F327397

General Info

Members Datasets Scaffolds Average Seq Length
216 145 432 419

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100194316|Ga0068852_1001943162
Length 444
Sequence VASNILVEVGPTIKSFEVIVMDRRFFLRSTGIGLASFGFMAVAPEFLHQFANAATLGSTGAYGRKKVLVTVFQRGAVDGLNVIVPHGESEYYNLRPTIAVPKPGKADGAIDLDGFFGLHPSLQPLETLWKDKKLAIVHSVGSPDNTRSHFDAQDYMESGTPGNKGTSDGWLNRVLQGINEKESSPFRAVSMTQQLPRSLYGRAPSVAMSNLADFSIKAGIYTQNLSGGFEDMWQQNAKDTLSQTGKETFEAVDFLKQANPAQYKPENGAVYPNTDFGRSMTQIAQLIKAGIGLEVAFTDTGNDIRWDTHVQEGGSRGQLGNYLRTYGQALAAFSTDLGKRMDDVLVVTMSEFGRTARENGSRGTDHGHANQMLIMGNSVRGGKVYTDWKGLKSDQLNEGRDLALTTDFRDVFSEAAAKHLGSSDLAKVFPGYQASPSKFRGYLG

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
127 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
128 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
129 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
132 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
136 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 0.46
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100194316 3300005616 Bacteria 1917
2 LJQas_1000308 3300000549 Bacteria 8726
3 JGI25406J46586_10010487 3300003203 Bacteria 4109
4 Ga0065704_10116170 3300005289 Bacteria 1858
5 Ga0065715_10090154 3300005293 Bacteria 7545
6 Ga0065707_10114136 3300005295 Bacteria 2306
7 Ga0070670_100010067 3300005331 Bacteria 8068
8 Ga0070670_100016307 3300005331 Bacteria 6381
9 Ga0068869_100024636 3300005334 Bacteria 4169
10 Ga0068869_100029565 3300005334 Bacteria 3840
11 Ga0070666_10042522 3300005335 Bacteria 3041
12 Ga0070666_10128993 3300005335 Unclassified 1756
13 Ga0070680_100028782 3300005336 Bacteria 4458
14 Ga0070682_100000154 3300005337 Bacteria 53052
15 Ga0070660_100023145 3300005339 Bacteria 4601
16 Ga0070660_100046710 3300005339 Bacteria 3320
17 Ga0070660_100161101 3300005339 Bacteria 1808
18 Ga0070661_100094592 3300005344 Bacteria 2215
19 Ga0070669_100000051 3300005353 Bacteria 114909
20 Ga0070675_100060980 3300005354 Bacteria 3114
21 Ga0070675_100167403 3300005354 Bacteria 1894
22 Ga0070671_100010125 3300005355 Bacteria 7574
23 Ga0070688_100054449 3300005365 Bacteria 2506
24 Ga0070659_100069276 3300005366 Bacteria 2799
25 Ga0070701_10031227 3300005438 Bacteria 2641
26 Ga0070705_100040440 3300005440 Bacteria 2651
27 Ga0070681_10006220 3300005458 Bacteria 11602
28 Ga0070681_10049170 3300005458 Bacteria 4212
29 Ga0070685_10001331 3300005466 Bacteria 12975
30 Ga0070685_10023373 3300005466 Bacteria 3385
31 Ga0070706_100003991 3300005467 Bacteria 14364
32 Ga0070698_100043368 3300005471 Bacteria 4612
33 Ga0070679_100059145 3300005530 Bacteria 3819
34 Ga0070679_100077145 3300005530 Bacteria 3321
35 Ga0070684_100157342 3300005535 Bacteria 2061
36 Ga0070697_100000152 3300005536 Bacteria 56083
37 Ga0070697_100000318 3300005536 Bacteria 38344
38 Ga0068853_100173125 3300005539 Bacteria 1954
39 Ga0070672_100124468 3300005543 Bacteria 2113
40 Ga0070686_100006506 3300005544 Bacteria 6497
41 Ga0070695_100032227 3300005545 Bacteria 3276
42 Ga0070695_100070414 3300005545 Unclassified 2288
43 Ga0070665_100003143 3300005548 Bacteria 17761
44 Ga0070704_100263226 3300005549 Unclassified 1422
45 Ga0070664_100009288 3300005564 Bacteria 7982
46 Ga0070664_100025557 3300005564 Bacteria 4896
47 Ga0068857_100010198 3300005577 Bacteria 8167
48 Ga0068857_100012939 3300005577 Bacteria 7270
49 Ga0068857_100213330 3300005577 Bacteria 1762
50 Ga0068852_100114901 3300005616 Bacteria 2453
51 Ga0068859_100025931 3300005617 Bacteria 5880
52 Ga0068859_100070172 3300005617 Bacteria 3539
53 Ga0068859_100131554 3300005617 Bacteria 2574
54 Ga0068864_100009309 3300005618 Bacteria 8102
55 Ga0068851_10059546 3300005834 Bacteria 1953
56 Ga0068863_100060808 3300005841 Bacteria 3572
57 Ga0068863_100227615 3300005841 Bacteria 1798
58 Ga0068858_100041196 3300005842 Bacteria 4283
59 Ga0068858_100191353 3300005842 Bacteria 1933
60 Ga0081539_10000697 3300005985 Bacteria 67380
61 Ga0097621_100250654 3300006237 Bacteria 1550
62 Ga0075431_100058711 3300006847 Bacteria 3971
63 Ga0075431_100205945 3300006847 Unclassified 2011
64 Ga0075434_100005067 3300006871 Bacteria 11960
65 Ga0075434_100054150 3300006871 Bacteria 3986
66 Ga0068865_100087034 3300006881 Bacteria 2257
67 Ga0075436_100010790 3300006914 Bacteria 6267
68 Ga0097620_100025932 3300006931 Bacteria 5880
69 Ga0097620_100070174 3300006931 Bacteria 3539
70 Ga0097620_100131557 3300006931 Bacteria 2574
71 Ga0105240_10151762 3300009093 Unclassified 2759
72 Ga0111539_10161271 3300009094 Unclassified 2622
73 Ga0114129_10089820 3300009147 Bacteria 4259
74 Ga0114129_10255346 3300009147 Bacteria 2352
75 Ga0105243_10225788 3300009148 Unclassified 1658
76 Ga0105249_10042478 3300009553 Bacteria 4135
77 Ga0105239_10140034 3300010375 Unclassified 2695
78 Ga0105239_10217844 3300010375 Bacteria 2140
79 Ga0105246_10220132 3300011119 Unclassified 1487
80 Ga0157373_10043327 3300013100 Bacteria 3215
81 Ga0157373_10111499 3300013100 Bacteria 1923
82 Ga0157370_10191562 3300013104 Bacteria 1898
83 Ga0157369_10109046 3300013105 Bacteria 2944
84 Ga0157374_10019550 3300013296 Bacteria 5996
85 Ga0157378_10030379 3300013297 Bacteria 4775
86 Ga0163162_10162127 3300013306 Unclassified 2358
87 Ga0163162_10184885 3300013306 Bacteria 2211
88 Ga0163162_10250533 3300013306 Bacteria 1903
89 Ga0163162_10408592 3300013306 Unclassified 1490
90 Ga0157375_10044205 3300013308 Bacteria 4326
91 Ga0163163_10016607 3300014325 Bacteria 6844
92 Ga0163163_10094082 3300014325 Bacteria 3014
93 Ga0163163_10371831 3300014325 Bacteria 1486
94 Ga0157380_10002627 3300014326 Bacteria 12159
95 Ga0157379_10040788 3300014968 Bacteria 4144
96 Ga0157379_10255383 3300014968 Unclassified 1592
97 Ga0157376_10071417 3300014969 Bacteria 2950
98 Ga0163161_10001229 3300017792 Bacteria 19210
99 Ga0207688_10093667 3300025901 Bacteria 1728
100 Ga0207680_10096840 3300025903 Unclassified 1888
101 Ga0207680_10118185 3300025903 Bacteria 1730
102 Ga0207645_10045070 3300025907 Bacteria 2819
103 Ga0207643_10046714 3300025908 Unclassified 2448
104 Ga0207684_10001843 3300025910 Bacteria 22093
105 Ga0207684_10019955 3300025910 Bacteria 5727
106 Ga0207707_10003101 3300025912 Bacteria 14751
107 Ga0207707_10216097 3300025912 Bacteria 1669
108 Ga0207671_10046600 3300025914 Bacteria 3208
109 Ga0207660_10020982 3300025917 Bacteria 4390
110 Ga0207660_10145266 3300025917 Bacteria 1817
111 Ga0207657_10033627 3300025919 Bacteria 4620
112 Ga0207657_10047224 3300025919 Bacteria 3766
113 Ga0207649_10035478 3300025920 Bacteria 2997
114 Ga0207652_10068198 3300025921 Unclassified 3085
115 Ga0207646_10082424 3300025922 Bacteria 2876
116 Ga0207681_10000043 3300025923 Bacteria 136641
117 Ga0207650_10012806 3300025925 Bacteria 5795
118 Ga0207690_10023685 3300025932 Bacteria 3835
119 Ga0207686_10052425 3300025934 Unclassified 2546
120 Ga0207670_10161645 3300025936 Bacteria 1672
121 Ga0207704_10137457 3300025938 Bacteria 1703
122 Ga0207691_10023651 3300025940 Bacteria 5785
123 Ga0207689_10005217 3300025942 Bacteria 11662
124 Ga0207689_10011821 3300025942 Bacteria 7477
125 Ga0207679_10188991 3300025945 Bacteria 1710
126 Ga0207712_10008841 3300025961 Bacteria 6368
127 Ga0207712_10029709 3300025961 Bacteria 3670
128 Ga0207712_10089502 3300025961 Bacteria 2263
129 Ga0207658_10031699 3300025986 Bacteria 3756
130 Ga0207703_10187040 3300026035 Bacteria 1831
131 Ga0207703_10324213 3300026035 Unclassified 1411
132 Ga0207639_10147295 3300026041 Bacteria 1968
133 Ga0207708_10224669 3300026075 Bacteria 1506
134 Ga0207641_10025878 3300026088 Bacteria 4839
135 Ga0207641_10259920 3300026088 Bacteria 1625
136 Ga0207676_10015906 3300026095 Bacteria 5442
137 Ga0207676_10036340 3300026095 Bacteria 3746
138 Ga0207676_10061601 3300026095 Bacteria 2971
139 Ga0207676_10163610 3300026095 Bacteria 1931
140 Ga0207674_10000037 3300026116 Bacteria 134125
141 Ga0207674_10015448 3300026116 Bacteria 8389
142 Ga0207674_10136630 3300026116 Bacteria 2413
143 Ga0268266_10006946 3300028379 Bacteria 10291
144 Ga0268265_10123627 3300028380 Bacteria 2137
145 Ga0268264_10003358 3300028381 Bacteria 13839
146 Ga0268264_10174697 3300028381 Bacteria 1946
147 Ga0307408_100025961 3300031548 Bacteria 4017
148 Ga0307408_100098539 3300031548 Unclassified 2222
149 Ga0265314_10094660 3300031711 Bacteria 1936
150 Ga0307405_10004537 3300031731 Bacteria 6574
151 Ga0307405_10012318 3300031731 Bacteria 4520
152 Ga0307405_10014066 3300031731 Bacteria 4291
153 Ga0307405_10070238 3300031731 Unclassified 2248
154 Ga0307413_10000724 3300031824 Bacteria 11339
155 Ga0307413_10011477 3300031824 Bacteria 4360
156 Ga0307413_10040577 3300031824 Bacteria 2717
157 Ga0307413_10177348 3300031824 Unclassified 1515
158 Ga0307410_10003773 3300031852 Bacteria 7684
159 Ga0307410_10017106 3300031852 Bacteria 4344
160 Ga0307410_10107936 3300031852 Bacteria 2009
161 Ga0307406_10016942 3300031901 Bacteria 4240
162 Ga0307406_10072935 3300031901 Unclassified 2255
163 Ga0307407_10014830 3300031903 Bacteria 3829
164 Ga0307407_10021534 3300031903 Bacteria 3327
165 Ga0307412_10011778 3300031911 Bacteria 5074
166 Ga0307412_10064022 3300031911 Bacteria 2483
167 Ga0307412_10109980 3300031911 Unclassified 1966
168 Ga0307409_100090336 3300031995 Bacteria 2507
169 Ga0307409_100280996 3300031995 Bacteria 1538
170 Ga0307416_100080597 3300032002 Bacteria 2748
171 Ga0307416_100140867 3300032002 Unclassified 2192
172 Ga0307416_100152341 3300032002 Bacteria 2123
173 Ga0307414_10008766 3300032004 Bacteria 5766
174 Ga0307414_10019090 3300032004 Bacteria 4241
175 Ga0307414_10262089 3300032004 Unclassified 1443
176 Ga0307411_10001382 3300032005 Bacteria 9842
177 Ga0307411_10012195 3300032005 Bacteria 4676
178 Ga0307411_10037445 3300032005 Bacteria 3050
179 Ga0307415_100005564 3300032126 Bacteria 6704
180 Ga0307415_100019361 3300032126 Unclassified 4131
181 Ga0307415_100052992 3300032126 Bacteria 2762
182 Ga0242420_000216 3300038996 Bacteria 6190
183 Ga0436365_1801695 3300039437 Bacteria 18738
184 Ga0439434_0010843 3300042435 Unclassified 2691
185 Ga0495610_0046911 3300046512 Bacteria 2128
186 Ga0495632_0005696 3300046519 Bacteria 8179
187 Ga0495621_0054342 3300046539 Bacteria 1439
188 Ga0495636_0013357 3300047318 Bacteria 3259
189 Ga0495672_0026312 3300047320 Bacteria 3714
190 Ga0496106_0074966 3300048909 Unclassified 2591
191 Ga0501043_0100170 3300049579 Bacteria 2278
192 Ga0501048_0149609 3300049582 Bacteria 1651
193 Ga0501071_0023332 3300049587 Bacteria 4321
194 Ga0501072_0001419 3300049588 Bacteria 17963
195 Ga0501075_0017897 3300049591 Bacteria 5120
196 Ga0501202_009498 3300049652 Unclassified 1790
197 Ga0501207_005050 3300049654 Unclassified 1814
198 Ga0501209_016433 3300049656 Unclassified 1671
199 Ga0501242_000865 3300049674 Unclassified 2865
200 Ga0501249_005564 3300049679 Bacteria 2577
201 Ga0501250_001264 3300049680 Unclassified 2032
202 Ga0501257_013598 3300049686 Unclassified 1867
203 Ga0501080_0124370 3300049742 Bacteria 2389
204 Ga0501081_0007375 3300049743 Bacteria 7137
205 Ga0501268_002880 3300049765 Unclassified 2308
206 Ga0501272_002011 3300049769 Unclassified 1998
207 nmdc:mga05p37_93683_c1 3300050507 Bacteria 3701
208 nmdc:mga06r32_195244_c1 3300050510 Unclassified 2011
209 nmdc:mga0n895_177581_c1 3300050512 Bacteria 2160
210 nmdc:mga0n895_249931_c1 3300050512 Bacteria 1800
211 nmdc:mga0rr50_213252_c1 3300050513 Bacteria 1591
212 nmdc:mga08x19_66931_c1 3300050514 Bacteria 2336
213 Ga0500616_0001628 3300053153 Bacteria 20838
214 Ga0501084_0145551 3300054114 Bacteria 1996
215 Ga0501082_0022314 3300060353 Bacteria 5453
216 Ga0530510_0108095 3300061734 Bacteria 2036
217 Ga0068852_100194316
218 LJQas_1000308
219 JGI25406J46586_10010487
220 Ga0065704_10116170
221 Ga0065715_10090154
222 Ga0065707_10114136
223 Ga0070670_100010067
224 Ga0070670_100016307
225 Ga0068869_100024636
226 Ga0068869_100029565
227 Ga0070666_10042522
228 Ga0070666_10128993
229 Ga0070680_100028782
230 Ga0070682_100000154
231 Ga0070660_100023145
232 Ga0070660_100046710
233 Ga0070660_100161101
234 Ga0070661_100094592
235 Ga0070669_100000051
236 Ga0070675_100060980
237 Ga0070675_100167403
238 Ga0070671_100010125
239 Ga0070688_100054449
240 Ga0070659_100069276
241 Ga0070701_10031227
242 Ga0070705_100040440
243 Ga0070681_10006220
244 Ga0070681_10049170
245 Ga0070685_10001331
246 Ga0070685_10023373
247 Ga0070706_100003991
248 Ga0070698_100043368
249 Ga0070679_100059145
250 Ga0070679_100077145
251 Ga0070684_100157342
252 Ga0070697_100000152
253 Ga0070697_100000318
254 Ga0068853_100173125
255 Ga0070672_100124468
256 Ga0070686_100006506
257 Ga0070695_100032227
258 Ga0070695_100070414
259 Ga0070665_100003143
260 Ga0070704_100263226
261 Ga0070664_100009288
262 Ga0070664_100025557
263 Ga0068857_100010198
264 Ga0068857_100012939
265 Ga0068857_100213330
266 Ga0068852_100114901
267 Ga0068859_100025931
268 Ga0068859_100070172
269 Ga0068859_100131554
270 Ga0068864_100009309
271 Ga0068851_10059546
272 Ga0068863_100060808
273 Ga0068863_100227615
274 Ga0068858_100041196
275 Ga0068858_100191353
276 Ga0081539_10000697
277 Ga0097621_100250654
278 Ga0075431_100058711
279 Ga0075431_100205945
280 Ga0075434_100005067
281 Ga0075434_100054150
282 Ga0068865_100087034
283 Ga0075436_100010790
284 Ga0097620_100025932
285 Ga0097620_100070174
286 Ga0097620_100131557
287 Ga0105240_10151762
288 Ga0111539_10161271
289 Ga0114129_10089820
290 Ga0114129_10255346
291 Ga0105243_10225788
292 Ga0105249_10042478
293 Ga0105239_10140034
294 Ga0105239_10217844
295 Ga0105246_10220132
296 Ga0157373_10043327
297 Ga0157373_10111499
298 Ga0157370_10191562
299 Ga0157369_10109046
300 Ga0157374_10019550
301 Ga0157378_10030379
302 Ga0163162_10162127
303 Ga0163162_10184885
304 Ga0163162_10250533
305 Ga0163162_10408592
306 Ga0157375_10044205
307 Ga0163163_10016607
308 Ga0163163_10094082
309 Ga0163163_10371831
310 Ga0157380_10002627
311 Ga0157379_10040788
312 Ga0157379_10255383
313 Ga0157376_10071417
314 Ga0163161_10001229
315 Ga0207688_10093667
316 Ga0207680_10096840
317 Ga0207680_10118185
318 Ga0207645_10045070
319 Ga0207643_10046714
320 Ga0207684_10001843
321 Ga0207684_10019955
322 Ga0207707_10003101
323 Ga0207707_10216097
324 Ga0207671_10046600
325 Ga0207660_10020982
326 Ga0207660_10145266
327 Ga0207657_10033627
328 Ga0207657_10047224
329 Ga0207649_10035478
330 Ga0207652_10068198
331 Ga0207646_10082424
332 Ga0207681_10000043
333 Ga0207650_10012806
334 Ga0207690_10023685
335 Ga0207686_10052425
336 Ga0207670_10161645
337 Ga0207704_10137457
338 Ga0207691_10023651
339 Ga0207689_10005217
340 Ga0207689_10011821
341 Ga0207679_10188991
342 Ga0207712_10008841
343 Ga0207712_10029709
344 Ga0207712_10089502
345 Ga0207658_10031699
346 Ga0207703_10187040
347 Ga0207703_10324213
348 Ga0207639_10147295
349 Ga0207708_10224669
350 Ga0207641_10025878
351 Ga0207641_10259920
352 Ga0207676_10015906
353 Ga0207676_10036340
354 Ga0207676_10061601
355 Ga0207676_10163610
356 Ga0207674_10000037
357 Ga0207674_10015448
358 Ga0207674_10136630
359 Ga0268266_10006946
360 Ga0268265_10123627
361 Ga0268264_10003358
362 Ga0268264_10174697
363 Ga0307408_100025961
364 Ga0307408_100098539
365 Ga0265314_10094660
366 Ga0307405_10004537
367 Ga0307405_10012318
368 Ga0307405_10014066
369 Ga0307405_10070238
370 Ga0307413_10000724
371 Ga0307413_10011477
372 Ga0307413_10040577
373 Ga0307413_10177348
374 Ga0307410_10003773
375 Ga0307410_10017106
376 Ga0307410_10107936
377 Ga0307406_10016942
378 Ga0307406_10072935
379 Ga0307407_10014830
380 Ga0307407_10021534
381 Ga0307412_10011778
382 Ga0307412_10064022
383 Ga0307412_10109980
384 Ga0307409_100090336
385 Ga0307409_100280996
386 Ga0307416_100080597
387 Ga0307416_100140867
388 Ga0307416_100152341
389 Ga0307414_10008766
390 Ga0307414_10019090
391 Ga0307414_10262089
392 Ga0307411_10001382
393 Ga0307411_10012195
394 Ga0307411_10037445
395 Ga0307415_100005564
396 Ga0307415_100019361
397 Ga0307415_100052992
398 Ga0242420_000216
399 Ga0436365_1801695
400 Ga0439434_0010843
401 Ga0495610_0046911
402 Ga0495632_0005696
403 Ga0495621_0054342
404 Ga0495636_0013357
405 Ga0495672_0026312
406 Ga0496106_0074966
407 Ga0501043_0100170
408 Ga0501048_0149609
409 Ga0501071_0023332
410 Ga0501072_0001419
411 Ga0501075_0017897
412 Ga0501202_009498
413 Ga0501207_005050
414 Ga0501209_016433
415 Ga0501242_000865
416 Ga0501249_005564
417 Ga0501250_001264
418 Ga0501257_013598
419 Ga0501080_0124370
420 Ga0501081_0007375
421 Ga0501268_002880
422 Ga0501272_002011
423 nmdc:mga05p37_93683_c1
424 nmdc:mga06r32_195244_c1
425 nmdc:mga0n895_177581_c1
426 nmdc:mga0n895_249931_c1
427 nmdc:mga0rr50_213252_c1
428 nmdc:mga08x19_66931_c1
429 Ga0500616_0001628
430 Ga0501084_0145551
431 Ga0501082_0022314
432 Ga0530510_0108095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

65

430

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.6837 241 330
6xkd-assembly2.cif.gz_B structure of ligand-bound mouse cgamp hydrolase enpp1 0.659 241 331
2ify-assembly1.cif.gz_A structure of bacillus anthracis cofactor-independent phosphoglucerate mutase 0.6571 256 405
6wev-assembly2.cif.gz_BbB crystal structures of human e-npp 1: bound to n-{[1-(6,7-dimethoxy-5,8-dihydroquinazolin-4-yl)piperidin-4-yl]methyl}sulfuric diamide 0.6119 248 330
6v8q-assembly1.cif.gz_A structure of an inner membrane protein required for phopq regulated increases in outer membrane cardiolipin 0.6021 41 407
ID Description Score Start End Superfamily
1ajbA00 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5838 254 361 3.40.720.10
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5824 233 330 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5784 44 352 3.40.720.10
4gtyB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5774 241 330 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5727 44 397 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A1F2QV88-F1-model_v4 DUF1501 domain-containing protein 0.9811 259 421
AF-A0A3M1JBJ8-F1-model_v4 DUF1501 domain-containing protein 0.9707 252 421
AF-A0A2V8AA60-F1-model_v4 DUF1501 domain-containing protein 0.9663 282 421
AF-A0A3M1JBJ8-F1-model_v4 DUF1501 domain-containing protein 0.9649 252 421
AF-A0A1F2QV88-F1-model_v4 DUF1501 domain-containing protein 0.9633 259 421

Map