F327384

General Info

Members Datasets Scaffolds Average Seq Length
216 141 214 126

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100958873|Ga0068855_1009588732
Length 130
Sequence MDDEDISLVEEPTKAYNIRHRAYAFAKDTLQVIGAVSYDKVYTSIFEQLVRSATSIGANLVEGTAGASKKDFLKFLIIALKSTNETKYWLCLIRDTINNIEKEKIKELIKEADEISKIVAAIIISTKATT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
129 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
130 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 1.85
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
2 JGI24739J22299_10027236 3300001989 Bacteria 2000
3 JGI24751J29686_10028602 3300002459 Bacteria 1157
4 Ga0065704_10070133 3300005289 Bacteria 1266035
5 Ga0070690_100016610 3300005330 Bacteria 4413
6 Ga0070670_100032098 3300005331 Bacteria 4522
7 Ga0070670_100576922 3300005331 Bacteria 1005
8 Ga0070677_10243897 3300005333 Bacteria 888
9 Ga0068869_100020182 3300005334 Bacteria 4566
10 Ga0070666_10011816 3300005335 Bacteria 5490
11 Ga0070682_100000129 3300005337 Bacteria 64098
12 Ga0068868_100006616 3300005338 Bacteria 8217
13 Ga0070687_101102776 3300005343 Bacteria 581
14 Ga0070661_100262226 3300005344 Bacteria 1336
15 Ga0070668_100036105 3300005347 Bacteria 3771
16 Ga0070671_100022897 3300005355 Bacteria 5106
17 Ga0070671_100180207 3300005355 Bacteria 1788
18 Ga0070671_101843654 3300005355 Bacteria 538
19 Ga0070674_100217349 3300005356 Bacteria 1485
20 Ga0070688_101051590 3300005365 Bacteria 649
21 Ga0070667_100431768 3300005367 Bacteria 1202
22 Ga0070701_11055362 3300005438 Bacteria 570
23 Ga0070678_100003904 3300005456 Bacteria 8381
24 Ga0070678_100025779 3300005456 Bacteria 3963
25 Ga0070678_100440648 3300005456 Bacteria 1139
26 Ga0070678_100482848 3300005456 Bacteria 1091
27 Ga0070662_100888416 3300005457 Bacteria 760
28 Ga0068867_100169489 3300005459 Bacteria 1728
29 Ga0068867_102268513 3300005459 Bacteria 516
30 Ga0070706_100760411 3300005467 Bacteria 898
31 Ga0068853_100109292 3300005539 Bacteria 2454
32 Ga0068853_100205359 3300005539 Bacteria 1794
33 Ga0068853_101568871 3300005539 Bacteria 638
34 Ga0070672_100336936 3300005543 Bacteria 1284
35 Ga0070672_101965916 3300005543 Bacteria 526
36 Ga0070693_100210583 3300005547 Bacteria 1268
37 Ga0068855_100771996 3300005563 Bacteria 1023
38 Ga0068855_100958873 3300005563 Bacteria 901
39 Ga0070664_100345529 3300005564 Bacteria 1352
40 Ga0070664_100533048 3300005564 Bacteria 1085
41 Ga0068857_100126817 3300005577 Bacteria 2300
42 Ga0068857_100864120 3300005577 Bacteria 866
43 Ga0068854_100242214 3300005578 Bacteria 1437
44 Ga0070702_101272354 3300005615 Bacteria 596
45 Ga0068859_100057532 3300005617 Bacteria 3916
46 Ga0068859_100227543 3300005617 Bacteria 1953
47 Ga0068859_101681833 3300005617 Bacteria 701
48 Ga0068864_100056025 3300005618 Bacteria 3406
49 Ga0068866_10398282 3300005718 Bacteria 887
50 Ga0068861_100042263 3300005719 Bacteria 3415
51 Ga0068861_101444652 3300005719 Bacteria 673
52 Ga0068851_10006062 3300005834 Bacteria 5514
53 Ga0068851_10687497 3300005834 Bacteria 629
54 Ga0068870_10255913 3300005840 Bacteria 1087
55 Ga0068870_10635151 3300005840 Bacteria 730
56 Ga0068863_100063235 3300005841 Bacteria 3500
57 Ga0068863_100151773 3300005841 Bacteria 2217
58 Ga0068863_101663675 3300005841 Bacteria 648
59 Ga0068858_100154440 3300005842 Bacteria 2159
60 Ga0068858_102238832 3300005842 Bacteria 540
61 Ga0068862_101800847 3300005844 Bacteria 621
62 Ga0070715_10140901 3300006163 Bacteria 1171
63 Ga0097621_100000611 3300006237 Bacteria 25252
64 Ga0097621_100046326 3300006237 Unclassified 3518
65 Ga0097621_100598510 3300006237 Bacteria 1007
66 Ga0068871_100000634 3300006358 Bacteria 24163
67 Ga0068871_101271632 3300006358 Bacteria 691
68 Ga0068871_102043957 3300006358 Bacteria 545
69 Ga0075434_100409693 3300006871 Bacteria 1377
70 Ga0068865_100224900 3300006881 Bacteria 1469
71 Ga0097620_100057536 3300006931 Bacteria 3916
72 Ga0097620_100227544 3300006931 Bacteria 1953
73 Ga0097620_101681343 3300006931 Bacteria 701
74 Ga0075435_100643463 3300007076 Bacteria 920
75 Ga0075435_101100351 3300007076 Bacteria 695
76 Ga0105245_10323701 3300009098 Bacteria 1519
77 Ga0105247_10471734 3300009101 Bacteria 909
78 Ga0105242_10127674 3300009176 Bacteria 2191
79 Ga0105242_10249179 3300009176 Bacteria 1600
80 Ga0105242_10576135 3300009176 Bacteria 1083
81 Ga0105242_12558348 3300009176 Bacteria 559
82 Ga0105242_12558349 3300009176 Bacteria 559
83 Ga0105248_10051086 3300009177 Bacteria 4639
84 Ga0105249_10000679 3300009553 Bacteria 30951
85 Ga0105249_10018555 3300009553 Bacteria 6193
86 Ga0105249_10219545 3300009553 Bacteria 1870
87 Ga0105249_10392819 3300009553 Bacteria 1416
88 Ga0105249_11073079 3300009553 Bacteria 875
89 Ga0105249_12911450 3300009553 Bacteria 549
90 Ga0105239_10017420 3300010375 Bacteria 7945
91 Ga0105239_11315500 3300010375 Bacteria 834
92 Ga0157371_10105920 3300013102 Bacteria 1995
93 Ga0157371_11300676 3300013102 Unclassified 562
94 Ga0157369_10171993 3300013105 Bacteria 2282
95 Ga0157374_10002410 3300013296 Bacteria 15774
96 Ga0157378_10025398 3300013297 Bacteria 5217
97 Ga0157378_11025558 3300013297 Bacteria 860
98 Ga0157378_12172591 3300013297 Bacteria 606
99 Ga0163162_10000595 3300013306 Bacteria 33576
100 Ga0163162_10002439 3300013306 Bacteria 17530
101 Ga0163162_10168443 3300013306 Bacteria 2314
102 Ga0163162_11353837 3300013306 Bacteria 809
103 Ga0163162_13139536 3300013306 Bacteria 530
104 Ga0157372_10012017 3300013307 Bacteria 9219
105 Ga0157372_10265639 3300013307 Bacteria 1993
106 Ga0157372_10308319 3300013307 Bacteria 1842
107 Ga0157372_10331873 3300013307 Bacteria 1771
108 Ga0157372_10610797 3300013307 Bacteria 1271
109 Ga0157372_12611363 3300013307 Bacteria 580
110 Ga0157375_10000614 3300013308 Bacteria 31619
111 Ga0157375_10005435 3300013308 Bacteria 11076
112 Ga0163163_10894450 3300014325 Bacteria 951
113 Ga0163163_10908187 3300014325 Unclassified 944
114 Ga0157380_10574835 3300014326 Bacteria 1110
115 Ga0157377_11321410 3300014745 Bacteria 565
116 Ga0157377_11615362 3300014745 Bacteria 520
117 Ga0157379_10050247 3300014968 Bacteria 3722
118 Ga0157376_10024787 3300014969 Bacteria 4716
119 Ga0157376_10104550 3300014969 Bacteria 2481
120 Ga0157376_10153346 3300014969 Bacteria 2080
121 Ga0157376_12905679 3300014969 Bacteria 519
122 Ga0163161_10000968 3300017792 Bacteria 21949
123 Ga0163161_10605062 3300017792 Bacteria 904
124 Ga0213876_10004817 3300021384 Bacteria 7489
125 Ga0213876_10084357 3300021384 Bacteria 1681
126 Ga0209437_100102 3300025233 Bacteria 224216
127 Ga0207656_10002981 3300025321 Bacteria 5783
128 Ga0207710_10571103 3300025900 Unclassified 590
129 Ga0207680_10253454 3300025903 Bacteria 1216
130 Ga0207680_10324548 3300025903 Bacteria 1077
131 Ga0207685_10073281 3300025905 Bacteria 1395
132 Ga0207643_10314342 3300025908 Bacteria 977
133 Ga0207695_10082084 3300025913 Bacteria 3260
134 Ga0207662_10435822 3300025918 Bacteria 894
135 Ga0207650_10128202 3300025925 Bacteria 1983
136 Ga0207659_10165215 3300025926 Bacteria 1741
137 Ga0207644_10142070 3300025931 Bacteria 1849
138 Ga0207706_10010295 3300025933 Bacteria 8551
139 Ga0207686_10045182 3300025934 Bacteria 2709
140 Ga0207686_10154934 3300025934 Bacteria 1599
141 Ga0207686_10353045 3300025934 Bacteria 1108
142 Ga0207686_10630670 3300025934 Bacteria 846
143 Ga0207704_10823605 3300025938 Bacteria 776
144 Ga0207691_11067360 3300025940 Bacteria 672
145 Ga0207711_10056409 3300025941 Bacteria 3376
146 Ga0207689_10025266 3300025942 Bacteria 4977
147 Ga0207689_10109636 3300025942 Bacteria 2268
148 Ga0207689_10284514 3300025942 Bacteria 1369
149 Ga0207661_11508759 3300025944 Bacteria 616
150 Ga0207679_10088461 3300025945 Bacteria 2388
151 Ga0207679_10554115 3300025945 Bacteria 1032
152 Ga0207712_10413280 3300025961 Bacteria 1137
153 Ga0207668_10254815 3300025972 Bacteria 1427
154 Ga0207677_11395927 3300026023 Bacteria 645
155 Ga0207703_10126536 3300026035 Bacteria 2201
156 Ga0207639_10128320 3300026041 Bacteria 2095
157 Ga0207639_10475849 3300026041 Bacteria 1138
158 Ga0207639_11218485 3300026041 Bacteria 706
159 Ga0207708_10240636 3300026075 Bacteria 1456
160 Ga0207641_10012106 3300026088 Bacteria 7076
161 Ga0207648_10250447 3300026089 Bacteria 1579
162 Ga0207648_10258512 3300026089 Bacteria 1553
163 Ga0207648_10486013 3300026089 Bacteria 1128
164 Ga0207676_10340058 3300026095 Bacteria 1384
165 Ga0207674_10142389 3300026116 Bacteria 2357
166 Ga0207675_100119273 3300026118 Bacteria 2495
167 Ga0207675_102322738 3300026118 Bacteria 550
168 Ga0207683_10026793 3300026121 Bacteria 4979
169 Ga0207683_10028008 3300026121 Bacteria 4870
170 Ga0207683_10688302 3300026121 Bacteria 948
171 Ga0268264_12351975 3300028381 Bacteria 539
172 Ga0307508_10922127 3300031616 Bacteria 502
173 Ga0265314_10050019 3300031711 Bacteria 2922
174 Ga0307413_11586744 3300031824 Unclassified 581
175 Ga0307416_101538116 3300032002 Bacteria 771
176 Ga0307416_101638027 3300032002 Unclassified 749
177 Ga0307414_10811338 3300032004 Bacteria 854
178 Ga0436365_0218149 3300039437 Unclassified 524
179 Ga0436365_1188598 3300039437 Bacteria 793
180 Ga0436365_1740763 3300039437 Bacteria 18760
181 Ga0439441_017659 3300042001 Bacteria 1283
182 Ga0451577_0268463 3300042876 Bacteria 1545
183 Ga0495668_0480808 3300046616 Bacteria 684
184 Ga0495686_0000814 3300047472 Bacteria 40340
185 Ga0496100_0031379 3300048903 Bacteria 3304
186 Ga0496104_0096952 3300048907 Bacteria 2822
187 Ga0496105_0444061 3300048908 Bacteria 1025
188 Ga0496115_1283431 3300048918 Bacteria 546
189 Ga0501032_0042193 3300049569 Bacteria 3095
190 Ga0501034_0290695 3300049571 Bacteria 1572
191 Ga0501036_0990709 3300049572 Bacteria 688
192 Ga0501039_0319787 3300049575 Bacteria 1220
193 Ga0501043_0042766 3300049579 Bacteria 3560
194 Ga0501046_0033569 3300049580 Bacteria 4144
195 Ga0501047_0043636 3300049581 Bacteria 4331
196 Ga0501048_0024802 3300049582 Bacteria 4374
197 Ga0501073_0008853 3300049589 Bacteria 7443
198 Ga0501074_0018342 3300049590 Bacteria 5082
199 Ga0501198_045697 3300049649 Unclassified 769
200 Ga0501217_048438 3300049661 Unclassified 1103
201 Ga0501223_029847 3300049663 Unclassified 1061
202 Ga0501242_002161 3300049674 Bacteria 2053
203 Ga0501257_018823 3300049686 Bacteria 1613
204 Ga0501225_0018351 3300049705 Bacteria 1939
205 Ga0501083_0292063 3300049744 Bacteria 1060
206 Ga0501263_005378 3300049760 Bacteria 1444
207 Ga0501035_0241504 3300049822 Bacteria 1536
208 Ga0501044_0001663 3300049823 Bacteria 26095
209 nmdc:mga0n895_134080_c1 3300050512 Bacteria 2502
210 nmdc:mga0rr50_1502660_c1 3300050513 Bacteria 569
211 Ga0500573_0474507 3300053140 Unclassified 572
212 Ga0500616_0118109 3300053153 Bacteria 1271
213 Ga0500622_0000568 3300053156 Bacteria 33817
214 Ga0501084_0260588 3300054114 Bacteria 1464

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_102322738 Ga0207675_1023227382 101
2 3300021384 Ga0213876_10084357 Ga0213876_100843572 113
3 3300039437 Ga0436365_1188598 Ga0436365_1188598_193_564 113
4 3300013297 Ga0157378_11025558 Ga0157378_110255582 115
5 3300005842 Ga0068858_100154440 Ga0068858_1001544402 116
6 3300009553 Ga0105249_10219545 Ga0105249_102195452 116
7 3300010375 Ga0105239_10017420 Ga0105239_100174207 116
8 3300013306 Ga0163162_10168443 Ga0163162_101684431 116
9 3300025233 Ga0209437_100102 Ga0209437_100102148 116
10 3300025913 Ga0207695_10082084 Ga0207695_100820842 116
11 3300026035 Ga0207703_10126536 Ga0207703_101265362 116
12 3300046616 Ga0495668_0480808 Ga0495668_0480808_154_513 116
13 3300053140 Ga0500573_0474507 Ga0500573_0474507_57_416 116
14 3300002459 JGI24751J29686_10028602 JGI24751J29686_100286022 117
15 3300005330 Ga0070690_100016610 Ga0070690_1000166103 117
16 3300005331 Ga0070670_100032098 Ga0070670_1000320983 117
17 3300005331 Ga0070670_100576922 Ga0070670_1005769222 117
18 3300005333 Ga0070677_10243897 Ga0070677_102438972 117
19 3300005334 Ga0068869_100020182 Ga0068869_1000201824 117
20 3300005335 Ga0070666_10011816 Ga0070666_100118161 117
21 3300005337 Ga0070682_100000129 Ga0070682_10000012912 117
22 3300005338 Ga0068868_100006616 Ga0068868_1000066168 117
23 3300005344 Ga0070661_100262226 Ga0070661_1002622262 117
24 3300005355 Ga0070671_100180207 Ga0070671_1001802072 117
25 3300005365 Ga0070688_101051590 Ga0070688_1010515902 117
26 3300005367 Ga0070667_100431768 Ga0070667_1004317682 117
27 3300005456 Ga0070678_100003904 Ga0070678_10000390410 117
28 3300005539 Ga0068853_100109292 Ga0068853_1001092922 117
29 3300005539 Ga0068853_100205359 Ga0068853_1002053592 117
30 3300005547 Ga0070693_100210583 Ga0070693_1002105832 117
31 3300005564 Ga0070664_100345529 Ga0070664_1003455292 117
32 3300005564 Ga0070664_100533048 Ga0070664_1005330482 117
33 3300005577 Ga0068857_100126817 Ga0068857_1001268172 117
34 3300005615 Ga0070702_101272354 Ga0070702_1012723541 117
35 3300005618 Ga0068864_100056025 Ga0068864_1000560252 117
36 3300005719 Ga0068861_101444652 Ga0068861_1014446522 117
37 3300005834 Ga0068851_10006062 Ga0068851_100060627 117
38 3300005834 Ga0068851_10687497 Ga0068851_106874972 117
39 3300005841 Ga0068863_100151773 Ga0068863_1001517732 117
40 3300006237 Ga0097621_100046326 Ga0097621_1000463263 117
41 3300006358 Ga0068871_101271632 Ga0068871_1012716322 117
42 3300006881 Ga0068865_100224900 Ga0068865_1002249002 117
43 3300007076 Ga0075435_100643463 Ga0075435_1006434631 117
44 3300007076 Ga0075435_101100351 Ga0075435_1011003512 117
45 3300009098 Ga0105245_10323701 Ga0105245_103237013 117
46 3300009176 Ga0105242_10576135 Ga0105242_105761352 117
47 3300009553 Ga0105249_10018555 Ga0105249_100185552 117
48 3300013296 Ga0157374_10002410 Ga0157374_1000241015 117
49 3300013306 Ga0163162_11353837 Ga0163162_113538372 117
50 3300013308 Ga0157375_10005435 Ga0157375_1000543514 117
51 3300014325 Ga0163163_10894450 Ga0163163_108944502 117
52 3300014969 Ga0157376_10104550 Ga0157376_101045501 117
53 3300014969 Ga0157376_10153346 Ga0157376_101533463 117
54 3300025321 Ga0207656_10002981 Ga0207656_100029812 117
55 3300025903 Ga0207680_10253454 Ga0207680_102534542 117
56 3300025925 Ga0207650_10128202 Ga0207650_101282022 117
57 3300025934 Ga0207686_10045182 Ga0207686_100451823 117
58 3300025942 Ga0207689_10025266 Ga0207689_100252663 117
59 3300025944 Ga0207661_11508759 Ga0207661_115087592 117
60 3300025945 Ga0207679_10088461 Ga0207679_100884612 117
61 3300025945 Ga0207679_10554115 Ga0207679_105541152 117
62 3300026023 Ga0207677_11395927 Ga0207677_113959272 117
63 3300026041 Ga0207639_10128320 Ga0207639_101283202 117
64 3300026041 Ga0207639_11218485 Ga0207639_112184852 117
65 3300026089 Ga0207648_10486013 Ga0207648_104860131 117
66 3300026095 Ga0207676_10340058 Ga0207676_103400582 117
67 3300026116 Ga0207674_10142389 Ga0207674_101423892 117
68 3300026121 Ga0207683_10026793 Ga0207683_100267934 117
69 3300028381 Ga0268264_12351975 Ga0268264_123519751 117
70 3300032004 Ga0307414_10811338 Ga0307414_108113382 117
71 3300049649 Ga0501198_045697 Ga0501198_045697_83_463 117
72 3300049661 Ga0501217_048438 Ga0501217_048438_300_680 117
73 3300049663 Ga0501223_029847 Ga0501223_029847_305_685 117
74 3300049674 Ga0501242_002161 Ga0501242_002161_1130_1510 117
75 3300049686 Ga0501257_018823 Ga0501257_018823_41_421 117
76 3300049705 Ga0501225_0018351 Ga0501225_0018351_1158_1538 117
77 3300049760 Ga0501263_005378 Ga0501263_005378_755_1135 117
78 3300050513 nmdc:mga0rr50_1502660_c1 nmdc:mga0rr50_1502660_c1_55_435 117
79 3300053153 Ga0500616_0118109 Ga0500616_0118109_516_902 117
80 3300005355 Ga0070671_100022897 Ga0070671_1000228975 118
81 3300005456 Ga0070678_100440648 Ga0070678_1004406482 118
82 3300005459 Ga0068867_100169489 Ga0068867_1001694892 118
83 3300005563 Ga0068855_100771996 Ga0068855_1007719961 118
84 3300005718 Ga0068866_10398282 Ga0068866_103982822 118
85 3300005841 Ga0068863_100063235 Ga0068863_1000632355 118
86 3300006163 Ga0070715_10140901 Ga0070715_101409012 118
87 3300006237 Ga0097621_100000611 Ga0097621_1000006118 118
88 3300006358 Ga0068871_100000634 Ga0068871_1000006345 118
89 3300009101 Ga0105247_10471734 Ga0105247_104717341 118
90 3300009176 Ga0105242_10249179 Ga0105242_102491792 118
91 3300009177 Ga0105248_10051086 Ga0105248_100510865 118
92 3300009553 Ga0105249_10000679 Ga0105249_1000067937 118
93 3300009553 Ga0105249_11073079 Ga0105249_110730791 118
94 3300013102 Ga0157371_11300676 Ga0157371_113006761 118
95 3300013297 Ga0157378_10025398 Ga0157378_100253985 118
96 3300013306 Ga0163162_10000595 Ga0163162_1000059521 118
97 3300013306 Ga0163162_10002439 Ga0163162_1000243916 118
98 3300013307 Ga0157372_10308319 Ga0157372_103083193 118
99 3300013307 Ga0157372_10331873 Ga0157372_103318732 118
100 3300013307 Ga0157372_12611363 Ga0157372_126113632 118
101 3300013308 Ga0157375_10000614 Ga0157375_1000061418 118
102 3300014968 Ga0157379_10050247 Ga0157379_100502472 118
103 3300014969 Ga0157376_10024787 Ga0157376_100247875 118
104 3300017792 Ga0163161_10000968 Ga0163161_1000096824 118
105 3300025900 Ga0207710_10571103 Ga0207710_105711031 118
106 3300025903 Ga0207680_10324548 Ga0207680_103245481 118
107 3300025905 Ga0207685_10073281 Ga0207685_100732812 118
108 3300025931 Ga0207644_10142070 Ga0207644_101420701 118
109 3300025934 Ga0207686_10353045 Ga0207686_103530452 118
110 3300025938 Ga0207704_10823605 Ga0207704_108236051 118
111 3300025941 Ga0207711_10056409 Ga0207711_100564092 118
112 3300025961 Ga0207712_10413280 Ga0207712_104132802 118
113 3300026088 Ga0207641_10012106 Ga0207641_100121067 118
114 3300026089 Ga0207648_10250447 Ga0207648_102504472 118
115 3300039437 Ga0436365_0218149 Ga0436365_0218149_42_431 118
116 3300042876 Ga0451577_0268463 Ga0451577_0268463_241_609 118
117 3300047472 Ga0495686_0000814 Ga0495686_0000814_11252_11635 118
118 3300048903 Ga0496100_0031379 Ga0496100_0031379_1403_1780 118
119 3300048907 Ga0496104_0096952 Ga0496104_0096952_926_1288 118
120 3300048908 Ga0496105_0444061 Ga0496105_0444061_420_797 118
121 3300053156 Ga0500622_0000568 Ga0500622_0000568_30666_31040 118
122 iso_pu_bacteria 2881955468 2881956896 118
123 iso_pu_bacteria 2929154850 2929158425 118
124 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00002130 119
125 3300001989 JGI24739J22299_10027236 JGI24739J22299_100272362 119
126 3300005289 Ga0065704_10070133 Ga0065704_10070133276 119
127 3300005343 Ga0070687_101102776 Ga0070687_1011027761 119
128 3300005347 Ga0070668_100036105 Ga0070668_1000361052 119
129 3300005355 Ga0070671_101843654 Ga0070671_1018436541 119
130 3300005356 Ga0070674_100217349 Ga0070674_1002173492 119
131 3300005438 Ga0070701_11055362 Ga0070701_110553621 119
132 3300005456 Ga0070678_100025779 Ga0070678_1000257794 119
133 3300005456 Ga0070678_100482848 Ga0070678_1004828481 119
134 3300005457 Ga0070662_100888416 Ga0070662_1008884162 119
135 3300005459 Ga0068867_102268513 Ga0068867_1022685131 119
136 3300005467 Ga0070706_100760411 Ga0070706_1007604111 119
137 3300005539 Ga0068853_101568871 Ga0068853_1015688712 119
138 3300005543 Ga0070672_100336936 Ga0070672_1003369362 119
139 3300005543 Ga0070672_101965916 Ga0070672_1019659161 119
140 3300005563 Ga0068855_100958873 Ga0068855_1009588732 119
141 3300005577 Ga0068857_100864120 Ga0068857_1008641202 119
142 3300005578 Ga0068854_100242214 Ga0068854_1002422142 119
143 3300005617 Ga0068859_100057532 Ga0068859_1000575323 119
144 3300005617 Ga0068859_100227543 Ga0068859_1002275432 119
145 3300005617 Ga0068859_101681833 Ga0068859_1016818332 119
146 3300005719 Ga0068861_100042263 Ga0068861_1000422635 119
147 3300005840 Ga0068870_10255913 Ga0068870_102559131 119
148 3300005840 Ga0068870_10635151 Ga0068870_106351512 119
149 3300005841 Ga0068863_101663675 Ga0068863_1016636752 119
150 3300005842 Ga0068858_102238832 Ga0068858_1022388321 119
151 3300005844 Ga0068862_101800847 Ga0068862_1018008471 119
152 3300006237 Ga0097621_100598510 Ga0097621_1005985102 119
153 3300006358 Ga0068871_102043957 Ga0068871_1020439571 119
154 3300006871 Ga0075434_100409693 Ga0075434_1004096932 119
155 3300006931 Ga0097620_100057536 Ga0097620_1000575363 119
156 3300006931 Ga0097620_100227544 Ga0097620_1002275442 119
157 3300006931 Ga0097620_101681343 Ga0097620_1016813432 119
158 3300009176 Ga0105242_10127674 Ga0105242_101276742 119
159 3300009176 Ga0105242_12558348 Ga0105242_125583482 119
160 3300009176 Ga0105242_12558349 Ga0105242_125583492 119
161 3300009553 Ga0105249_10392819 Ga0105249_103928192 119
162 3300009553 Ga0105249_12911450 Ga0105249_129114502 119
163 3300010375 Ga0105239_11315500 Ga0105239_113155002 119
164 3300013102 Ga0157371_10105920 Ga0157371_101059202 119
165 3300013105 Ga0157369_10171993 Ga0157369_101719932 119
166 3300013297 Ga0157378_12172591 Ga0157378_121725912 119
167 3300013306 Ga0163162_13139536 Ga0163162_131395361 119
168 3300013307 Ga0157372_10012017 Ga0157372_100120177 119
169 3300013307 Ga0157372_10265639 Ga0157372_102656392 119
170 3300013307 Ga0157372_10610797 Ga0157372_106107972 119
171 3300014325 Ga0163163_10908187 Ga0163163_109081872 119
172 3300014326 Ga0157380_10574835 Ga0157380_105748352 119
173 3300014745 Ga0157377_11321410 Ga0157377_113214101 119
174 3300014745 Ga0157377_11615362 Ga0157377_116153621 119
175 3300014969 Ga0157376_12905679 Ga0157376_129056791 119
176 3300017792 Ga0163161_10605062 Ga0163161_106050622 119
177 3300021384 Ga0213876_10004817 Ga0213876_100048172 119
178 3300025908 Ga0207643_10314342 Ga0207643_103143422 119
179 3300025918 Ga0207662_10435822 Ga0207662_104358221 119
180 3300025926 Ga0207659_10165215 Ga0207659_101652152 119
181 3300025933 Ga0207706_10010295 Ga0207706_100102959 119
182 3300025934 Ga0207686_10154934 Ga0207686_101549342 119
183 3300025934 Ga0207686_10630670 Ga0207686_106306702 119
184 3300025940 Ga0207691_11067360 Ga0207691_110673602 119
185 3300025942 Ga0207689_10109636 Ga0207689_101096362 119
186 3300025942 Ga0207689_10284514 Ga0207689_102845142 119
187 3300025972 Ga0207668_10254815 Ga0207668_102548152 119
188 3300026041 Ga0207639_10475849 Ga0207639_104758492 119
189 3300026075 Ga0207708_10240636 Ga0207708_102406362 119
190 3300026089 Ga0207648_10258512 Ga0207648_102585122 119
191 3300026118 Ga0207675_100119273 Ga0207675_1001192733 119
192 3300026121 Ga0207683_10028008 Ga0207683_100280083 119
193 3300026121 Ga0207683_10688302 Ga0207683_106883021 119
194 3300031616 Ga0307508_10922127 Ga0307508_109221271 119
195 3300031711 Ga0265314_10050019 Ga0265314_100500195 119
196 3300031824 Ga0307413_11586744 Ga0307413_115867441 119
197 3300032002 Ga0307416_101538116 Ga0307416_1015381161 119
198 3300032002 Ga0307416_101638027 Ga0307416_1016380271 119
199 3300039437 Ga0436365_1740763 Ga0436365_1740763_6835_7215 119
200 3300042001 Ga0439441_017659 Ga0439441_017659_429_926 119
201 3300048918 Ga0496115_1283431 Ga0496115_1283431_97_474 119
202 3300049569 Ga0501032_0042193 Ga0501032_0042193_341_736 119
203 3300049571 Ga0501034_0290695 Ga0501034_0290695_854_1249 119
204 3300049572 Ga0501036_0990709 Ga0501036_0990709_38_433 119
205 3300049575 Ga0501039_0319787 Ga0501039_0319787_196_591 119
206 3300049579 Ga0501043_0042766 Ga0501043_0042766_1007_1402 119
207 3300049580 Ga0501046_0033569 Ga0501046_0033569_489_884 119
208 3300049581 Ga0501047_0043636 Ga0501047_0043636_3331_3726 119
209 3300049582 Ga0501048_0024802 Ga0501048_0024802_159_554 119
210 3300049589 Ga0501073_0008853 Ga0501073_0008853_6284_6679 119
211 3300049590 Ga0501074_0018342 Ga0501074_0018342_4357_4752 119
212 3300049744 Ga0501083_0292063 Ga0501083_0292063_266_661 119
213 3300049822 Ga0501035_0241504 Ga0501035_0241504_639_1034 119
214 3300049823 Ga0501044_0001663 Ga0501044_0001663_9916_10311 119
215 3300050512 nmdc:mga0n895_134080_c1 nmdc:mga0n895_134080_c1_1361_1753 119
216 3300054114 Ga0501084_0260588 Ga0501084_0260588_491_886 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

14

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.931 35 85
6sv1-assembly1.cif.gz_B crystal structure of rhodospirillum rubrum rru_a0973 e34a variant 0.9252 33 86
6suw-assembly1.cif.gz_D crystal structure of rhodospirillum rubrum rru_a0973 e31a variant 0.9251 33 86
6suw-assembly2.cif.gz_R crystal structure of rhodospirillum rubrum rru_a0973 e31a variant 0.9244 33 86
5l89-assembly3.cif.gz_U crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a 0.9228 33 86
ID Description Score Start End Superfamily
af_X1WEV5_108_185_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9424 59 118 1.10.287.660
5l8gG00 Special;Helix non-globular;Helix Hairpins; 0.9331 33 86 6.10.140.1960
5l8gO00 Special;Helix non-globular;Helix Hairpins; 0.9313 33 86 6.10.140.1960
5l89M00 Special;Helix non-globular;Helix Hairpins; 0.9291 33 86 6.10.140.1960
5l8bL00 Special;Helix non-globular;Helix Hairpins; 0.9249 33 86 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A7V0UJT4-F1-model_v4 Four helix bundle protein 0.9661 8 117
AF-A0A554MNA0-F1-model_v4 S23 ribosomal protein 0.966 8 117 GO:0005840
AF-A0A2H5W476-F1-model_v4 Four helix bundle protein 0.9655 10 118
AF-A0A2E2NZZ6-F1-model_v4 Four helix bundle protein 0.9651 8 115
AF-A0A4Q3EQM9-F1-model_v4 Four helix bundle protein 0.9633 4 117

Feature Viewer

pLDDT pTM Quality
93.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map