F327400

General Info

Members Datasets Scaffolds Average Seq Length
216 138 432 256

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100055361|Ga0068859_1000553614
Length 285
Sequence MRADYGRGPFRFSNTHTRAGRRLMGMALETHTAVVTGGTKGVGRGVALALAQAGARVFATGRSASDTAARESVSEIRCDHRQDGQVDAAFARILGEAGAVDILVNNVWGGYDNMMENGQFTWPKPFWEQXXXRWDEMFHAGVRAHYHAAQLAAPSMIARKRGLIVNISHWAAQKHLGNVAYGVSKAATDKLTSDLAFELKLHGVTVVSLYPGMVRTEKVMEAAQWLDLSNSESPEFIGRAIAALAADPDVLRHTGQVLVAATVAKDYGFTDVDGKSPRPLTIADV

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.7
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100055361 3300005617 Bacteria 3992
2 JGI25406J46586_10000154 3300003203 Bacteria 30301
3 Ga0070658_10517838 3300005327 Bacteria 1031
4 Ga0070676_10009812 3300005328 Bacteria 5178
5 Ga0070690_100028792 3300005330 Bacteria 3442
6 Ga0070670_100003276 3300005331 Bacteria 13395
7 Ga0068869_100005012 3300005334 Bacteria 8293
8 Ga0068868_100390371 3300005338 Bacteria 1199
9 Ga0070660_100342183 3300005339 Unclassified 1231
10 Ga0070689_100276435 3300005340 Bacteria 1392
11 Ga0070687_100107438 3300005343 Bacteria 1573
12 Ga0070668_100003805 3300005347 Bacteria 11153
13 Ga0070668_100186658 3300005347 Unclassified 1696
14 Ga0070668_100354081 3300005347 Bacteria 1243
15 Ga0070669_100003064 3300005353 Bacteria 12019
16 Ga0070669_100028874 3300005353 Bacteria 3995
17 Ga0070669_100035903 3300005353 Bacteria 3591
18 Ga0070669_100235683 3300005353 Unclassified 1452
19 Ga0070675_100039899 3300005354 Bacteria 3832
20 Ga0070675_100086660 3300005354 Bacteria 2617
21 Ga0070675_100240362 3300005354 Bacteria 1582
22 Ga0070671_100027333 3300005355 Bacteria 4695
23 Ga0070674_100037093 3300005356 Bacteria 3276
24 Ga0070674_100469405 3300005356 Unclassified 1042
25 Ga0070673_100022245 3300005364 Bacteria 4612
26 Ga0070673_100164582 3300005364 Bacteria 1889
27 Ga0070673_100558254 3300005364 Bacteria 1041
28 Ga0070667_100173927 3300005367 Bacteria 1902
29 Ga0070667_100721101 3300005367 Bacteria 923
30 Ga0070701_10113384 3300005438 Bacteria 1518
31 Ga0070700_100006130 3300005441 Bacteria 6405
32 Ga0070694_100170522 3300005444 Bacteria 1603
33 Ga0070678_100023217 3300005456 Bacteria 4129
34 Ga0070662_100114789 3300005457 Unclassified 2056
35 Ga0068867_100001452 3300005459 Bacteria 16424
36 Ga0068867_100189755 3300005459 Bacteria 1639
37 Ga0070706_100094194 3300005467 Unclassified 2779
38 Ga0068853_100380047 3300005539 Bacteria 1319
39 Ga0070672_100001730 3300005543 Bacteria 13660
40 Ga0070672_100022937 3300005543 Bacteria 4594
41 Ga0070672_100026377 3300005543 Bacteria 4323
42 Ga0070672_100095151 3300005543 Bacteria 2408
43 Ga0070672_100427038 3300005543 Bacteria 1139
44 Ga0070686_100000698 3300005544 Bacteria 19479
45 Ga0070695_100202409 3300005545 Bacteria 1420
46 Ga0070665_100010205 3300005548 Bacteria 9500
47 Ga0070665_100178240 3300005548 Bacteria 2126
48 Ga0070664_100006796 3300005564 Bacteria 9224
49 Ga0070664_100734377 3300005564 Bacteria 921
50 Ga0068857_100019224 3300005577 Bacteria 5997
51 Ga0068859_100059443 3300005617 Bacteria 3850
52 Ga0068864_100038838 3300005618 Bacteria 4067
53 Ga0068861_100007641 3300005719 Bacteria 7418
54 Ga0068851_10004425 3300005834 Bacteria 6337
55 Ga0068870_10062442 3300005840 Bacteria 2006
56 Ga0068863_100351877 3300005841 Bacteria 1435
57 Ga0068858_100027345 3300005842 Bacteria 5299
58 Ga0068860_100098515 3300005843 Bacteria 2788
59 Ga0068860_100108438 3300005843 Bacteria 2654
60 Ga0068860_100214222 3300005843 Bacteria 1869
61 Ga0068862_100006176 3300005844 Bacteria 9976
62 Ga0081539_10000112 3300005985 Bacteria 190218
63 Ga0081539_10003740 3300005985 Bacteria 18100
64 Ga0097621_100475542 3300006237 Bacteria 1129
65 Ga0068871_100230952 3300006358 Bacteria 1606
66 Ga0075428_100004528 3300006844 Bacteria 15359
67 Ga0075428_100216791 3300006844 Bacteria 2067
68 Ga0075431_100035809 3300006847 Bacteria 5111
69 Ga0075433_10408975 3300006852 Bacteria 1197
70 Ga0068865_100025444 3300006881 Bacteria 3894
71 Ga0068865_100121482 3300006881 Bacteria 1943
72 Ga0097620_100055361 3300006931 Bacteria 3992
73 Ga0097620_100059450 3300006931 Bacteria 3850
74 Ga0105240_10571968 3300009093 Bacteria 1248
75 Ga0111539_10048358 3300009094 Bacteria 5078
76 Ga0111539_10049464 3300009094 Bacteria 5012
77 Ga0114129_10019654 3300009147 Bacteria 9615
78 Ga0114129_10027561 3300009147 Bacteria 8043
79 Ga0114129_10031176 3300009147 Bacteria 7540
80 Ga0114129_10052988 3300009147 Bacteria 5692
81 Ga0114129_10218927 3300009147 Bacteria 2570
82 Ga0114129_11194375 3300009147 Unclassified 948
83 Ga0114129_11431950 3300009147 Bacteria 851
84 Ga0105243_10001911 3300009148 Bacteria 17773
85 Ga0105243_10042315 3300009148 Bacteria 3566
86 Ga0105243_10438384 3300009148 Bacteria 1223
87 Ga0105243_10457347 3300009148 Bacteria 1199
88 Ga0105243_10581064 3300009148 Bacteria 1075
89 Ga0105242_10000121 3300009176 Bacteria 57323
90 Ga0105242_10013014 3300009176 Bacteria 6418
91 Ga0105242_11081739 3300009176 Bacteria 815
92 Ga0105248_10258344 3300009177 Bacteria 1961
93 Ga0105249_10000436 3300009553 Bacteria 39538
94 Ga0105249_10007369 3300009553 Bacteria 9594
95 Ga0105249_10218982 3300009553 Unclassified 1872
96 Ga0105239_10408095 3300010375 Bacteria 1538
97 Ga0105246_10315306 3300011119 Bacteria 1268
98 Ga0157370_10067131 3300013104 Bacteria 3390
99 Ga0163162_10000023 3300013306 Bacteria 193395
100 Ga0163162_10025797 3300013306 Bacteria 5809
101 Ga0163162_10372160 3300013306 Bacteria 1562
102 Ga0157375_10124736 3300013308 Bacteria 2689
103 Ga0157375_10495015 3300013308 Bacteria 1387
104 Ga0157375_10685664 3300013308 Unclassified 1179
105 Ga0157375_10785271 3300013308 Bacteria 1102
106 Ga0163163_10020399 3300014325 Bacteria 6240
107 Ga0163163_10113039 3300014325 Bacteria 2745
108 Ga0157380_10095172 3300014326 Bacteria 2467
109 Ga0157380_10192848 3300014326 Unclassified 1801
110 Ga0157377_10063685 3300014745 Bacteria 2112
111 Ga0163161_10124003 3300017792 Bacteria 1943
112 Ga0213876_10000068 3300021384 Bacteria 125977
113 Ga0213875_10005450 3300021388 Bacteria 6828
114 Ga0207656_10044645 3300025321 Bacteria 1893
115 Ga0207645_10002512 3300025907 Bacteria 14365
116 Ga0207643_10022239 3300025908 Bacteria 3489
117 Ga0207643_10046296 3300025908 Bacteria 2458
118 Ga0207705_10423625 3300025909 Bacteria 1031
119 Ga0207695_10053439 3300025913 Bacteria 4225
120 Ga0207662_10128326 3300025918 Bacteria 1596
121 Ga0207662_10431508 3300025918 Bacteria 898
122 Ga0207646_10434006 3300025922 Bacteria 1185
123 Ga0207681_10029547 3300025923 Bacteria 3562
124 Ga0207681_10041342 3300025923 Bacteria 3073
125 Ga0207681_10603930 3300025923 Bacteria 907
126 Ga0207694_10013231 3300025924 Bacteria 6212
127 Ga0207650_10002630 3300025925 Bacteria 12423
128 Ga0207659_10010450 3300025926 Bacteria 5835
129 Ga0207659_10459720 3300025926 Bacteria 1073
130 Ga0207644_10003908 3300025931 Bacteria 9665
131 Ga0207706_10100070 3300025933 Bacteria 2551
132 Ga0207686_10000017 3300025934 Bacteria 195143
133 Ga0207709_10000024 3300025935 Bacteria 369177
134 Ga0207709_10036413 3300025935 Bacteria 2916
135 Ga0207669_10013918 3300025937 Bacteria 4016
136 Ga0207704_10005390 3300025938 Bacteria 5895
137 Ga0207691_10012003 3300025940 Bacteria 8309
138 Ga0207691_10054295 3300025940 Bacteria 3655
139 Ga0207691_10065654 3300025940 Bacteria 3284
140 Ga0207691_10079082 3300025940 Bacteria 2960
141 Ga0207689_10006158 3300025942 Bacteria 10617
142 Ga0207679_10006143 3300025945 Bacteria 7584
143 Ga0207679_10171902 3300025945 Bacteria 1785
144 Ga0207651_10041477 3300025960 Bacteria 3055
145 Ga0207651_10196056 3300025960 Bacteria 1614
146 Ga0207651_10240867 3300025960 Bacteria 1474
147 Ga0207712_10000785 3300025961 Bacteria 23685
148 Ga0207712_10001548 3300025961 Bacteria 15509
149 Ga0207712_10005247 3300025961 Bacteria 8195
150 Ga0207668_10003095 3300025972 Bacteria 9757
151 Ga0207668_10293354 3300025972 Bacteria 1339
152 Ga0207640_10058393 3300025981 Bacteria 2542
153 Ga0207658_10270718 3300025986 Bacteria 1452
154 Ga0207658_10592106 3300025986 Bacteria 996
155 Ga0207703_10007113 3300026035 Bacteria 8905
156 Ga0207703_10069385 3300026035 Bacteria 2907
157 Ga0207708_10010237 3300026075 Bacteria 6963
158 Ga0207708_10070673 3300026075 Bacteria 2673
159 Ga0207641_10390435 3300026088 Bacteria 1335
160 Ga0207648_10006904 3300026089 Bacteria 11247
161 Ga0207648_10233442 3300026089 Bacteria 1637
162 Ga0207648_10296981 3300026089 Bacteria 1448
163 Ga0207676_10038992 3300026095 Bacteria 3631
164 Ga0207674_10004666 3300026116 Bacteria 16448
165 Ga0207674_10026034 3300026116 Bacteria 6224
166 Ga0207675_100006858 3300026118 Bacteria 10782
167 Ga0207683_10056019 3300026121 Bacteria 3457
168 Ga0207428_10039966 3300027907 Bacteria 3808
169 Ga0207428_10082918 3300027907 Bacteria 2501
170 Ga0207428_10123327 3300027907 Unclassified 1985
171 Ga0268266_10150069 3300028379 Bacteria 2100
172 Ga0268266_10203732 3300028379 Bacteria 1812
173 Ga0268265_10006902 3300028380 Bacteria 7680
174 Ga0268265_10225186 3300028380 Bacteria 1644
175 Ga0268264_10034243 3300028381 Bacteria 4177
176 Ga0268264_10060012 3300028381 Bacteria 3188
177 Ga0268264_10417265 3300028381 Bacteria 1293
178 Ga0265314_10012570 3300031711 Bacteria 6896
179 Ga0307410_10052892 3300031852 Bacteria 2745
180 Ga0307414_10011879 3300032004 Bacteria 5129
181 Ga0307414_10250099 3300032004 Unclassified 1473
182 Ga0307411_10194723 3300032005 Bacteria 1551
183 Ga0436364_0419958 3300037853 Bacteria 3600
184 Ga0436365_0289912 3300039437 Bacteria 336570
185 Ga0436361_0624703 3300039447 Bacteria 1382
186 Ga0450923_045295 3300042125 Bacteria 933
187 Ga0439460_0030170 3300042461 Bacteria 1540
188 Ga0451577_0041014 3300042876 Bacteria 4157
189 Ga0453683_0007631 3300044673 Bacteria 7325
190 Ga0451576_0012443 3300045051 Bacteria 9557
191 Ga0495594_0107067 3300046499 Bacteria 1575
192 Ga0495643_0001254 3300046522 Bacteria 24304
193 Ga0495640_0417098 3300046533 Bacteria 823
194 Ga0495609_0112711 3300046538 Bacteria 1173
195 Ga0495645_0145355 3300046543 Unclassified 1652
196 Ga0495659_0015465 3300046664 Bacteria 2509
197 Ga0495623_0061259 3300046679 Unclassified 2360
198 Ga0495589_0297591 3300046794 Bacteria 748
199 Ga0495674_0012262 3300047319 Bacteria 8079
200 Ga0495675_0024376 3300047444 Unclassified 3857
201 Ga0496102_0327796 3300048905 Unclassified 1442
202 Ga0496106_0022460 3300048909 Bacteria 4687
203 Ga0496107_0057164 3300048910 Bacteria 2820
204 Ga0496108_0073711 3300048911 Bacteria 2882
205 Ga0496109_0346576 3300048912 Unclassified 1403
206 Ga0496111_0126432 3300048914 Bacteria 1890
207 Ga0496112_0011327 3300048915 Bacteria 8138
208 Ga0496113_0630981 3300048916 Unclassified 857
209 nmdc:mga05p37_6458_c1 3300050507 Bacteria 12095
210 nmdc:mga05p37_90084_c1 3300050507 Bacteria 3780
211 nmdc:mga05p37_900_c1 3300050507 Bacteria 33505
212 nmdc:mga09592_40595_c1 3300050508 Bacteria 3910
213 nmdc:mga0qj67_425319_c1 3300050509 Bacteria 1071
214 nmdc:mga06r32_21855_c1 3300050510 Bacteria 5908
215 nmdc:mga08y16_147227_c1 3300050511 Unclassified 2448
216 nmdc:mga08y16_186600_c1 3300050511 Bacteria 2152
217 Ga0068859_100055361
218 JGI25406J46586_10000154
219 Ga0070658_10517838
220 Ga0070676_10009812
221 Ga0070690_100028792
222 Ga0070670_100003276
223 Ga0068869_100005012
224 Ga0068868_100390371
225 Ga0070660_100342183
226 Ga0070689_100276435
227 Ga0070687_100107438
228 Ga0070668_100003805
229 Ga0070668_100186658
230 Ga0070668_100354081
231 Ga0070669_100003064
232 Ga0070669_100028874
233 Ga0070669_100035903
234 Ga0070669_100235683
235 Ga0070675_100039899
236 Ga0070675_100086660
237 Ga0070675_100240362
238 Ga0070671_100027333
239 Ga0070674_100037093
240 Ga0070674_100469405
241 Ga0070673_100022245
242 Ga0070673_100164582
243 Ga0070673_100558254
244 Ga0070667_100173927
245 Ga0070667_100721101
246 Ga0070701_10113384
247 Ga0070700_100006130
248 Ga0070694_100170522
249 Ga0070678_100023217
250 Ga0070662_100114789
251 Ga0068867_100001452
252 Ga0068867_100189755
253 Ga0070706_100094194
254 Ga0068853_100380047
255 Ga0070672_100001730
256 Ga0070672_100022937
257 Ga0070672_100026377
258 Ga0070672_100095151
259 Ga0070672_100427038
260 Ga0070686_100000698
261 Ga0070695_100202409
262 Ga0070665_100010205
263 Ga0070665_100178240
264 Ga0070664_100006796
265 Ga0070664_100734377
266 Ga0068857_100019224
267 Ga0068859_100059443
268 Ga0068864_100038838
269 Ga0068861_100007641
270 Ga0068851_10004425
271 Ga0068870_10062442
272 Ga0068863_100351877
273 Ga0068858_100027345
274 Ga0068860_100098515
275 Ga0068860_100108438
276 Ga0068860_100214222
277 Ga0068862_100006176
278 Ga0081539_10000112
279 Ga0081539_10003740
280 Ga0097621_100475542
281 Ga0068871_100230952
282 Ga0075428_100004528
283 Ga0075428_100216791
284 Ga0075431_100035809
285 Ga0075433_10408975
286 Ga0068865_100025444
287 Ga0068865_100121482
288 Ga0097620_100055361
289 Ga0097620_100059450
290 Ga0105240_10571968
291 Ga0111539_10048358
292 Ga0111539_10049464
293 Ga0114129_10019654
294 Ga0114129_10027561
295 Ga0114129_10031176
296 Ga0114129_10052988
297 Ga0114129_10218927
298 Ga0114129_11194375
299 Ga0114129_11431950
300 Ga0105243_10001911
301 Ga0105243_10042315
302 Ga0105243_10438384
303 Ga0105243_10457347
304 Ga0105243_10581064
305 Ga0105242_10000121
306 Ga0105242_10013014
307 Ga0105242_11081739
308 Ga0105248_10258344
309 Ga0105249_10000436
310 Ga0105249_10007369
311 Ga0105249_10218982
312 Ga0105239_10408095
313 Ga0105246_10315306
314 Ga0157370_10067131
315 Ga0163162_10000023
316 Ga0163162_10025797
317 Ga0163162_10372160
318 Ga0157375_10124736
319 Ga0157375_10495015
320 Ga0157375_10685664
321 Ga0157375_10785271
322 Ga0163163_10020399
323 Ga0163163_10113039
324 Ga0157380_10095172
325 Ga0157380_10192848
326 Ga0157377_10063685
327 Ga0163161_10124003
328 Ga0213876_10000068
329 Ga0213875_10005450
330 Ga0207656_10044645
331 Ga0207645_10002512
332 Ga0207643_10022239
333 Ga0207643_10046296
334 Ga0207705_10423625
335 Ga0207695_10053439
336 Ga0207662_10128326
337 Ga0207662_10431508
338 Ga0207646_10434006
339 Ga0207681_10029547
340 Ga0207681_10041342
341 Ga0207681_10603930
342 Ga0207694_10013231
343 Ga0207650_10002630
344 Ga0207659_10010450
345 Ga0207659_10459720
346 Ga0207644_10003908
347 Ga0207706_10100070
348 Ga0207686_10000017
349 Ga0207709_10000024
350 Ga0207709_10036413
351 Ga0207669_10013918
352 Ga0207704_10005390
353 Ga0207691_10012003
354 Ga0207691_10054295
355 Ga0207691_10065654
356 Ga0207691_10079082
357 Ga0207689_10006158
358 Ga0207679_10006143
359 Ga0207679_10171902
360 Ga0207651_10041477
361 Ga0207651_10196056
362 Ga0207651_10240867
363 Ga0207712_10000785
364 Ga0207712_10001548
365 Ga0207712_10005247
366 Ga0207668_10003095
367 Ga0207668_10293354
368 Ga0207640_10058393
369 Ga0207658_10270718
370 Ga0207658_10592106
371 Ga0207703_10007113
372 Ga0207703_10069385
373 Ga0207708_10010237
374 Ga0207708_10070673
375 Ga0207641_10390435
376 Ga0207648_10006904
377 Ga0207648_10233442
378 Ga0207648_10296981
379 Ga0207676_10038992
380 Ga0207674_10004666
381 Ga0207674_10026034
382 Ga0207675_100006858
383 Ga0207683_10056019
384 Ga0207428_10039966
385 Ga0207428_10082918
386 Ga0207428_10123327
387 Ga0268266_10150069
388 Ga0268266_10203732
389 Ga0268265_10006902
390 Ga0268265_10225186
391 Ga0268264_10034243
392 Ga0268264_10060012
393 Ga0268264_10417265
394 Ga0265314_10012570
395 Ga0307410_10052892
396 Ga0307414_10011879
397 Ga0307414_10250099
398 Ga0307411_10194723
399 Ga0436364_0419958
400 Ga0436365_0289912
401 Ga0436361_0624703
402 Ga0450923_045295
403 Ga0439460_0030170
404 Ga0451577_0041014
405 Ga0453683_0007631
406 Ga0451576_0012443
407 Ga0495594_0107067
408 Ga0495643_0001254
409 Ga0495640_0417098
410 Ga0495609_0112711
411 Ga0495645_0145355
412 Ga0495659_0015465
413 Ga0495623_0061259
414 Ga0495589_0297591
415 Ga0495674_0012262
416 Ga0495675_0024376
417 Ga0496102_0327796
418 Ga0496106_0022460
419 Ga0496107_0057164
420 Ga0496108_0073711
421 Ga0496109_0346576
422 Ga0496111_0126432
423 Ga0496112_0011327
424 Ga0496113_0630981
425 nmdc:mga05p37_6458_c1
426 nmdc:mga05p37_90084_c1
427 nmdc:mga05p37_900_c1
428 nmdc:mga09592_40595_c1
429 nmdc:mga0qj67_425319_c1
430 nmdc:mga06r32_21855_c1
431 nmdc:mga08y16_147227_c1
432 nmdc:mga08y16_186600_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

227

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

262

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7btm-assembly3.cif.gz_H-2 sdr protein/resistance protein napw 0.8623 7 241
7btm-assembly1.cif.gz_D sdr protein/resistance protein napw 0.8586 7 241
7bsx-assembly3.cif.gz_C sdr protein napw-nadp 0.8503 7 241
7btm-assembly3.cif.gz_E sdr protein/resistance protein napw 0.8475 7 241
7btm-assembly4.cif.gz_F sdr protein/resistance protein napw 0.8464 7 241
ID Description Score Start End Superfamily
af_Q6GQN9_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8675 7 231 3.40.50.720
af_Q23612_2_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8616 7 231 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8572 99 181 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8459 43 223 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8436 21 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1M6MQV9-F1-model_v4 Short chain dehydrogenase 0.955 143 247
AF-A0A7W6ZGC9-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9265 101 248
AF-A0A2A6K9N8-F1-model_v4 deleted 0.9253 117 248
AF-A0A1Q7HK82-F1-model_v4 Short-chain dehydrogenase 0.9252 7 249
AF-A0A2S7T8G0-F1-model_v4 Short-chain dehydrogenase 0.9231 110 249 GO:0016491

Map