F327392

General Info

Members Datasets Scaffolds Average Seq Length
216 139 432 178

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100616332|Ga0068856_1006163321
Length 204
Sequence MREQPAPLLTVGHGTADRYQLTPLLRGAAIEQVVDVRSAPGSRRNPDVGRVQLQAWLAEAGIGYRWEKRLGGFRRPSADSPDTVWRNASFRGYAGYTREPDFLAAMNELLAQTDAIRTAVMCSEAVWWRCHRRLIADYAVLACRVPVQHLMHDGRLTAHITTAGVRLRPDGLLVYDGAEPASSPDQAPDATSYTRPSPSKGRRA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
84 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
138 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
139 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 2.31
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.78
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100616332 3300005614 Bacteria 1106
2 Ga0070658_10004424 3300005327 Bacteria 11446
3 Ga0070658_10487367 3300005327 Bacteria 1064
4 Ga0070683_100175771 3300005329 Bacteria 2032
5 Ga0070680_100012774 3300005336 Bacteria 6531
6 Ga0070680_100217776 3300005336 Bacteria 1611
7 Ga0070680_100426091 3300005336 Bacteria 1132
8 Ga0070682_100019165 3300005337 Bacteria 4009
9 Ga0070660_100049654 3300005339 Bacteria 3226
10 Ga0070709_10002518 3300005434 Bacteria 9922
11 Ga0070709_10395749 3300005434 Bacteria 1030
12 Ga0070714_100004308 3300005435 Bacteria 10729
13 Ga0070714_100188712 3300005435 Bacteria 1879
14 Ga0070714_100189812 3300005435 Bacteria 1874
15 Ga0070714_100236482 3300005435 Bacteria 1685
16 Ga0070714_100274376 3300005435 Bacteria 1564
17 Ga0070714_100694480 3300005435 Bacteria 981
18 Ga0070714_101359617 3300005435 Bacteria 693
19 Ga0070713_100003054 3300005436 Bacteria 10996
20 Ga0070713_100068872 3300005436 Bacteria 2983
21 Ga0070713_100150648 3300005436 Bacteria 2069
22 Ga0070713_100390960 3300005436 Bacteria 1297
23 Ga0070713_100398253 3300005436 Bacteria 1285
24 Ga0070713_100479150 3300005436 Unclassified 1172
25 Ga0070713_101058055 3300005436 Bacteria 784
26 Ga0070710_10000561 3300005437 Bacteria 17599
27 Ga0070710_10002458 3300005437 Bacteria 8776
28 Ga0070711_100002275 3300005439 Bacteria 10892
29 Ga0070711_100169556 3300005439 Bacteria 1663
30 Ga0070708_100356621 3300005445 Bacteria 1378
31 Ga0070681_10011815 3300005458 Bacteria 8656
32 Ga0070681_10042056 3300005458 Bacteria 4580
33 Ga0070681_10094751 3300005458 Bacteria 2934
34 Ga0070698_100000317 3300005471 Bacteria 49042
35 Ga0070698_100010938 3300005471 Bacteria 9653
36 Ga0070699_100602002 3300005518 Bacteria 1002
37 Ga0070679_100008407 3300005530 Bacteria 9713
38 Ga0070679_100010792 3300005530 Bacteria 8675
39 Ga0070679_100258964 3300005530 Bacteria 1695
40 Ga0070679_100723322 3300005530 Bacteria 938
41 Ga0070684_100330495 3300005535 Bacteria 1401
42 Ga0068853_100930994 3300005539 Bacteria 835
43 Ga0070665_100584364 3300005548 Bacteria 1130
44 Ga0068855_100419978 3300005563 Bacteria 1463
45 Ga0068857_100658738 3300005577 Bacteria 992
46 Ga0070717_10010211 3300006028 Bacteria 7073
47 Ga0070717_10385966 3300006028 Bacteria 1256
48 Ga0075432_10021935 3300006058 Bacteria 2183
49 Ga0070715_10017429 3300006163 Bacteria 2719
50 Ga0070715_10136109 3300006163 Bacteria 1188
51 Ga0070716_100000361 3300006173 Bacteria 18670
52 Ga0070712_100003999 3300006175 Bacteria 9060
53 Ga0075431_100046964 3300006847 Bacteria 4452
54 Ga0099795_10223910 3300007788 Bacteria 802
55 Ga0111539_10050900 3300009094 Bacteria 4935
56 Ga0114129_10066108 3300009147 Bacteria 5044
57 Ga0105238_10617967 3300009551 Bacteria 1092
58 Ga0157371_10222411 3300013102 Bacteria 1356
59 Ga0157370_10040134 3300013104 Bacteria 4520
60 Ga0157369_10063412 3300013105 Bacteria 3982
61 Ga0157369_10182400 3300013105 Bacteria 2208
62 Ga0157369_10216664 3300013105 Bacteria 2005
63 Ga0157369_10794849 3300013105 Bacteria 972
64 Ga0157369_11683154 3300013105 Bacteria 645
65 Ga0157372_10721173 3300013307 Bacteria 1160
66 Ga0206356_11045189 3300020070 Bacteria 728
67 Ga0206354_10653487 3300020081 Bacteria 767
68 Ga0206353_11257381 3300020082 Bacteria 1325
69 Ga0206353_11841349 3300020082 Bacteria 10952
70 Ga0213875_10000488 3300021388 Bacteria 33637
71 Ga0207692_10000530 3300025898 Bacteria 13545
72 Ga0207685_10217809 3300025905 Bacteria 906
73 Ga0207699_10000626 3300025906 Bacteria 17088
74 Ga0207699_10051754 3300025906 Bacteria 2427
75 Ga0207705_10007513 3300025909 Bacteria 8009
76 Ga0207705_10082508 3300025909 Bacteria 2345
77 Ga0207707_10024106 3300025912 Bacteria 5321
78 Ga0207707_10042189 3300025912 Bacteria 3983
79 Ga0207707_10145091 3300025912 Bacteria 2075
80 Ga0207707_10433236 3300025912 Bacteria 1126
81 Ga0207693_10000680 3300025915 Bacteria 30522
82 Ga0207693_10052932 3300025915 Bacteria 3185
83 Ga0207663_10002913 3300025916 Bacteria 8273
84 Ga0207660_10013558 3300025917 Bacteria 5343
85 Ga0207660_10561068 3300025917 Bacteria 929
86 Ga0207652_10003757 3300025921 Bacteria 12440
87 Ga0207652_10058148 3300025921 Bacteria 3331
88 Ga0207652_10240160 3300025921 Bacteria 1633
89 Ga0207652_10760155 3300025921 Bacteria 862
90 Ga0207700_10000542 3300025928 Bacteria 22105
91 Ga0207700_10006702 3300025928 Bacteria 6989
92 Ga0207700_10010519 3300025928 Bacteria 5844
93 Ga0207700_10059028 3300025928 Bacteria 2900
94 Ga0207700_10420814 3300025928 Bacteria 1173
95 Ga0207700_10595861 3300025928 Bacteria 983
96 Ga0207700_10797447 3300025928 Bacteria 845
97 Ga0207700_10886225 3300025928 Bacteria 798
98 Ga0207664_10000832 3300025929 Bacteria 20952
99 Ga0207664_10047671 3300025929 Bacteria 3367
100 Ga0207664_10180424 3300025929 Bacteria 1812
101 Ga0207664_10750691 3300025929 Bacteria 877
102 Ga0207664_11010183 3300025929 Bacteria 745
103 Ga0207665_10000506 3300025939 Bacteria 26419
104 Ga0207665_10154709 3300025939 Bacteria 1645
105 Ga0207667_10092361 3300025949 Bacteria 3126
106 Ga0207674_10037038 3300026116 Bacteria 5077
107 Ga0207674_10049841 3300026116 Bacteria 4280
108 Ga0265326_10006681 3300028558 Bacteria 3567
109 Ga0265334_10000121 3300028573 Bacteria 50668
110 Ga0265322_10020855 3300028654 Bacteria 1877
111 Ga0265338_10000059 3300028800 Bacteria 198047
112 Ga0265324_10016703 3300029957 Bacteria 2674
113 Ga0265332_10002481 3300031238 Bacteria 9393
114 Ga0265320_10011087 3300031240 Bacteria 5321
115 Ga0265325_10072932 3300031241 Bacteria 1719
116 Ga0265340_10008500 3300031247 Bacteria 5540
117 Ga0265316_10020380 3300031344 Bacteria 5644
118 Ga0265313_10017174 3300031595 Bacteria 4124
119 Ga0265314_10007910 3300031711 Bacteria 9170
120 Ga0265342_10013066 3300031712 Bacteria 5590
121 Ga0307407_10034091 3300031903 Bacteria 2784
122 Ga0307414_10269462 3300032004 Bacteria 1425
123 Ga0373953_0026663 3300035117 Bacteria 2215
124 Ga0373956_0047654 3300035119 Bacteria 1917
125 Ga0373955_0034978 3300035172 Bacteria 2657
126 Ga0373924_0055123 3300035410 Bacteria 1654
127 Ga0373935_0253402 3300035692 Bacteria 1232
128 Ga0373933_0079131 3300035724 Bacteria 2012
129 Ga0373937_0764515 3300036401 Bacteria 913
130 Ga0373937_1148383 3300036401 Bacteria 725
131 Ga0372808_027900 3300036459 Bacteria 811
132 Ga0373925_0000177 3300037068 Bacteria 69605
133 Ga0373925_0565683 3300037068 Bacteria 935
134 Ga0373925_1216450 3300037068 Bacteria 619
135 Ga0395899_0002733 3300037312 Bacteria 14222
136 Ga0395900_0021472 3300037418 Bacteria 6601
137 Ga0395898_0028129 3300037466 Bacteria 5637
138 Ga0395898_0301584 3300037466 Bacteria 1528
139 Ga0436364_0132601 3300037853 Bacteria 24278
140 Ga0436364_1144385 3300037853 Bacteria 877
141 Ga0395901_0102606 3300038443 Bacteria 3002
142 Ga0395901_0330475 3300038443 Bacteria 1576
143 Ga0439442_000201 3300042002 Bacteria 15014
144 Ga0450920_000997 3300042122 Bacteria 4633
145 Ga0466969_0024422 3300044656 Bacteria 3109
146 Ga0466972_0003951 3300044658 Bacteria 7402
147 Ga0466965_0230473 3300044683 Bacteria 989
148 Ga0466966_0011723 3300044684 Bacteria 5812
149 Ga0466966_0081461 3300044684 Bacteria 2015
150 Ga0466961_0001958 3300044693 Bacteria 12837
151 Ga0466961_0010128 3300044693 Bacteria 6005
152 Ga0466961_0546827 3300044693 Bacteria 697
153 Ga0466963_0055404 3300044694 Bacteria 2637
154 Ga0466963_0081242 3300044694 Bacteria 2195
155 Ga0466963_0081581 3300044694 Bacteria 2191
156 Ga0466963_0764809 3300044694 Bacteria 681
157 Ga0466964_0198870 3300044706 Bacteria 961
158 Ga0466971_0134532 3300044719 Bacteria 1149
159 Ga0466968_0046329 3300044735 Bacteria 1847
160 Ga0466970_0031065 3300044765 Bacteria 2820
161 Ga0466970_0150329 3300044765 Bacteria 1285
162 Ga0466957_0653114 3300044842 Bacteria 740
163 Ga0466960_0213949 3300044901 Bacteria 1058
164 Ga0466959_0021350 3300045049 Bacteria 4775
165 Ga0466959_0148572 3300045049 Bacteria 1653
166 Ga0466967_0014270 3300045976 Bacteria 6181
167 Ga0466967_0025657 3300045976 Bacteria 4863
168 Ga0466967_0154197 3300045976 Bacteria 2150
169 Ga0466967_0574201 3300045976 Bacteria 1111
170 Ga0466967_1041800 3300045976 Bacteria 815
171 Ga0495592_0039113 3300046454 Bacteria 3565
172 Ga0495629_0501910 3300046459 Bacteria 818
173 Ga0495651_0061559 3300046462 Bacteria 2872
174 Ga0495653_0186368 3300046463 Bacteria 1419
175 Ga0495662_0138860 3300046476 Bacteria 1196
176 Ga0495608_0027159 3300046511 Bacteria 3896
177 Ga0495628_0174552 3300046516 Bacteria 1628
178 Ga0495652_0132777 3300046529 Bacteria 1968
179 Ga0495665_0075703 3300046531 Bacteria 1772
180 Ga0495640_0182668 3300046533 Bacteria 1336
181 Ga0495586_0117502 3300046535 Bacteria 1484
182 Ga0495587_0044935 3300046536 Bacteria 2626
183 Ga0495645_0038042 3300046543 Bacteria 3509
184 Ga0495667_0067988 3300046559 Bacteria 2327
185 Ga0495634_0017757 3300046642 Bacteria 5072
186 Ga0495635_0067177 3300046663 Bacteria 2459
187 Ga0495657_0040065 3300046675 Bacteria 3215
188 Ga0495657_0616833 3300046675 Bacteria 627
189 Ga0495599_0053903 3300046678 Bacteria 2519
190 Ga0495646_0176602 3300046680 Bacteria 1174
191 Ga0495613_0635890 3300046689 Bacteria 707
192 Ga0495600_0320225 3300046809 Bacteria 975
193 Ga0495581_0098452 3300047315 Bacteria 1699
194 Ga0495674_0057753 3300047319 Bacteria 3395
195 Ga0495684_0052214 3300047471 Bacteria 3119
196 Ga0496109_1067127 3300048912 Bacteria 745
197 Ga0496112_0798274 3300048915 Bacteria 869
198 Ga0496113_0083349 3300048916 Bacteria 2453
199 Ga0496113_0197166 3300048916 Bacteria 1600
200 Ga0496115_0183605 3300048918 Bacteria 1729
201 Ga0496115_0702666 3300048918 Bacteria 795
202 Ga0496118_0220330 3300048921 Bacteria 1105
203 Ga0496126_0099588 3300048929 Bacteria 2545
204 Ga0501047_0000330 3300049581 Bacteria 54438
205 Ga0501047_0601192 3300049581 Bacteria 921
206 nmdc:mga05p37_32818_c1 3300050507 Bacteria 6353
207 nmdc:mga06r32_86650_c1 3300050510 Bacteria 3054
208 nmdc:mga08y16_20793_c1 3300050511 Bacteria 6927
209 nmdc:mga0rr50_38216_c1 3300050513 Bacteria 3472
210 nmdc:mga08x19_77382_c1 3300050514 Bacteria 2179
211 nmdc:mga0a205_6604_c1 3300050515 Bacteria 10494
212 Ga0495612_0056369 3300053078 Bacteria 1622
213 Ga0495612_0059262 3300053078 Bacteria 1583
214 2808898193 2808606371 Bacteria 4251511
215 2939601959 2939598168 Bacteria 4687164
216 2974304415 2974302888 Bacteria 4369871
217 Ga0068856_100616332
218 Ga0070658_10004424
219 Ga0070658_10487367
220 Ga0070683_100175771
221 Ga0070680_100012774
222 Ga0070680_100217776
223 Ga0070680_100426091
224 Ga0070682_100019165
225 Ga0070660_100049654
226 Ga0070709_10002518
227 Ga0070709_10395749
228 Ga0070714_100004308
229 Ga0070714_100188712
230 Ga0070714_100189812
231 Ga0070714_100236482
232 Ga0070714_100274376
233 Ga0070714_100694480
234 Ga0070714_101359617
235 Ga0070713_100003054
236 Ga0070713_100068872
237 Ga0070713_100150648
238 Ga0070713_100390960
239 Ga0070713_100398253
240 Ga0070713_100479150
241 Ga0070713_101058055
242 Ga0070710_10000561
243 Ga0070710_10002458
244 Ga0070711_100002275
245 Ga0070711_100169556
246 Ga0070708_100356621
247 Ga0070681_10011815
248 Ga0070681_10042056
249 Ga0070681_10094751
250 Ga0070698_100000317
251 Ga0070698_100010938
252 Ga0070699_100602002
253 Ga0070679_100008407
254 Ga0070679_100010792
255 Ga0070679_100258964
256 Ga0070679_100723322
257 Ga0070684_100330495
258 Ga0068853_100930994
259 Ga0070665_100584364
260 Ga0068855_100419978
261 Ga0068857_100658738
262 Ga0070717_10010211
263 Ga0070717_10385966
264 Ga0075432_10021935
265 Ga0070715_10017429
266 Ga0070715_10136109
267 Ga0070716_100000361
268 Ga0070712_100003999
269 Ga0075431_100046964
270 Ga0099795_10223910
271 Ga0111539_10050900
272 Ga0114129_10066108
273 Ga0105238_10617967
274 Ga0157371_10222411
275 Ga0157370_10040134
276 Ga0157369_10063412
277 Ga0157369_10182400
278 Ga0157369_10216664
279 Ga0157369_10794849
280 Ga0157369_11683154
281 Ga0157372_10721173
282 Ga0206356_11045189
283 Ga0206354_10653487
284 Ga0206353_11257381
285 Ga0206353_11841349
286 Ga0213875_10000488
287 Ga0207692_10000530
288 Ga0207685_10217809
289 Ga0207699_10000626
290 Ga0207699_10051754
291 Ga0207705_10007513
292 Ga0207705_10082508
293 Ga0207707_10024106
294 Ga0207707_10042189
295 Ga0207707_10145091
296 Ga0207707_10433236
297 Ga0207693_10000680
298 Ga0207693_10052932
299 Ga0207663_10002913
300 Ga0207660_10013558
301 Ga0207660_10561068
302 Ga0207652_10003757
303 Ga0207652_10058148
304 Ga0207652_10240160
305 Ga0207652_10760155
306 Ga0207700_10000542
307 Ga0207700_10006702
308 Ga0207700_10010519
309 Ga0207700_10059028
310 Ga0207700_10420814
311 Ga0207700_10595861
312 Ga0207700_10797447
313 Ga0207700_10886225
314 Ga0207664_10000832
315 Ga0207664_10047671
316 Ga0207664_10180424
317 Ga0207664_10750691
318 Ga0207664_11010183
319 Ga0207665_10000506
320 Ga0207665_10154709
321 Ga0207667_10092361
322 Ga0207674_10037038
323 Ga0207674_10049841
324 Ga0265326_10006681
325 Ga0265334_10000121
326 Ga0265322_10020855
327 Ga0265338_10000059
328 Ga0265324_10016703
329 Ga0265332_10002481
330 Ga0265320_10011087
331 Ga0265325_10072932
332 Ga0265340_10008500
333 Ga0265316_10020380
334 Ga0265313_10017174
335 Ga0265314_10007910
336 Ga0265342_10013066
337 Ga0307407_10034091
338 Ga0307414_10269462
339 Ga0373953_0026663
340 Ga0373956_0047654
341 Ga0373955_0034978
342 Ga0373924_0055123
343 Ga0373935_0253402
344 Ga0373933_0079131
345 Ga0373937_0764515
346 Ga0373937_1148383
347 Ga0372808_027900
348 Ga0373925_0000177
349 Ga0373925_0565683
350 Ga0373925_1216450
351 Ga0395899_0002733
352 Ga0395900_0021472
353 Ga0395898_0028129
354 Ga0395898_0301584
355 Ga0436364_0132601
356 Ga0436364_1144385
357 Ga0395901_0102606
358 Ga0395901_0330475
359 Ga0439442_000201
360 Ga0450920_000997
361 Ga0466969_0024422
362 Ga0466972_0003951
363 Ga0466965_0230473
364 Ga0466966_0011723
365 Ga0466966_0081461
366 Ga0466961_0001958
367 Ga0466961_0010128
368 Ga0466961_0546827
369 Ga0466963_0055404
370 Ga0466963_0081242
371 Ga0466963_0081581
372 Ga0466963_0764809
373 Ga0466964_0198870
374 Ga0466971_0134532
375 Ga0466968_0046329
376 Ga0466970_0031065
377 Ga0466970_0150329
378 Ga0466957_0653114
379 Ga0466960_0213949
380 Ga0466959_0021350
381 Ga0466959_0148572
382 Ga0466967_0014270
383 Ga0466967_0025657
384 Ga0466967_0154197
385 Ga0466967_0574201
386 Ga0466967_1041800
387 Ga0495592_0039113
388 Ga0495629_0501910
389 Ga0495651_0061559
390 Ga0495653_0186368
391 Ga0495662_0138860
392 Ga0495608_0027159
393 Ga0495628_0174552
394 Ga0495652_0132777
395 Ga0495665_0075703
396 Ga0495640_0182668
397 Ga0495586_0117502
398 Ga0495587_0044935
399 Ga0495645_0038042
400 Ga0495667_0067988
401 Ga0495634_0017757
402 Ga0495635_0067177
403 Ga0495657_0040065
404 Ga0495657_0616833
405 Ga0495599_0053903
406 Ga0495646_0176602
407 Ga0495613_0635890
408 Ga0495600_0320225
409 Ga0495581_0098452
410 Ga0495674_0057753
411 Ga0495684_0052214
412 Ga0496109_1067127
413 Ga0496112_0798274
414 Ga0496113_0083349
415 Ga0496113_0197166
416 Ga0496115_0183605
417 Ga0496115_0702666
418 Ga0496118_0220330
419 Ga0496126_0099588
420 Ga0501047_0000330
421 Ga0501047_0601192
422 nmdc:mga05p37_32818_c1
423 nmdc:mga06r32_86650_c1
424 nmdc:mga08y16_20793_c1
425 nmdc:mga0rr50_38216_c1
426 nmdc:mga08x19_77382_c1
427 nmdc:mga0a205_6604_c1
428 Ga0495612_0056369
429 Ga0495612_0059262
430 2808898193
431 2939601959
432 2974304415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

17

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ukj-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.6996 16 64
6w2y-assembly1.cif.gz_B cryoem structure of gabab1b homodimer 0.6972 18 63
1zck-assembly1.cif.gz_A native structure prl-1 (ptp4a1) 0.6886 5 141
5x2q-assembly2.cif.gz_D crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with glycine 0.6875 16 63
6w2y-assembly1.cif.gz_A cryoem structure of gabab1b homodimer 0.6872 18 63
ID Description Score Start End Superfamily
3lzcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 1 0.756 14 65 3.40.50.11840
4mqeA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7054 18 63 3.40.50.2300
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6918 4 143 3.90.190.10
af_Q8IIN1_58_216_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6691 11 141 3.90.190.10
af_O45814_242_435_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6636 19 65 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A1G7GB50-F1-model_v4 DUF488 domain-containing protein 0.9897 4 173
AF-J2JUR5-F1-model_v4 HhH-GPD domain-containing protein 0.9891 19 172
AF-A0A7H8MF84-F1-model_v4 DUF488 domain-containing protein 0.9889 1 172
AF-A0A6G5RLW0-F1-model_v4 DNA repair protein 0.9884 1 172
AF-A0A365GV43-F1-model_v4 DUF488 domain-containing protein 0.9859 2 172

Map