F327675

General Info

Members Datasets Scaffolds Average Seq Length
216 169 214 210

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10075409|Ga0207665_100754092
Length 204
Sequence VSDRLATSLAGIIVLALILSGLAPFDRTTWWLEVAPVLIALPALIATRRRFPLTPLLYWVIFVHAGVLIAGGAYSYARVPLGFWLQDALALSRNPYDKIGHFMQGLTPALLTCEVLLRGGYMRLSKARRMTVFLAICVAMAISACYELIEWGAAVALGQGADEFLGTQGDPWDTQSDMLMAFLGASFAMLCLRAWHTRQMQRLG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 6.02
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10378803 3300003323 Bacteria 2050
2 Ga0070658_10005844 3300005327 Bacteria 9975
3 Ga0070690_100131590 3300005330 Bacteria 1690
4 Ga0068869_100058828 3300005334 Bacteria 2812
5 Ga0070680_100414778 3300005336 Bacteria 1148
6 Ga0070682_100012272 3300005337 Bacteria 4907
7 Ga0070692_10391413 3300005345 Bacteria 875
8 Ga0070705_100256182 3300005440 Bacteria 1231
9 Ga0070705_100273851 3300005440 Bacteria 1197
10 Ga0070694_100004187 3300005444 Bacteria 8668
11 Ga0068867_100144952 3300005459 Bacteria 1860
12 Ga0070707_100146679 3300005468 Bacteria 2297
13 Ga0070679_100174398 3300005530 Bacteria 2122
14 Ga0070679_100234815 3300005530 Bacteria 1793
15 Ga0070686_100935868 3300005544 Bacteria 707
16 Ga0070695_100400683 3300005545 Bacteria 1040
17 Ga0070693_100053277 3300005547 Bacteria 2322
18 Ga0070665_100024345 3300005548 Bacteria 6096
19 Ga0070704_100006630 3300005549 Bacteria 6835
20 Ga0068855_100433328 3300005563 Bacteria 1437
21 Ga0068857_100075577 3300005577 Bacteria 3003
22 Ga0068854_100559561 3300005578 Bacteria 971
23 Ga0068852_100227331 3300005616 Bacteria 1777
24 Ga0068859_100134179 3300005617 Bacteria 2547
25 Ga0068858_100371766 3300005842 Unclassified 1371
26 Ga0068862_100143830 3300005844 Bacteria 2118
27 Ga0075363_100263184 3300006048 Bacteria 995
28 Ga0070716_100035039 3300006173 Bacteria 2757
29 Ga0075369_10090058 3300006186 Bacteria 1368
30 Ga0075366_10004459 3300006195 Bacteria 7514
31 Ga0075428_100000165 3300006844 Bacteria 60894
32 Ga0075428_100077241 3300006844 Bacteria 3635
33 Ga0075431_100075600 3300006847 Bacteria 3476
34 Ga0075433_10097705 3300006852 Unclassified 2599
35 Ga0075434_100068547 3300006871 Bacteria 3534
36 Ga0075434_100853857 3300006871 Bacteria 926
37 Ga0075434_101015610 3300006871 Bacteria 843
38 Ga0075429_100003351 3300006880 Bacteria 13655
39 Ga0075429_100029269 3300006880 Bacteria 4784
40 Ga0075429_100071924 3300006880 Bacteria 3012
41 Ga0097620_100134176 3300006931 Bacteria 2547
42 Ga0075435_100098074 3300007076 Bacteria 2426
43 Ga0105240_10498357 3300009093 Bacteria 1355
44 Ga0111539_10016495 3300009094 Bacteria 9158
45 Ga0111539_10225457 3300009094 Bacteria 2183
46 Ga0105245_10272098 3300009098 Bacteria 1652
47 Ga0114129_10000190 3300009147 Bacteria 69084
48 Ga0105243_10065120 3300009148 Bacteria 2927
49 Ga0105242_10026123 3300009176 Bacteria 4627
50 Ga0105248_10024596 3300009177 Bacteria 6696
51 Ga0105248_10632983 3300009177 Bacteria 1207
52 Ga0105238_10119084 3300009551 Bacteria 2621
53 Ga0105249_10619636 3300009553 Bacteria 1138
54 Ga0163162_10041340 3300013306 Bacteria 4613
55 Ga0163162_10125133 3300013306 Unclassified 2676
56 Ga0157372_10230737 3300013307 Bacteria 2146
57 Ga0157375_10017501 3300013308 Bacteria 6469
58 Ga0157377_10013469 3300014745 Bacteria 4139
59 Ga0157379_10099310 3300014968 Bacteria 2613
60 Ga0163161_10030165 3300017792 Bacteria 3857
61 Ga0207680_10139724 3300025903 Bacteria 1605
62 Ga0207705_10025973 3300025909 Bacteria 4179
63 Ga0207695_10475412 3300025913 Bacteria 1132
64 Ga0207662_10233295 3300025918 Bacteria 1203
65 Ga0207652_10225436 3300025921 Bacteria 1689
66 Ga0207652_10569540 3300025921 Bacteria 1017
67 Ga0207646_10331997 3300025922 Bacteria 1374
68 Ga0207694_10448982 3300025924 Bacteria 1076
69 Ga0207686_10049677 3300025934 Bacteria 2604
70 Ga0207665_10075409 3300025939 Bacteria 2310
71 Ga0207691_10016066 3300025940 Bacteria 7111
72 Ga0207711_10001893 3300025941 Bacteria 19060
73 Ga0207679_10181502 3300025945 Bacteria 1742
74 Ga0207712_10053327 3300025961 Bacteria 2836
75 Ga0207658_10051744 3300025986 Unclassified 3028
76 Ga0207703_10092822 3300026035 Unclassified 2542
77 Ga0207708_10744434 3300026075 Bacteria 841
78 Ga0207674_10051641 3300026116 Bacteria 4195
79 Ga0209970_1025092 3300027614 Bacteria 1021
80 Ga0207428_10000488 3300027907 Bacteria 47436
81 Ga0207428_10033134 3300027907 Bacteria 4245
82 Ga0207428_10052552 3300027907 Bacteria 3253
83 Ga0207428_10138335 3300027907 Bacteria 1861
84 Ga0268266_10039332 3300028379 Bacteria 4028
85 Ga0268265_10162719 3300028380 Bacteria 1898
86 Ga0265318_10008402 3300028577 Bacteria 4600
87 Ga0265323_10106712 3300028653 Bacteria 921
88 Ga0265330_10021196 3300031235 Bacteria 2968
89 Ga0265332_10005981 3300031238 Bacteria 5563
90 Ga0265320_10064722 3300031240 Bacteria 1736
91 Ga0265331_10056792 3300031250 Bacteria 1857
92 Ga0265327_10043245 3300031251 Bacteria 2412
93 Ga0265316_10295774 3300031344 Bacteria 1180
94 Ga0307509_10398892 3300031507 Bacteria 1083
95 Ga0316575_10000017 3300031665 Bacteria 43424
96 Ga0265314_10001661 3300031711 Bacteria 24263
97 Ga0307518_10005535 3300031838 Bacteria 9042
98 Ga0307411_10375322 3300032005 Bacteria 1168
99 Ga0307507_10071762 3300033179 Bacteria 3127
100 Ga0307507_10076614 3300033179 Bacteria 2981
101 Ga0373953_0046738 3300035117 Bacteria 1739
102 Ga0373931_0045370 3300035691 Bacteria 2321
103 Ga0373931_0196842 3300035691 Bacteria 1202
104 Ga0373937_0120654 3300036401 Bacteria 2443
105 Ga0439446_0067389 3300042156 Bacteria 1090
106 Ga0451577_0000058 3300042876 Bacteria 272673
107 Ga0451577_0029743 3300042876 Bacteria 4937
108 Ga0451577_0031868 3300042876 Bacteria 4754
109 Ga0453683_0511241 3300044673 Bacteria 780
110 Ga0453684_0000279 3300044712 Bacteria 220016
111 Ga0453684_0001472 3300044712 Bacteria 66447
112 Ga0453684_0119214 3300044712 Bacteria 3190
113 Ga0453684_0375219 3300044712 Bacteria 1598
114 Ga0453684_0617869 3300044712 Unclassified 1186
115 Ga0466971_0230774 3300044719 Bacteria 879
116 Ga0451576_0000355 3300045051 Bacteria 110049
117 Ga0451576_0000659 3300045051 Bacteria 71101
118 Ga0451576_0000926 3300045051 Bacteria 55382
119 Ga0451576_0001254 3300045051 Bacteria 44591
120 Ga0451576_0008082 3300045051 Bacteria 12404
121 Ga0451576_0045611 3300045051 Bacteria 4615
122 Ga0451576_0263030 3300045051 Bacteria 1803
123 Ga0451576_0365438 3300045051 Bacteria 1511
124 Ga0451576_0949021 3300045051 Bacteria 902
125 Ga0466967_0048675 3300045976 Bacteria 3703
126 Ga0495592_0065677 3300046454 Bacteria 2655
127 Ga0495662_0016600 3300046476 Bacteria 3567
128 Ga0495585_0203569 3300046492 Bacteria 1006
129 Ga0495596_0016413 3300046500 Bacteria 3076
130 Ga0495583_0000190 3300046506 Bacteria 103427
131 Ga0495608_0032248 3300046511 Bacteria 3541
132 Ga0495616_0109637 3300046513 Bacteria 1283
133 Ga0495618_0020180 3300046514 Bacteria 4103
134 Ga0495628_0037186 3300046516 Bacteria 3903
135 Ga0495630_0017701 3300046517 Bacteria 5224
136 Ga0495632_0002487 3300046519 Bacteria 13987
137 Ga0495644_0009305 3300046523 Bacteria 3787
138 Ga0495666_0021985 3300046526 Bacteria 3158
139 Ga0495640_0037984 3300046533 Bacteria 3391
140 Ga0495586_0005215 3300046535 Bacteria 6956
141 Ga0495586_0007623 3300046535 Bacteria 5776
142 Ga0495587_0020200 3300046536 Bacteria 4114
143 Ga0495609_0084499 3300046538 Bacteria 1385
144 Ga0495597_0070555 3300046542 Bacteria 1506
145 Ga0495634_0018833 3300046642 Bacteria 4909
146 Ga0495611_0001705 3300046648 Bacteria 10674
147 Ga0495661_0063151 3300046665 Bacteria 2190
148 Ga0495588_0124683 3300046674 Bacteria 1358
149 Ga0495599_0008522 3300046678 Bacteria 6239
150 Ga0495613_0016852 3300046689 Bacteria 5440
151 Ga0495624_0011950 3300046690 Bacteria 5951
152 Ga0495670_0090988 3300046691 Bacteria 1562
153 Ga0495589_0011168 3300046794 Bacteria 4659
154 Ga0495589_0065141 3300046794 Bacteria 1786
155 Ga0495604_0005408 3300047317 Bacteria 10131
156 Ga0495674_0045654 3300047319 Bacteria 3890
157 Ga0495674_0397384 3300047319 Bacteria 1113
158 Ga0495680_0033149 3300047322 Bacteria 4184
159 Ga0495683_0006159 3300047323 Bacteria 6575
160 Ga0495683_0059830 3300047323 Bacteria 1889
161 Ga0495681_0005182 3300047470 Bacteria 8769
162 Ga0495593_0070793 3300047673 Bacteria 1812
163 Ga0496101_0000605 3300048904 Bacteria 21913
164 Ga0496102_0001284 3300048905 Bacteria 22639
165 Ga0496104_0015301 3300048907 Bacteria 6946
166 Ga0496105_0001394 3300048908 Bacteria 16972
167 Ga0496105_0707250 3300048908 Bacteria 773
168 Ga0496107_0068874 3300048910 Bacteria 2568
169 Ga0496108_0246364 3300048911 Bacteria 1554
170 Ga0496108_0405372 3300048911 Unclassified 1191
171 Ga0496109_0269326 3300048912 Unclassified 1605
172 Ga0496109_0630347 3300048912 Bacteria 1009
173 Ga0496110_0003282 3300048913 Bacteria 12342
174 Ga0496111_0135052 3300048914 Bacteria 1827
175 Ga0496114_0143128 3300048917 Bacteria 2071
176 Ga0496125_0000487 3300048928 Bacteria 69494
177 Ga0496126_0396679 3300048929 Bacteria 1120
178 Ga0495678_011090 3300049459 Bacteria 4331
179 Ga0501040_0346945 3300049576 Bacteria 1063
180 Ga0501041_0430041 3300049577 Bacteria 837
181 Ga0501069_0015564 3300049585 Bacteria 4079
182 Ga0501069_0049069 3300049585 Bacteria 2346
183 Ga0501070_0005410 3300049586 Bacteria 10895
184 Ga0501073_0001548 3300049589 Bacteria 17041
185 Ga0501073_0009089 3300049589 Bacteria 7334
186 Ga0501074_0001537 3300049590 Bacteria 15604
187 Ga0501075_0049134 3300049591 Bacteria 3171
188 Ga0501079_0001387 3300049741 Bacteria 17071
189 Ga0501080_0053929 3300049742 Bacteria 3744
190 Ga0501083_0013218 3300049744 Bacteria 5770
191 Ga0501044_0403031 3300049823 Bacteria 1280
192 nmdc:mga0k408_1404_c1 3300050493 Bacteria 13028
193 nmdc:mga05p37_456_c1 3300050507 Bacteria 44536
194 nmdc:mga09592_17521_c1 3300050508 Bacteria 5869
195 nmdc:mga09592_255722_c1 3300050508 Bacteria 1518
196 nmdc:mga09592_281201_c1 3300050508 Bacteria 1443
197 nmdc:mga09592_9394_c1 3300050508 Bacteria 7951
198 nmdc:mga0qj67_212695_c1 3300050509 Bacteria 1570
199 nmdc:mga0qj67_940795_c1 3300050509 Bacteria 680
200 nmdc:mga06r32_512075_c1 3300050510 Bacteria 1176
201 nmdc:mga08y16_215990_c1 3300050511 Bacteria 1986
202 nmdc:mga08y16_4744_c1 3300050511 Bacteria 14171
203 nmdc:mga0n895_29473_c1 3300050512 Bacteria 5236
204 nmdc:mga0n895_447677_c1 3300050512 Bacteria 1304
205 nmdc:mga0n895_673898_c1 3300050512 Bacteria 1031
206 nmdc:mga0rr50_118220_c1 3300050513 Bacteria 2106
207 nmdc:mga0rr50_84223_c1 3300050513 Bacteria 2461
208 nmdc:mga0a205_405276_c1 3300050515 Bacteria 1227
209 Ga0495619_0688804 3300053085 Bacteria 695
210 Ga0500646_0005310 3300053090 Bacteria 3257
211 Ga0500655_004068 3300053133 Bacteria 2633
212 Ga0500604_0003018 3300053151 Bacteria 4517
213 Ga0500637_0086497 3300053178 Bacteria 1813
214 Ga0500645_009996 3300053730 Bacteria 3160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10017501 Ga0157375_100175019 178
2 3300048912 Ga0496109_0269326 Ga0496109_0269326_970_1554 178
3 3300005345 Ga0070692_10391413 Ga0070692_103914131 186
4 3300045051 Ga0451576_0001254 Ga0451576_0001254_16644_17258 190
5 3300031235 Ga0265330_10021196 Ga0265330_100211963 193
6 3300031240 Ga0265320_10064722 Ga0265320_100647222 193
7 3300027614 Ga0209970_1025092 Ga0209970_10250922 194
8 3300045051 Ga0451576_0008082 Ga0451576_0008082_9183_9797 194
9 3300005548 Ga0070665_100024345 Ga0070665_1000243454 195
10 3300028379 Ga0268266_10039332 Ga0268266_100393323 195
11 3300032005 Ga0307411_10375322 Ga0307411_103753222 196
12 3300042876 Ga0451577_0000058 Ga0451577_0000058_114615_115235 198
13 3300044712 Ga0453684_0000279 Ga0453684_0000279_211275_211895 198
14 3300045051 Ga0451576_0045611 Ga0451576_0045611_84_680 198
15 3300006173 Ga0070716_100035039 Ga0070716_1000350392 199
16 3300006195 Ga0075366_10004459 Ga0075366_100044597 199
17 3300025939 Ga0207665_10075409 Ga0207665_100754092 199
18 3300049576 Ga0501040_0346945 Ga0501040_0346945_12_611 199
19 3300049577 Ga0501041_0430041 Ga0501041_0430041_25_624 199
20 3300049589 Ga0501073_0009089 Ga0501073_0009089_3510_4124 199
21 3300049591 Ga0501075_0049134 Ga0501075_0049134_2028_2627 199
22 3300050493 nmdc:mga0k408_1404_c1 nmdc:mga0k408_1404_c1_7855_8460 199
23 iso_pu_bacteria 2711768156 2712470865 199
24 3300005563 Ga0068855_100433328 Ga0068855_1004333282 200
25 3300028653 Ga0265323_10106712 Ga0265323_101067122 200
26 3300005327 Ga0070658_10005844 Ga0070658_1000584410 201
27 3300005334 Ga0068869_100058828 Ga0068869_1000588284 201
28 3300009098 Ga0105245_10272098 Ga0105245_102720982 201
29 3300013307 Ga0157372_10230737 Ga0157372_102307375 201
30 3300014745 Ga0157377_10013469 Ga0157377_100134693 201
31 3300025909 Ga0207705_10025973 Ga0207705_100259734 201
32 3300025945 Ga0207679_10181502 Ga0207679_101815022 201
33 3300033179 Ga0307507_10076614 Ga0307507_100766144 201
34 3300044712 Ga0453684_0375219 Ga0453684_0375219_73_702 201
35 3300005440 Ga0070705_100256182 Ga0070705_1002561822 202
36 3300005459 Ga0068867_100144952 Ga0068867_1001449521 202
37 3300005577 Ga0068857_100075577 Ga0068857_1000755773 202
38 3300005617 Ga0068859_100134179 Ga0068859_1001341793 202
39 3300006931 Ga0097620_100134176 Ga0097620_1001341763 202
40 3300009094 Ga0111539_10225457 Ga0111539_102254572 202
41 3300026116 Ga0207674_10051641 Ga0207674_100516415 202
42 3300027907 Ga0207428_10138335 Ga0207428_101383353 202
43 3300028577 Ga0265318_10008402 Ga0265318_100084023 202
44 3300031238 Ga0265332_10005981 Ga0265332_100059814 202
45 3300031250 Ga0265331_10056792 Ga0265331_100567922 202
46 3300031344 Ga0265316_10295774 Ga0265316_102957742 202
47 3300031711 Ga0265314_10001661 Ga0265314_1000166118 202
48 3300045051 Ga0451576_0949021 Ga0451576_0949021_169_783 202
49 3300050511 nmdc:mga08y16_215990_c1 nmdc:mga08y16_215990_c1_1193_1801 202
50 3300053085 Ga0495619_0688804 Ga0495619_0688804_44_661 202
51 3300005336 Ga0070680_100414778 Ga0070680_1004147781 203
52 3300005440 Ga0070705_100273851 Ga0070705_1002738512 203
53 3300005444 Ga0070694_100004187 Ga0070694_1000041878 203
54 3300005468 Ga0070707_100146679 Ga0070707_1001466792 203
55 3300005530 Ga0070679_100234815 Ga0070679_1002348152 203
56 3300005545 Ga0070695_100400683 Ga0070695_1004006832 203
57 3300005547 Ga0070693_100053277 Ga0070693_1000532772 203
58 3300005549 Ga0070704_100006630 Ga0070704_1000066308 203
59 3300006871 Ga0075434_100068547 Ga0075434_1000685473 203
60 3300006871 Ga0075434_101015610 Ga0075434_1010156102 203
61 3300006880 Ga0075429_100029269 Ga0075429_1000292693 203
62 3300009093 Ga0105240_10498357 Ga0105240_104983572 203
63 3300025913 Ga0207695_10475412 Ga0207695_104754122 203
64 3300025918 Ga0207662_10233295 Ga0207662_102332952 203
65 3300025921 Ga0207652_10225436 Ga0207652_102254362 203
66 3300025922 Ga0207646_10331997 Ga0207646_103319971 203
67 3300025924 Ga0207694_10448982 Ga0207694_104489822 203
68 3300027907 Ga0207428_10052552 Ga0207428_100525522 203
69 3300031838 Ga0307518_10005535 Ga0307518_100055357 203
70 3300035117 Ga0373953_0046738 Ga0373953_0046738_611_1228 203
71 3300036401 Ga0373937_0120654 Ga0373937_0120654_171_788 203
72 3300046454 Ga0495592_0065677 Ga0495592_0065677_33_650 203
73 3300046476 Ga0495662_0016600 Ga0495662_0016600_2401_3018 203
74 3300046511 Ga0495608_0032248 Ga0495608_0032248_2567_3184 203
75 3300046514 Ga0495618_0020180 Ga0495618_0020180_576_1193 203
76 3300046516 Ga0495628_0037186 Ga0495628_0037186_2361_2978 203
77 3300046517 Ga0495630_0017701 Ga0495630_0017701_2001_2618 203
78 3300046526 Ga0495666_0021985 Ga0495666_0021985_2295_2912 203
79 3300046533 Ga0495640_0037984 Ga0495640_0037984_837_1454 203
80 3300046535 Ga0495586_0005215 Ga0495586_0005215_2581_3198 203
81 3300046535 Ga0495586_0007623 Ga0495586_0007623_3804_4424 203
82 3300046536 Ga0495587_0020200 Ga0495587_0020200_621_1238 203
83 3300046642 Ga0495634_0018833 Ga0495634_0018833_2009_2626 203
84 3300046678 Ga0495599_0008522 Ga0495599_0008522_3141_3758 203
85 3300046689 Ga0495613_0016852 Ga0495613_0016852_627_1244 203
86 3300046690 Ga0495624_0011950 Ga0495624_0011950_1175_1795 203
87 3300046794 Ga0495589_0065141 Ga0495589_0065141_1145_1768 203
88 3300047317 Ga0495604_0005408 Ga0495604_0005408_2688_3305 203
89 3300047319 Ga0495674_0045654 Ga0495674_0045654_313_933 203
90 3300047319 Ga0495674_0397384 Ga0495674_0397384_411_1028 203
91 3300047322 Ga0495680_0033149 Ga0495680_0033149_3145_3762 203
92 3300047323 Ga0495683_0006159 Ga0495683_0006159_5822_6445 203
93 3300047673 Ga0495593_0070793 Ga0495593_0070793_584_1201 203
94 3300048928 Ga0496125_0000487 Ga0496125_0000487_18703_19335 203
95 3300048929 Ga0496126_0396679 Ga0496126_0396679_115_747 203
96 3300049585 Ga0501069_0049069 Ga0501069_0049069_1482_2096 203
97 3300050508 nmdc:mga09592_255722_c1 nmdc:mga09592_255722_c1_601_1269 203
98 3300050508 nmdc:mga09592_281201_c1 nmdc:mga09592_281201_c1_671_1285 203
99 3300050512 nmdc:mga0n895_29473_c1 nmdc:mga0n895_29473_c1_2305_2919 203
100 3300050512 nmdc:mga0n895_673898_c1 nmdc:mga0n895_673898_c1_330_944 203
101 3300050513 nmdc:mga0rr50_118220_c1 nmdc:mga0rr50_118220_c1_1176_1790 203
102 3300050513 nmdc:mga0rr50_84223_c1 nmdc:mga0rr50_84223_c1_605_1219 203
103 3300050515 nmdc:mga0a205_405276_c1 nmdc:mga0a205_405276_c1_434_1048 203
104 3300005544 Ga0070686_100935868 Ga0070686_1009358681 204
105 3300005578 Ga0068854_100559561 Ga0068854_1005595612 204
106 3300005616 Ga0068852_100227331 Ga0068852_1002273312 204
107 3300006186 Ga0075369_10090058 Ga0075369_100900581 204
108 3300042156 Ga0439446_0067389 Ga0439446_0067389_251_874 204
109 3300042876 Ga0451577_0029743 Ga0451577_0029743_156_776 204
110 3300044712 Ga0453684_0001472 Ga0453684_0001472_14066_14686 204
111 3300044719 Ga0466971_0230774 Ga0466971_0230774_232_864 204
112 3300045051 Ga0451576_0000659 Ga0451576_0000659_44448_45068 204
113 3300045976 Ga0466967_0048675 Ga0466967_0048675_1201_1833 204
114 3300005530 Ga0070679_100174398 Ga0070679_1001743982 205
115 3300009148 Ga0105243_10065120 Ga0105243_100651203 205
116 3300009176 Ga0105242_10026123 Ga0105242_100261234 205
117 3300009177 Ga0105248_10632983 Ga0105248_106329832 205
118 3300009551 Ga0105238_10119084 Ga0105238_101190842 205
119 3300009553 Ga0105249_10619636 Ga0105249_106196362 205
120 3300014968 Ga0157379_10099310 Ga0157379_100993102 205
121 3300025921 Ga0207652_10569540 Ga0207652_105695401 205
122 3300025934 Ga0207686_10049677 Ga0207686_100496772 205
123 3300025961 Ga0207712_10053327 Ga0207712_100533272 205
124 3300026075 Ga0207708_10744434 Ga0207708_107444341 205
125 3300031251 Ga0265327_10043245 Ga0265327_100432453 205
126 3300031507 Ga0307509_10398892 Ga0307509_103988922 205
127 3300033179 Ga0307507_10071762 Ga0307507_100717622 205
128 3300035691 Ga0373931_0045370 Ga0373931_0045370_496_1143 205
129 3300035691 Ga0373931_0196842 Ga0373931_0196842_98_718 205
130 3300045051 Ga0451576_0263030 Ga0451576_0263030_773_1399 205
131 3300045051 Ga0451576_0365438 Ga0451576_0365438_113_733 205
132 3300046492 Ga0495585_0203569 Ga0495585_0203569_268_957 205
133 3300046500 Ga0495596_0016413 Ga0495596_0016413_1824_2513 205
134 3300046506 Ga0495583_0000190 Ga0495583_0000190_92184_92873 205
135 3300046513 Ga0495616_0109637 Ga0495616_0109637_121_810 205
136 3300046519 Ga0495632_0002487 Ga0495632_0002487_5312_6001 205
137 3300046523 Ga0495644_0009305 Ga0495644_0009305_77_766 205
138 3300046538 Ga0495609_0084499 Ga0495609_0084499_110_799 205
139 3300046542 Ga0495597_0070555 Ga0495597_0070555_517_1206 205
140 3300046648 Ga0495611_0001705 Ga0495611_0001705_1054_1743 205
141 3300046665 Ga0495661_0063151 Ga0495661_0063151_59_748 205
142 3300046691 Ga0495670_0090988 Ga0495670_0090988_462_1151 205
143 3300046794 Ga0495589_0011168 Ga0495589_0011168_262_951 205
144 3300047323 Ga0495683_0059830 Ga0495683_0059830_1211_1876 205
145 3300047470 Ga0495681_0005182 Ga0495681_0005182_5838_6527 205
146 3300049459 Ga0495678_011090 Ga0495678_011090_1332_2021 205
147 3300053178 Ga0500637_0086497 Ga0500637_0086497_115_741 205
148 iso_pu_bacteria 2511231002 2511246300 205
149 3300006844 Ga0075428_100000165 Ga0075428_10000016520 206
150 3300006880 Ga0075429_100071924 Ga0075429_1000719243 206
151 3300027907 Ga0207428_10033134 Ga0207428_100331343 206
152 3300044712 Ga0453684_0617869 Ga0453684_0617869_20_646 206
153 3300048914 Ga0496111_0135052 Ga0496111_0135052_619_1266 206
154 3300050508 nmdc:mga09592_17521_c1 nmdc:mga09592_17521_c1_3041_3661 206
155 3300050509 nmdc:mga0qj67_940795_c1 nmdc:mga0qj67_940795_c1_12_632 206
156 3300053090 Ga0500646_0005310 Ga0500646_0005310_2422_3069 206
157 3300053133 Ga0500655_004068 Ga0500655_004068_1260_1907 206
158 3300053151 Ga0500604_0003018 Ga0500604_0003018_1463_2110 206
159 3300031665 Ga0316575_10000017 Ga0316575_1000001741 207
160 3300042876 Ga0451577_0031868 Ga0451577_0031868_3384_4025 207
161 3300044712 Ga0453684_0119214 Ga0453684_0119214_1764_2399 207
162 3300045051 Ga0451576_0000926 Ga0451576_0000926_15702_16343 207
163 3300049585 Ga0501069_0015564 Ga0501069_0015564_79_795 207
164 3300049586 Ga0501070_0005410 Ga0501070_0005410_1490_2206 207
165 3300049589 Ga0501073_0001548 Ga0501073_0001548_1084_1800 207
166 3300049590 Ga0501074_0001537 Ga0501074_0001537_12702_13418 207
167 3300049741 Ga0501079_0001387 Ga0501079_0001387_13086_13802 207
168 3300049742 Ga0501080_0053929 Ga0501080_0053929_356_1072 207
169 3300049744 Ga0501083_0013218 Ga0501083_0013218_3308_4024 207
170 3300049823 Ga0501044_0403031 Ga0501044_0403031_103_819 207
171 3300005330 Ga0070690_100131590 Ga0070690_1001315902 208
172 3300005337 Ga0070682_100012272 Ga0070682_1000122722 208
173 3300005842 Ga0068858_100371766 Ga0068858_1003717662 208
174 3300006048 Ga0075363_100263184 Ga0075363_1002631842 208
175 3300006852 Ga0075433_10097705 Ga0075433_100977055 208
176 3300006871 Ga0075434_100853857 Ga0075434_1008538572 208
177 3300006880 Ga0075429_100003351 Ga0075429_10000335119 208
178 3300007076 Ga0075435_100098074 Ga0075435_1000980744 208
179 3300009094 Ga0111539_10016495 Ga0111539_1001649511 208
180 3300009147 Ga0114129_10000190 Ga0114129_1000019061 208
181 3300009177 Ga0105248_10024596 Ga0105248_100245962 208
182 3300013306 Ga0163162_10041340 Ga0163162_100413403 208
183 3300013306 Ga0163162_10125133 Ga0163162_101251332 208
184 3300017792 Ga0163161_10030165 Ga0163161_100301652 208
185 3300025903 Ga0207680_10139724 Ga0207680_101397242 208
186 3300025940 Ga0207691_10016066 Ga0207691_1001606611 208
187 3300025941 Ga0207711_10001893 Ga0207711_1000189321 208
188 3300025986 Ga0207658_10051744 Ga0207658_100517443 208
189 3300026035 Ga0207703_10092822 Ga0207703_100928222 208
190 3300027907 Ga0207428_10000488 Ga0207428_1000048837 208
191 3300044673 Ga0453683_0511241 Ga0453683_0511241_121_750 208
192 3300046674 Ga0495588_0124683 Ga0495588_0124683_630_1286 208
193 3300048904 Ga0496101_0000605 Ga0496101_0000605_11188_11844 208
194 3300048905 Ga0496102_0001284 Ga0496102_0001284_21077_21733 208
195 3300048907 Ga0496104_0015301 Ga0496104_0015301_4370_5026 208
196 3300048908 Ga0496105_0001394 Ga0496105_0001394_6386_7042 208
197 3300048908 Ga0496105_0707250 Ga0496105_0707250_82_717 208
198 3300048910 Ga0496107_0068874 Ga0496107_0068874_867_1523 208
199 3300048911 Ga0496108_0246364 Ga0496108_0246364_24_680 208
200 3300048911 Ga0496108_0405372 Ga0496108_0405372_104_778 208
201 3300048912 Ga0496109_0630347 Ga0496109_0630347_275_931 208
202 3300048913 Ga0496110_0003282 Ga0496110_0003282_20_676 208
203 3300048917 Ga0496114_0143128 Ga0496114_0143128_411_1067 208
204 3300050507 nmdc:mga05p37_456_c1 nmdc:mga05p37_456_c1_28468_29121 208
205 3300050508 nmdc:mga09592_9394_c1 nmdc:mga09592_9394_c1_3820_4473 208
206 3300050509 nmdc:mga0qj67_212695_c1 nmdc:mga0qj67_212695_c1_722_1375 208
207 3300050511 nmdc:mga08y16_4744_c1 nmdc:mga08y16_4744_c1_2310_2963 208
208 3300050512 nmdc:mga0n895_447677_c1 nmdc:mga0n895_447677_c1_338_970 208
209 3300005844 Ga0068862_100143830 Ga0068862_1001438304 209
210 3300006844 Ga0075428_100077241 Ga0075428_1000772412 209
211 3300006847 Ga0075431_100075600 Ga0075431_1000756005 209
212 3300028380 Ga0268265_10162719 Ga0268265_101627192 209
213 3300045051 Ga0451576_0000355 Ga0451576_0000355_2765_3475 209
214 3300050510 nmdc:mga06r32_512075_c1 nmdc:mga06r32_512075_c1_497_1141 209
215 3300053730 Ga0500645_009996 Ga0500645_009996_159_803 209
216 3300003323 rootH1_10378803 rootH1_103788032 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09997

DUF2238

Predicted membrane protein (DUF2238)

38

181

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7blz-assembly1.cif.gz_L red alga c.merolae photosystem i 0.5849 100 193
7wfe-assembly1.cif.gz_BL right psi in the cyclic electron transfer supercomplex ndh-psi from arabidopsis 0.5842 100 195
7zq9-assembly1.cif.gz_L2 dimeric psi of chlamydomonas reinhardtii at 2.74 a resolution (symmetry expanded) 0.5297 100 190
5zgh-assembly1.cif.gz_L cryo-em structure of the red algal psi-lhcr 0.5287 86 193
6jeo-assembly1.cif.gz_bL structure of psi tetramer from anabaena 0.5264 76 203
ID Description Score Start End Superfamily
af_P39270_42_182_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.9638 42 180 1.20.144.10
af_P39270_42_182_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.9438 42 180 1.20.144.10
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5036 104 195 1.10.1760.20
5oy0000 Mainly Alpha;Up-down Bundle;Photosystem 1 Reaction Centre Subunit Xi; Chain: L;;Photosystem I PsaL, reaction centre subunit XI 0.4942 88 203 1.20.1240.10
af_A0A0R0G7E0_1084_1251_1.10.357.90 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Telomerase reverse transcriptase (TERT), thumb domain 0.4805 100 206 1.10.357.90
ID Description Score Start End GO Terms
AF-A0A0A1WAZ5-F1-model_v4 Inner membrane protein YjdF 0.9809 9 205 GO:0016020
AF-A0A562QK32-F1-model_v4 Putative membrane protein 0.9796 4 205 GO:0016020
AF-N9TAM8-F1-model_v4 DUF2238 domain-containing protein 0.9794 6 203 GO:0016020
AF-A0A077Z9T6-F1-model_v4 DUF2238 domain containing protein 0.978 36 209 GO:0016020
AF-A0A826X551-F1-model_v4 deleted 0.9764 6 200

Feature Viewer

pLDDT pTM Quality
88.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map