F327457

General Info

Members Datasets Scaffolds Average Seq Length
216 168 432 169

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10211282|Ga0075362_102112822
Length 165
Sequence MITVDYVRRMALYNRWQNENLYVAADRLTDEERYRERGAFFGSIHRTMCHLLWADQTWMSRFSDVPPPAPLADLVAMHGEWQSLKRRRIDFDAEIVRWAEGLAADWPAGVLAYFSPSLGRETSQPRWLFVSHFFNHQTHHRGQIHCMLTQAGMKPGDTDLPMMPS

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 7.41
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10211282 3300006177 Bacteria 946
2 Ga0070683_100096871 3300005329 Bacteria 2775
3 Ga0070680_100069368 3300005336 Bacteria 2895
4 Ga0068868_100086573 3300005338 Bacteria 2519
5 Ga0070660_100143948 3300005339 Bacteria 1914
6 Ga0070692_10041619 3300005345 Bacteria 2355
7 Ga0070659_100089792 3300005366 Bacteria 2462
8 Ga0070709_10341556 3300005434 Bacteria 1104
9 Ga0070714_100447472 3300005435 Bacteria 1227
10 Ga0070714_101377258 3300005435 Bacteria 689
11 Ga0070713_100020566 3300005436 Bacteria 5063
12 Ga0070663_100301305 3300005455 Bacteria 1283
13 Ga0070681_10111693 3300005458 Bacteria 2672
14 Ga0070681_10209163 3300005458 Bacteria 1867
15 Ga0070681_10635582 3300005458 Bacteria 982
16 Ga0070679_100110392 3300005530 Bacteria 2736
17 Ga0070684_100109730 3300005535 Bacteria 2473
18 Ga0068853_100085225 3300005539 Bacteria 2769
19 Ga0070665_100038763 3300005548 Bacteria 4790
20 Ga0068855_100031689 3300005563 Bacteria 6312
21 Ga0068855_100156979 3300005563 Bacteria 2584
22 Ga0068857_100193829 3300005577 Bacteria 1851
23 Ga0068857_100303633 3300005577 Unclassified 1472
24 Ga0068854_100675703 3300005578 Bacteria 889
25 Ga0068856_100319954 3300005614 Bacteria 1568
26 Ga0068859_100232999 3300005617 Bacteria 1930
27 Ga0068859_100715544 3300005617 Bacteria 1091
28 Ga0068861_100716060 3300005719 Bacteria 931
29 Ga0068858_101136799 3300005842 Bacteria 767
30 Ga0070717_10231406 3300006028 Bacteria 1627
31 Ga0070717_11261984 3300006028 Bacteria 672
32 Ga0075368_10063139 3300006042 Bacteria 1485
33 Ga0075363_100155288 3300006048 Bacteria 1293
34 Ga0075364_10486519 3300006051 Bacteria 844
35 Ga0070712_100802436 3300006175 Bacteria 808
36 Ga0075369_10305050 3300006186 Bacteria 744
37 Ga0075370_10086047 3300006353 Bacteria 1810
38 Ga0075428_100000580 3300006844 Bacteria 37416
39 Ga0075430_100019629 3300006846 Bacteria 5751
40 Ga0075431_100003609 3300006847 Bacteria 14993
41 Ga0075434_100320534 3300006871 Bacteria 1570
42 Ga0075429_100067687 3300006880 Bacteria 3108
43 Ga0068865_100036098 3300006881 Bacteria 3330
44 Ga0097620_100232999 3300006931 Bacteria 1930
45 Ga0097620_100715557 3300006931 Bacteria 1091
46 Ga0075435_100096493 3300007076 Bacteria 2446
47 Ga0075435_100871261 3300007076 Bacteria 785
48 Ga0099795_10309008 3300007788 Unclassified 697
49 Ga0105240_10472284 3300009093 Bacteria 1399
50 Ga0105240_11366533 3300009093 Bacteria 745
51 Ga0111539_10004604 3300009094 Bacteria 18016
52 Ga0114129_10001573 3300009147 Bacteria 30997
53 Ga0114129_11669251 3300009147 Bacteria 778
54 Ga0105241_10095394 3300009174 Bacteria 2355
55 Ga0105241_10186387 3300009174 Bacteria 1725
56 Ga0105248_10388477 3300009177 Bacteria 1571
57 Ga0105237_10173309 3300009545 Bacteria 2158
58 Ga0105237_12154237 3300009545 Bacteria 567
59 Ga0105238_10046191 3300009551 Bacteria 4396
60 Ga0105238_10228127 3300009551 Bacteria 1839
61 Ga0105239_10016525 3300010375 Bacteria 8159
62 Ga0157373_10127644 3300013100 Bacteria 1789
63 Ga0157370_10085169 3300013104 Bacteria 2969
64 Ga0171462_1034 3300013250 Bacteria 85441
65 Ga0163162_10530507 3300013306 Bacteria 1306
66 Ga0163162_11950645 3300013306 Bacteria 672
67 Ga0157372_10103924 3300013307 Bacteria 3247
68 Ga0157372_10373538 3300013307 Bacteria 1661
69 Ga0157375_10409129 3300013308 Bacteria 1523
70 Ga0163163_11533367 3300014325 Bacteria 728
71 Ga0157380_10381198 3300014326 Bacteria 1331
72 Ga0157379_12028329 3300014968 Bacteria 569
73 Ga0157376_10081309 3300014969 Bacteria 2781
74 Ga0213876_10016518 3300021384 Bacteria 3902
75 Ga0213875_10000046 3300021388 Bacteria 149850
76 Ga0213871_10181947 3300021441 Bacteria 650
77 Ga0224572_1020945 3300024225 Bacteria 1255
78 Ga0207680_10053627 3300025903 Bacteria 2422
79 Ga0207695_10157908 3300025913 Bacteria 2202
80 Ga0207660_10155461 3300025917 Bacteria 1760
81 Ga0207652_10220735 3300025921 Bacteria 1708
82 Ga0207694_10028675 3300025924 Bacteria 4244
83 Ga0207700_10053346 3300025928 Bacteria 3029
84 Ga0207690_10106985 3300025932 Bacteria 2008
85 Ga0207704_10035730 3300025938 Bacteria 2851
86 Ga0207665_10148770 3300025939 Bacteria 1676
87 Ga0207665_10674305 3300025939 Bacteria 812
88 Ga0207661_10026783 3300025944 Bacteria 4398
89 Ga0207640_10489951 3300025981 Bacteria 1021
90 Ga0207703_10245060 3300026035 Bacteria 1613
91 Ga0207639_10269179 3300026041 Bacteria 1494
92 Ga0207678_10279321 3300026067 Bacteria 1433
93 Ga0207674_10042271 3300026116 Bacteria 4709
94 Ga0207674_10102055 3300026116 Bacteria 2849
95 Ga0207675_100565953 3300026118 Bacteria 1137
96 Ga0207428_10006682 3300027907 Bacteria 10592
97 Ga0268266_10152597 3300028379 Bacteria 2083
98 Ga0265340_10137017 3300031247 Bacteria 1121
99 Ga0265316_10537323 3300031344 Bacteria 833
100 Ga0307416_101101998 3300032002 Bacteria 899
101 Ga0373954_0044099 3300035118 Bacteria 2081
102 Ga0373943_0218167 3300035170 Bacteria 1061
103 Ga0373946_0148070 3300035171 Bacteria 1093
104 Ga0373955_0257147 3300035172 Bacteria 1048
105 Ga0373935_0029855 3300035692 Bacteria 3375
106 Ga0373935_0417852 3300035692 Bacteria 965
107 Ga0373935_0447154 3300035692 Bacteria 933
108 Ga0373927_0115935 3300035695 Bacteria 1746
109 Ga0373947_0201136 3300035725 Bacteria 1303
110 Ga0373925_0095492 3300037068 Bacteria 2277
111 Ga0436365_0734019 3300039437 Bacteria 1200
112 Ga0436365_0916209 3300039437 Bacteria 4767
113 Ga0436365_1064967 3300039437 Bacteria 2037
114 Ga0436365_1222078 3300039437 Bacteria 3118
115 Ga0436365_1836893 3300039437 Bacteria 715
116 Ga0436360_0742576 3300039438 Bacteria 1709
117 Ga0436361_0506405 3300039447 Bacteria 1497
118 Ga0436363_0413331 3300039450 Bacteria 1249
119 Ga0436363_1195483 3300039450 Bacteria 2820
120 Ga0439434_0020072 3300042435 Bacteria 2006
121 Ga0466959_0202399 3300045049 Bacteria 1382
122 Ga0495629_0027346 3300046459 Bacteria 4049
123 Ga0495629_0253770 3300046459 Bacteria 1210
124 Ga0495653_0059764 3300046463 Bacteria 2891
125 Ga0495639_0327221 3300046475 Bacteria 767
126 Ga0495639_0391502 3300046475 Bacteria 701
127 Ga0495662_0040165 3300046476 Bacteria 2259
128 Ga0495664_0002686 3300046477 Bacteria 9570
129 Ga0495594_0297799 3300046499 Bacteria 919
130 Ga0495618_0004196 3300046514 Bacteria 8894
131 Ga0495630_0258403 3300046517 Bacteria 1330
132 Ga0495652_0047385 3300046529 Bacteria 3686
133 Ga0495640_0022656 3300046533 Bacteria 4587
134 Ga0495586_0204664 3300046535 Bacteria 1119
135 Ga0495587_0188286 3300046536 Bacteria 1169
136 Ga0495645_0004365 3300046543 Bacteria 9659
137 Ga0495667_0195983 3300046559 Bacteria 1294
138 Ga0495634_0014954 3300046642 Bacteria 5580
139 Ga0495635_0003106 3300046663 Bacteria 11425
140 Ga0495599_0409509 3300046678 Bacteria 807
141 Ga0495647_0262772 3300046681 Bacteria 771
142 Ga0495658_0155336 3300046683 Bacteria 1408
143 Ga0495613_0557390 3300046689 Bacteria 766
144 Ga0495624_0252171 3300046690 Bacteria 1067
145 Ga0495600_0281924 3300046809 Bacteria 1052
146 Ga0495581_0266412 3300047315 Bacteria 1002
147 Ga0495581_0530849 3300047315 Bacteria 683
148 Ga0495604_0061145 3300047317 Bacteria 2882
149 Ga0495604_0440665 3300047317 Bacteria 852
150 Ga0495604_0476149 3300047317 Bacteria 813
151 Ga0495674_0005446 3300047319 Bacteria 12229
152 Ga0495674_0730201 3300047319 Bacteria 775
153 Ga0495672_0093696 3300047320 Bacteria 1644
154 Ga0495684_0091844 3300047471 Bacteria 2299
155 Ga0496100_0021542 3300048903 Bacteria 3884
156 Ga0496101_0428470 3300048904 Bacteria 1043
157 Ga0496102_0125728 3300048905 Bacteria 2396
158 Ga0496106_0907790 3300048909 Bacteria 695
159 Ga0496108_0005493 3300048911 Bacteria 10258
160 Ga0496108_0495230 3300048911 Bacteria 1067
161 Ga0496109_0001143 3300048912 Bacteria 22064
162 Ga0496109_0472967 3300048912 Bacteria 1183
163 Ga0496110_0004001 3300048913 Bacteria 11354
164 Ga0496110_0179868 3300048913 Bacteria 1920
165 Ga0496111_0006758 3300048914 Bacteria 7474
166 Ga0496112_0086121 3300048915 Bacteria 3109
167 Ga0496112_0144718 3300048915 Bacteria 2345
168 Ga0496112_1103827 3300048915 Bacteria 711
169 Ga0496113_0176774 3300048916 Bacteria 1691
170 Ga0496113_1051842 3300048916 Bacteria 640
171 Ga0501034_0284235 3300049571 Bacteria 1593
172 Ga0501034_0516357 3300049571 Bacteria 1107
173 Ga0501036_0783573 3300049572 Bacteria 786
174 Ga0501039_0656730 3300049575 Bacteria 821
175 Ga0501046_0074625 3300049580 Bacteria 2631
176 Ga0501048_0251271 3300049582 Bacteria 1255
177 Ga0501071_0666259 3300049587 Bacteria 801
178 Ga0501072_0300268 3300049588 Bacteria 1276
179 Ga0501073_0162083 3300049589 Bacteria 1549
180 Ga0501075_0637766 3300049591 Bacteria 812
181 Ga0501076_0133716 3300049592 Bacteria 2013
182 Ga0501076_0729973 3300049592 Bacteria 818
183 Ga0501077_0122870 3300049593 Bacteria 1646
184 Ga0501079_0377816 3300049741 Bacteria 1111
185 Ga0501080_0503642 3300049742 Bacteria 1082
186 Ga0501081_0030356 3300049743 Bacteria 3659
187 Ga0501083_0068298 3300049744 Bacteria 2365
188 Ga0501083_0102518 3300049744 Bacteria 1886
189 Ga0501044_0419996 3300049823 Bacteria 1247
190 nmdc:mga03683_95576_c2 3300050489 Bacteria 926
191 nmdc:mga03n38_119565_c1 3300050490 Bacteria 1293
192 nmdc:mga06z11_37888_c1 3300050494 Bacteria 2391
193 nmdc:mga06z11_648746_c1 3300050494 Bacteria 643
194 nmdc:mga05p37_419_c1 3300050507 Bacteria 45960
195 nmdc:mga05p37_442331_c1 3300050507 Bacteria 1507
196 nmdc:mga09592_4325_c1 3300050508 Bacteria 11474
197 nmdc:mga0qj67_16579_c2 3300050509 Bacteria 4966
198 nmdc:mga06r32_453_c1 3300050510 Bacteria 34927
199 nmdc:mga08y16_793_c1 3300050511 Bacteria 30184
200 nmdc:mga0n895_1049050_c1 3300050512 Bacteria 794
201 nmdc:mga0n895_1679436_c1 3300050512 Bacteria 598
202 nmdc:mga0n895_181684_c1 3300050512 Bacteria 2135
203 nmdc:mga0rr50_1082986_c1 3300050513 Bacteria 682
204 nmdc:mga0rr50_174965_c1 3300050513 Bacteria 1751
205 nmdc:mga0sz30_67412_c1 3300050516 Bacteria 1537
206 Ga0495601_0014201 3300053077 Bacteria 4799
207 Ga0495601_0359751 3300053077 Bacteria 946
208 Ga0495612_0001936 3300053078 Bacteria 8529
209 Ga0495595_0528995 3300053084 Bacteria 601
210 Ga0495619_0010295 3300053085 Bacteria 5886
211 Ga0500646_0055177 3300053090 Bacteria 1156
212 Ga0501084_0200955 3300054114 Bacteria 1682
213 Ga0501084_0509806 3300054114 Bacteria 1017
214 Ga0501082_0000028 3300060353 Bacteria 100580
215 Ga0501082_0075963 3300060353 Bacteria 2895
216 Ga0530510_0861792 3300061734 Bacteria 692
217 Ga0075362_10211282
218 Ga0070683_100096871
219 Ga0070680_100069368
220 Ga0068868_100086573
221 Ga0070660_100143948
222 Ga0070692_10041619
223 Ga0070659_100089792
224 Ga0070709_10341556
225 Ga0070714_100447472
226 Ga0070714_101377258
227 Ga0070713_100020566
228 Ga0070663_100301305
229 Ga0070681_10111693
230 Ga0070681_10209163
231 Ga0070681_10635582
232 Ga0070679_100110392
233 Ga0070684_100109730
234 Ga0068853_100085225
235 Ga0070665_100038763
236 Ga0068855_100031689
237 Ga0068855_100156979
238 Ga0068857_100193829
239 Ga0068857_100303633
240 Ga0068854_100675703
241 Ga0068856_100319954
242 Ga0068859_100232999
243 Ga0068859_100715544
244 Ga0068861_100716060
245 Ga0068858_101136799
246 Ga0070717_10231406
247 Ga0070717_11261984
248 Ga0075368_10063139
249 Ga0075363_100155288
250 Ga0075364_10486519
251 Ga0070712_100802436
252 Ga0075369_10305050
253 Ga0075370_10086047
254 Ga0075428_100000580
255 Ga0075430_100019629
256 Ga0075431_100003609
257 Ga0075434_100320534
258 Ga0075429_100067687
259 Ga0068865_100036098
260 Ga0097620_100232999
261 Ga0097620_100715557
262 Ga0075435_100096493
263 Ga0075435_100871261
264 Ga0099795_10309008
265 Ga0105240_10472284
266 Ga0105240_11366533
267 Ga0111539_10004604
268 Ga0114129_10001573
269 Ga0114129_11669251
270 Ga0105241_10095394
271 Ga0105241_10186387
272 Ga0105248_10388477
273 Ga0105237_10173309
274 Ga0105237_12154237
275 Ga0105238_10046191
276 Ga0105238_10228127
277 Ga0105239_10016525
278 Ga0157373_10127644
279 Ga0157370_10085169
280 Ga0171462_1034
281 Ga0163162_10530507
282 Ga0163162_11950645
283 Ga0157372_10103924
284 Ga0157372_10373538
285 Ga0157375_10409129
286 Ga0163163_11533367
287 Ga0157380_10381198
288 Ga0157379_12028329
289 Ga0157376_10081309
290 Ga0213876_10016518
291 Ga0213875_10000046
292 Ga0213871_10181947
293 Ga0224572_1020945
294 Ga0207680_10053627
295 Ga0207695_10157908
296 Ga0207660_10155461
297 Ga0207652_10220735
298 Ga0207694_10028675
299 Ga0207700_10053346
300 Ga0207690_10106985
301 Ga0207704_10035730
302 Ga0207665_10148770
303 Ga0207665_10674305
304 Ga0207661_10026783
305 Ga0207640_10489951
306 Ga0207703_10245060
307 Ga0207639_10269179
308 Ga0207678_10279321
309 Ga0207674_10042271
310 Ga0207674_10102055
311 Ga0207675_100565953
312 Ga0207428_10006682
313 Ga0268266_10152597
314 Ga0265340_10137017
315 Ga0265316_10537323
316 Ga0307416_101101998
317 Ga0373954_0044099
318 Ga0373943_0218167
319 Ga0373946_0148070
320 Ga0373955_0257147
321 Ga0373935_0029855
322 Ga0373935_0417852
323 Ga0373935_0447154
324 Ga0373927_0115935
325 Ga0373947_0201136
326 Ga0373925_0095492
327 Ga0436365_0734019
328 Ga0436365_0916209
329 Ga0436365_1064967
330 Ga0436365_1222078
331 Ga0436365_1836893
332 Ga0436360_0742576
333 Ga0436361_0506405
334 Ga0436363_0413331
335 Ga0436363_1195483
336 Ga0439434_0020072
337 Ga0466959_0202399
338 Ga0495629_0027346
339 Ga0495629_0253770
340 Ga0495653_0059764
341 Ga0495639_0327221
342 Ga0495639_0391502
343 Ga0495662_0040165
344 Ga0495664_0002686
345 Ga0495594_0297799
346 Ga0495618_0004196
347 Ga0495630_0258403
348 Ga0495652_0047385
349 Ga0495640_0022656
350 Ga0495586_0204664
351 Ga0495587_0188286
352 Ga0495645_0004365
353 Ga0495667_0195983
354 Ga0495634_0014954
355 Ga0495635_0003106
356 Ga0495599_0409509
357 Ga0495647_0262772
358 Ga0495658_0155336
359 Ga0495613_0557390
360 Ga0495624_0252171
361 Ga0495600_0281924
362 Ga0495581_0266412
363 Ga0495581_0530849
364 Ga0495604_0061145
365 Ga0495604_0440665
366 Ga0495604_0476149
367 Ga0495674_0005446
368 Ga0495674_0730201
369 Ga0495672_0093696
370 Ga0495684_0091844
371 Ga0496100_0021542
372 Ga0496101_0428470
373 Ga0496102_0125728
374 Ga0496106_0907790
375 Ga0496108_0005493
376 Ga0496108_0495230
377 Ga0496109_0001143
378 Ga0496109_0472967
379 Ga0496110_0004001
380 Ga0496110_0179868
381 Ga0496111_0006758
382 Ga0496112_0086121
383 Ga0496112_0144718
384 Ga0496112_1103827
385 Ga0496113_0176774
386 Ga0496113_1051842
387 Ga0501034_0284235
388 Ga0501034_0516357
389 Ga0501036_0783573
390 Ga0501039_0656730
391 Ga0501046_0074625
392 Ga0501048_0251271
393 Ga0501071_0666259
394 Ga0501072_0300268
395 Ga0501073_0162083
396 Ga0501075_0637766
397 Ga0501076_0133716
398 Ga0501076_0729973
399 Ga0501077_0122870
400 Ga0501079_0377816
401 Ga0501080_0503642
402 Ga0501081_0030356
403 Ga0501083_0068298
404 Ga0501083_0102518
405 Ga0501044_0419996
406 nmdc:mga03683_95576_c2
407 nmdc:mga03n38_119565_c1
408 nmdc:mga06z11_37888_c1
409 nmdc:mga06z11_648746_c1
410 nmdc:mga05p37_419_c1
411 nmdc:mga05p37_442331_c1
412 nmdc:mga09592_4325_c1
413 nmdc:mga0qj67_16579_c2
414 nmdc:mga06r32_453_c1
415 nmdc:mga08y16_793_c1
416 nmdc:mga0n895_1049050_c1
417 nmdc:mga0n895_1679436_c1
418 nmdc:mga0n895_181684_c1
419 nmdc:mga0rr50_1082986_c1
420 nmdc:mga0rr50_174965_c1
421 nmdc:mga0sz30_67412_c1
422 Ga0495601_0014201
423 Ga0495601_0359751
424 Ga0495612_0001936
425 Ga0495595_0528995
426 Ga0495619_0010295
427 Ga0500646_0055177
428 Ga0501084_0200955
429 Ga0501084_0509806
430 Ga0501082_0000028
431 Ga0501082_0075963
432 Ga0530510_0861792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

13

144

0.79

PF05163

DinB

DinB family

1

165

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8444 4 161
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7929 1 161
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7697 16 160
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.767 1 161
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7635 5 150
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8485 9 161 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7947 9 161 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7434 16 160 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7346 4 152 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7327 13 149 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A537TCD1-F1-model_v4 Damage-inducible protein DinB 0.9922 1 166
AF-A0A537R8X8-F1-model_v4 Damage-inducible protein DinB 0.9912 1 134
AF-A0A3D3SL31-F1-model_v4 deleted 0.9902 1 103
AF-A0A1Y5RYE3-F1-model_v4 DinB family protein 0.9862 1 166
AF-A0A3M2EJL9-F1-model_v4 Damage-inducible protein DinB 0.986 1 165

Map