6785
193 Ga0501048_0004609 3300049582 Bacteria 10488
194 Ga0501068_0000141 3300049584 Bacteria 33019
195 Ga0501071_0039333 3300049587 Bacteria 3383
196 Ga0501074_0000994 3300049590 Bacteria 18432
197 Ga0501075_0002629 3300049591 Bacteria 11997
198 Ga0501077_0001172 3300049593 Bacteria 15853
199 Ga0501077_0028530 3300049593 Bacteria 3547
200 Ga0501079_0000033 3300049741 Bacteria 59060
201 Ga0501079_0097866 3300049741 Bacteria 2274
202 Ga0501080_0001783 3300049742 Bacteria 18446
203 Ga0501080_0002940 3300049742 Bacteria 14974
204 Ga0501080_0133800 3300049742 Bacteria 2295
205 Ga0501083_0030478 3300049744 Bacteria 3706
206 nmdc:mga08y16_17832_c1 3300050511 Bacteria 7477
207 Ga0500583_0010038 3300053092 Bacteria 3492
208 Ga0500583_0013340 3300053092 Bacteria 3175
209 Ga0500641_0016042 3300053096 Bacteria 2786
210 Ga0500658_0008799 3300053134 Bacteria 3726
211 Ga0500588_0002347 3300053146 Bacteria 3831
212 Ga0500616_0000018 3300053153 Bacteria 610976
213 Ga0500637_0076871 3300053178 Unclassified 1925
214 Ga0501084_0003544 3300054114 Bacteria 12673
215 Ga0501082_0000761 3300060353 Bacteria 28260
216 Ga0530510_0000239 3300061734 Bacteria 34451
217 Ga0496119_0005260
218 JGI25406J46586_10008598
219 rootL2_10131677
220 Ga0070683_100035411
221 Ga0070690_100035092
222 Ga0070677_10001814
223 Ga0070666_10045872
224 Ga0070682_100033409
225 Ga0070682_100079719
226 Ga0070675_100044751
227 Ga0070667_100002510
228 Ga0070667_100005695
229 Ga0070713_100130491
230 Ga0070678_100019646
231 Ga0070681_10011807
232 Ga0070681_10049800
233 Ga0070681_10050339
234 Ga0070681_10122136
235 Ga0068867_100141705
236 Ga0070679_100008335
237 Ga0068853_100154762
238 Ga0070672_100024711
239 Ga0070672_100113157
240 Ga0070686_100009103
241 Ga0070665_100003982
242 Ga0070665_100009848
243 Ga0070665_100020957
244 Ga0070665_100023264
245 Ga0070665_100041998
246 Ga0068855_100005663
247 Ga0068855_100006200
248 Ga0068855_100014913
249 Ga0068854_100044399
250 Ga0068856_100006499
251 Ga0068856_100077838
252 Ga0068852_100094470
253 Ga0068859_100030593
254 Ga0068864_100113892
255 Ga0068863_100000134
256 Ga0068863_100000954
257 Ga0068858_100000113
258 Ga0068858_100003189
259 Ga0068858_100142691
260 Ga0068860_100000405
261 Ga0068860_100000635
262 Ga0068860_100073887
263 Ga0068862_100017971
264 Ga0068862_100052323
265 Ga0081455_10000289
266 Ga0081539_10000016
267 Ga0068871_100007848
268 Ga0097620_100030593
269 Ga0105240_10010607
270 Ga0105240_10012163
271 Ga0105240_10034621
272 Ga0105240_10038843
273 Ga0105240_10057109
274 Ga0105240_10086929
275 Ga0105240_10090772
276 Ga0111539_10014515
277 Ga0105248_10092983
278 Ga0105237_10078604
279 Ga0105238_10042978
280 Ga0105238_10117010
281 Ga0105249_10078362
282 Ga0105249_10094249
283 Ga0105239_10060639
284 Ga0105239_10131703
285 Ga0157370_10018139
286 Ga0157369_10005257
287 Ga0157369_10145096
288 Ga0163162_10168304
289 Ga0157372_10017829
290 Ga0157372_10259482
291 Ga0163163_10070943
292 Ga0157380_10015926
293 Ga0157379_10082812
294 Ga0207680_10005586
295 Ga0207654_10034765
296 Ga0207707_10000130
297 Ga0207695_10006882
298 Ga0207695_10022344
299 Ga0207695_10148662
300 Ga0207671_10033116
301 Ga0207671_10077140
302 Ga0207694_10000576
303 Ga0207694_10019231
304 Ga0207694_10024634
305 Ga0207694_10091405
306 Ga0207659_10013329
307 Ga0207700_10096635
308 Ga0207644_10009476
309 Ga0207669_10126749
310 Ga0207691_10003322
311 Ga0207691_10005210
312 Ga0207691_10118731
313 Ga0207689_10017026
314 Ga0207661_10116066
315 Ga0207667_10002287
316 Ga0207667_10006605
317 Ga0207667_10018485
318 Ga0207712_10060648
319 Ga0207668_10034953
320 Ga0207658_10081295
321 Ga0207639_10113260
322 Ga0207678_10068421
323 Ga0207708_10035003
324 Ga0207708_10047500
325 Ga0207702_10080239
326 Ga0207702_10163295
327 Ga0207641_10000076
328 Ga0207641_10000201
329 Ga0207676_10068436
330 Ga0207675_100009880
331 Ga0207683_10005552
332 Ga0207683_10021315
333 Ga0268266_10000191
334 Ga0268266_10004002
335 Ga0268266_10012358
336 Ga0268266_10052789
337 Ga0268265_10080989
338 Ga0268264_10000183
339 Ga0268264_10000334
340 Ga0307515_10017594
341 Ga0307515_10163944
342 Ga0265338_10041318
343 Ga0307511_10004268
344 Ga0307511_10006624
345 Ga0265331_10014057
346 Ga0307513_10004214
347 Ga0307513_10005881
348 Ga0307513_10027478
349 Ga0307513_10030144
350 Ga0307513_10032907
351 Ga0307509_10000025
352 Ga0307509_10006926
353 Ga0307509_10047019
354 Ga0307408_100052760
355 Ga0307413_10069815
356 Ga0307410_10008978
357 Ga0307406_10021699
358 Ga0307407_10076360
359 Ga0307409_100004649
360 Ga0307409_100062594
361 Ga0307416_100043300
362 Ga0307416_100163865
363 Ga0307411_10103429
364 Ga0307510_10000002
365 Ga0307510_10027830
366 Ga0373936_0002033
367 Ga0316574_0027073
368 Ga0395898_0041612
369 Ga0436365_1798471
370 Ga0436361_1197009
371 Ga0451791_0055130
372 Ga0451800_0668162
373 Ga0451807_1491438
374 Ga0451577_0119665
375 Ga0466969_0002572
376 Ga0466966_0029918
377 Ga0466966_0072119
378 Ga0466966_0092285
379 Ga0466971_0011329
380 Ga0466957_0002146
381 Ga0466959_0000434
382 Ga0466959_0011155
383 Ga0495638_0000932
384 Ga0495638_0016744
385 Ga0495638_0028822
386 Ga0495616_0000669
387 Ga0495643_0033741
388 Ga0495656_0014411
389 Ga0495625_0012810
390 Ga0495625_0014050
391 Ga0495649_0002216
392 Ga0495672_0035866
393 Ga0496117_0000054
394 Ga0496118_0000045
395 Ga0496119_0002807
396 Ga0496120_0000379
397 Ga0496121_0015196
398 Ga0496125_0000391
399 Ga0496126_0012836
400 Ga0496126_0012926
401 Ga0501033_0006151
402 Ga0501036_0003102
403 Ga0501037_0032610
404 Ga0501039_0019310
405 Ga0501040_0004304
406 Ga0501042_0011497
407 Ga0501042_0094028
408 Ga0501046_0013962
409 Ga0501048_0004609
410 Ga0501068_0000141
411 Ga0501071_0039333
412 Ga0501074_0000994
413 Ga0501075_0002629
414 Ga0501077_0001172
415 Ga0501077_0028530
416 Ga0501079_0000033
417 Ga0501079_0097866
418 Ga0501080_0001783
419 Ga0501080_0002940
420 Ga0501080_0133800
421 Ga0501083_0030478
422 nmdc:mga08y16_17832_c1
423 Ga0500583_0010038
424 Ga0500583_0013340
425 Ga0500641_0016042
426 Ga0500658_0008799
427 Ga0500588_0002347
428 Ga0500616_0000018
429 Ga0500637_0076871
430 Ga0501084_0003544
431 Ga0501082_0000761
432 Ga0530510_0000239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

239

473

0.98

PF02391

MoaE

MoaE protein

6

118

0.97

PF00581

Rhodanese

Rhodanese-like domain

488

580

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9721 4 130
8hlg-assembly1.cif.gz_B crystal structure of moae 0.9461 3 138
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.944 3 125
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.943 3 125
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9405 3 125
ID Description Score Start End Superfamily
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9734 4 138 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9716 4 130 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9618 3 144 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9612 4 136 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9405 3 125 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A3D3YVJ3-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9855 184 312 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A182EBN6-F1-model_v4 Molybdopterin synthase catalytic subunit 0.9783 4 138 GO:0006777
AF-A0A0C2CZ29-F1-model_v4 Molybdopterin converting factor, subunit 2 0.9777 4 125 GO:0006777
AF-A0A6B3P3T3-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9747 4 139 GO:0006777
AF-A0A814BJB3-F1-model_v4 N-alpha-acetyltransferase 60 (EC 2.3.1.259) (EC 2.3.1.48) 0.9716 12 139 GO:0000139
GO:0004402
GO:0004596
GO:0006777
GO:0007059

Map