F327384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 141 | 214 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100958873|Ga0068855_1009588732 |
| Length | 130 |
| Sequence | MDDEDISLVEEPTKAYNIRHRAYAFAKDTLQVIGAVSYDKVYTSIFEQLVRSATSIGANLVEGTAGASKKDFLKFLIIALKSTNETKYWLCLIRDTINNIEKEKIKELIKEADEISKIVAAIIISTKATT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 3 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 114 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 127 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 128 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 129 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 130 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 131 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 132 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 134 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 139 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 140 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 141 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 93.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_677025 | 2162886007 | Bacteria | 181955 |
| 2 | JGI24739J22299_10027236 | 3300001989 | Bacteria | 2000 |
| 3 | JGI24751J29686_10028602 | 3300002459 | Bacteria | 1157 |
| 4 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 5 | Ga0070690_100016610 | 3300005330 | Bacteria | 4413 |
| 6 | Ga0070670_100032098 | 3300005331 | Bacteria | 4522 |
| 7 | Ga0070670_100576922 | 3300005331 | Bacteria | 1005 |
| 8 | Ga0070677_10243897 | 3300005333 | Bacteria | 888 |
| 9 | Ga0068869_100020182 | 3300005334 | Bacteria | 4566 |
| 10 | Ga0070666_10011816 | 3300005335 | Bacteria | 5490 |
| 11 | Ga0070682_100000129 | 3300005337 | Bacteria | 64098 |
| 12 | Ga0068868_100006616 | 3300005338 | Bacteria | 8217 |
| 13 | Ga0070687_101102776 | 3300005343 | Bacteria | 581 |
| 14 | Ga0070661_100262226 | 3300005344 | Bacteria | 1336 |
| 15 | Ga0070668_100036105 | 3300005347 | Bacteria | 3771 |
| 16 | Ga0070671_100022897 | 3300005355 | Bacteria | 5106 |
| 17 | Ga0070671_100180207 | 3300005355 | Bacteria | 1788 |
| 18 | Ga0070671_101843654 | 3300005355 | Bacteria | 538 |
| 19 | Ga0070674_100217349 | 3300005356 | Bacteria | 1485 |
| 20 | Ga0070688_101051590 | 3300005365 | Bacteria | 649 |
| 21 | Ga0070667_100431768 | 3300005367 | Bacteria | 1202 |
| 22 | Ga0070701_11055362 | 3300005438 | Bacteria | 570 |
| 23 | Ga0070678_100003904 | 3300005456 | Bacteria | 8381 |
| 24 | Ga0070678_100025779 | 3300005456 | Bacteria | 3963 |
| 25 | Ga0070678_100440648 | 3300005456 | Bacteria | 1139 |
| 26 | Ga0070678_100482848 | 3300005456 | Bacteria | 1091 |
| 27 | Ga0070662_100888416 | 3300005457 | Bacteria | 760 |
| 28 | Ga0068867_100169489 | 3300005459 | Bacteria | 1728 |
| 29 | Ga0068867_102268513 | 3300005459 | Bacteria | 516 |
| 30 | Ga0070706_100760411 | 3300005467 | Bacteria | 898 |
| 31 | Ga0068853_100109292 | 3300005539 | Bacteria | 2454 |
| 32 | Ga0068853_100205359 | 3300005539 | Bacteria | 1794 |
| 33 | Ga0068853_101568871 | 3300005539 | Bacteria | 638 |
| 34 | Ga0070672_100336936 | 3300005543 | Bacteria | 1284 |
| 35 | Ga0070672_101965916 | 3300005543 | Bacteria | 526 |
| 36 | Ga0070693_100210583 | 3300005547 | Bacteria | 1268 |
| 37 | Ga0068855_100771996 | 3300005563 | Bacteria | 1023 |
| 38 | Ga0068855_100958873 | 3300005563 | Bacteria | 901 |
| 39 | Ga0070664_100345529 | 3300005564 | Bacteria | 1352 |
| 40 | Ga0070664_100533048 | 3300005564 | Bacteria | 1085 |
| 41 | Ga0068857_100126817 | 3300005577 | Bacteria | 2300 |
| 42 | Ga0068857_100864120 | 3300005577 | Bacteria | 866 |
| 43 | Ga0068854_100242214 | 3300005578 | Bacteria | 1437 |
| 44 | Ga0070702_101272354 | 3300005615 | Bacteria | 596 |
| 45 | Ga0068859_100057532 | 3300005617 | Bacteria | 3916 |
| 46 | Ga0068859_100227543 | 3300005617 | Bacteria | 1953 |
| 47 | Ga0068859_101681833 | 3300005617 | Bacteria | 701 |
| 48 | Ga0068864_100056025 | 3300005618 | Bacteria | 3406 |
| 49 | Ga0068866_10398282 | 3300005718 | Bacteria | 887 |
| 50 | Ga0068861_100042263 | 3300005719 | Bacteria | 3415 |
| 51 | Ga0068861_101444652 | 3300005719 | Bacteria | 673 |
| 52 | Ga0068851_10006062 | 3300005834 | Bacteria | 5514 |
| 53 | Ga0068851_10687497 | 3300005834 | Bacteria | 629 |
| 54 | Ga0068870_10255913 | 3300005840 | Bacteria | 1087 |
| 55 | Ga0068870_10635151 | 3300005840 | Bacteria | 730 |
| 56 | Ga0068863_100063235 | 3300005841 | Bacteria | 3500 |
| 57 | Ga0068863_100151773 | 3300005841 | Bacteria | 2217 |
| 58 | Ga0068863_101663675 | 3300005841 | Bacteria | 648 |
| 59 | Ga0068858_100154440 | 3300005842 | Bacteria | 2159 |
| 60 | Ga0068858_102238832 | 3300005842 | Bacteria | 540 |
| 61 | Ga0068862_101800847 | 3300005844 | Bacteria | 621 |
| 62 | Ga0070715_10140901 | 3300006163 | Bacteria | 1171 |
| 63 | Ga0097621_100000611 | 3300006237 | Bacteria | 25252 |
| 64 | Ga0097621_100046326 | 3300006237 | Unclassified | 3518 |
| 65 | Ga0097621_100598510 | 3300006237 | Bacteria | 1007 |
| 66 | Ga0068871_100000634 | 3300006358 | Bacteria | 24163 |
| 67 | Ga0068871_101271632 | 3300006358 | Bacteria | 691 |
| 68 | Ga0068871_102043957 | 3300006358 | Bacteria | 545 |
| 69 | Ga0075434_100409693 | 3300006871 | Bacteria | 1377 |
| 70 | Ga0068865_100224900 | 3300006881 | Bacteria | 1469 |
| 71 | Ga0097620_100057536 | 3300006931 | Bacteria | 3916 |
| 72 | Ga0097620_100227544 | 3300006931 | Bacteria | 1953 |
| 73 | Ga0097620_101681343 | 3300006931 | Bacteria | 701 |
| 74 | Ga0075435_100643463 | 3300007076 | Bacteria | 920 |
| 75 | Ga0075435_101100351 | 3300007076 | Bacteria | 695 |
| 76 | Ga0105245_10323701 | 3300009098 | Bacteria | 1519 |
| 77 | Ga0105247_10471734 | 3300009101 | Bacteria | 909 |
| 78 | Ga0105242_10127674 | 3300009176 | Bacteria | 2191 |
| 79 | Ga0105242_10249179 | 3300009176 | Bacteria | 1600 |
| 80 | Ga0105242_10576135 | 3300009176 | Bacteria | 1083 |
| 81 | Ga0105242_12558348 | 3300009176 | Bacteria | 559 |
| 82 | Ga0105242_12558349 | 3300009176 | Bacteria | 559 |
| 83 | Ga0105248_10051086 | 3300009177 | Bacteria | 4639 |
| 84 | Ga0105249_10000679 | 3300009553 | Bacteria | 30951 |
| 85 | Ga0105249_10018555 | 3300009553 | Bacteria | 6193 |
| 86 | Ga0105249_10219545 | 3300009553 | Bacteria | 1870 |
| 87 | Ga0105249_10392819 | 3300009553 | Bacteria | 1416 |
| 88 | Ga0105249_11073079 | 3300009553 | Bacteria | 875 |
| 89 | Ga0105249_12911450 | 3300009553 | Bacteria | 549 |
| 90 | Ga0105239_10017420 | 3300010375 | Bacteria | 7945 |
| 91 | Ga0105239_11315500 | 3300010375 | Bacteria | 834 |
| 92 | Ga0157371_10105920 | 3300013102 | Bacteria | 1995 |
| 93 | Ga0157371_11300676 | 3300013102 | Unclassified | 562 |
| 94 | Ga0157369_10171993 | 3300013105 | Bacteria | 2282 |
| 95 | Ga0157374_10002410 | 3300013296 | Bacteria | 15774 |
| 96 | Ga0157378_10025398 | 3300013297 | Bacteria | 5217 |
| 97 | Ga0157378_11025558 | 3300013297 | Bacteria | 860 |
| 98 | Ga0157378_12172591 | 3300013297 | Bacteria | 606 |
| 99 | Ga0163162_10000595 | 3300013306 | Bacteria | 33576 |
| 100 | Ga0163162_10002439 | 3300013306 | Bacteria | 17530 |
| 101 | Ga0163162_10168443 | 3300013306 | Bacteria | 2314 |
| 102 | Ga0163162_11353837 | 3300013306 | Bacteria | 809 |
| 103 | Ga0163162_13139536 | 3300013306 | Bacteria | 530 |
| 104 | Ga0157372_10012017 | 3300013307 | Bacteria | 9219 |
| 105 | Ga0157372_10265639 | 3300013307 | Bacteria | 1993 |
| 106 | Ga0157372_10308319 | 3300013307 | Bacteria | 1842 |
| 107 | Ga0157372_10331873 | 3300013307 | Bacteria | 1771 |
| 108 | Ga0157372_10610797 | 3300013307 | Bacteria | 1271 |
| 109 | Ga0157372_12611363 | 3300013307 | Bacteria | 580 |
| 110 | Ga0157375_10000614 | 3300013308 | Bacteria | 31619 |
| 111 | Ga0157375_10005435 | 3300013308 | Bacteria | 11076 |
| 112 | Ga0163163_10894450 | 3300014325 | Bacteria | 951 |
| 113 | Ga0163163_10908187 | 3300014325 | Unclassified | 944 |
| 114 | Ga0157380_10574835 | 3300014326 | Bacteria | 1110 |
| 115 | Ga0157377_11321410 | 3300014745 | Bacteria | 565 |
| 116 | Ga0157377_11615362 | 3300014745 | Bacteria | 520 |
| 117 | Ga0157379_10050247 | 3300014968 | Bacteria | 3722 |
| 118 | Ga0157376_10024787 | 3300014969 | Bacteria | 4716 |
| 119 | Ga0157376_10104550 | 3300014969 | Bacteria | 2481 |
| 120 | Ga0157376_10153346 | 3300014969 | Bacteria | 2080 |
| 121 | Ga0157376_12905679 | 3300014969 | Bacteria | 519 |
| 122 | Ga0163161_10000968 | 3300017792 | Bacteria | 21949 |
| 123 | Ga0163161_10605062 | 3300017792 | Bacteria | 904 |
| 124 | Ga0213876_10004817 | 3300021384 | Bacteria | 7489 |
| 125 | Ga0213876_10084357 | 3300021384 | Bacteria | 1681 |
| 126 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 127 | Ga0207656_10002981 | 3300025321 | Bacteria | 5783 |
| 128 | Ga0207710_10571103 | 3300025900 | Unclassified | 590 |
| 129 | Ga0207680_10253454 | 3300025903 | Bacteria | 1216 |
| 130 | Ga0207680_10324548 | 3300025903 | Bacteria | 1077 |
| 131 | Ga0207685_10073281 | 3300025905 | Bacteria | 1395 |
| 132 | Ga0207643_10314342 | 3300025908 | Bacteria | 977 |
| 133 | Ga0207695_10082084 | 3300025913 | Bacteria | 3260 |
| 134 | Ga0207662_10435822 | 3300025918 | Bacteria | 894 |
| 135 | Ga0207650_10128202 | 3300025925 | Bacteria | 1983 |
| 136 | Ga0207659_10165215 | 3300025926 | Bacteria | 1741 |
| 137 | Ga0207644_10142070 | 3300025931 | Bacteria | 1849 |
| 138 | Ga0207706_10010295 | 3300025933 | Bacteria | 8551 |
| 139 | Ga0207686_10045182 | 3300025934 | Bacteria | 2709 |
| 140 | Ga0207686_10154934 | 3300025934 | Bacteria | 1599 |
| 141 | Ga0207686_10353045 | 3300025934 | Bacteria | 1108 |
| 142 | Ga0207686_10630670 | 3300025934 | Bacteria | 846 |
| 143 | Ga0207704_10823605 | 3300025938 | Bacteria | 776 |
| 144 | Ga0207691_11067360 | 3300025940 | Bacteria | 672 |
| 145 | Ga0207711_10056409 | 3300025941 | Bacteria | 3376 |
| 146 | Ga0207689_10025266 | 3300025942 | Bacteria | 4977 |
| 147 | Ga0207689_10109636 | 3300025942 | Bacteria | 2268 |
| 148 | Ga0207689_10284514 | 3300025942 | Bacteria | 1369 |
| 149 | Ga0207661_11508759 | 3300025944 | Bacteria | 616 |
| 150 | Ga0207679_10088461 | 3300025945 | Bacteria | 2388 |
| 151 | Ga0207679_10554115 | 3300025945 | Bacteria | 1032 |
| 152 | Ga0207712_10413280 | 3300025961 | Bacteria | 1137 |
| 153 | Ga0207668_10254815 | 3300025972 | Bacteria | 1427 |
| 154 | Ga0207677_11395927 | 3300026023 | Bacteria | 645 |
| 155 | Ga0207703_10126536 | 3300026035 | Bacteria | 2201 |
| 156 | Ga0207639_10128320 | 3300026041 | Bacteria | 2095 |
| 157 | Ga0207639_10475849 | 3300026041 | Bacteria | 1138 |
| 158 | Ga0207639_11218485 | 3300026041 | Bacteria | 706 |
| 159 | Ga0207708_10240636 | 3300026075 | Bacteria | 1456 |
| 160 | Ga0207641_10012106 | 3300026088 | Bacteria | 7076 |
| 161 | Ga0207648_10250447 | 3300026089 | Bacteria | 1579 |
| 162 | Ga0207648_10258512 | 3300026089 | Bacteria | 1553 |
| 163 | Ga0207648_10486013 | 3300026089 | Bacteria | 1128 |
| 164 | Ga0207676_10340058 | 3300026095 | Bacteria | 1384 |
| 165 | Ga0207674_10142389 | 3300026116 | Bacteria | 2357 |
| 166 | Ga0207675_100119273 | 3300026118 | Bacteria | 2495 |
| 167 | Ga0207675_102322738 | 3300026118 | Bacteria | 550 |
| 168 | Ga0207683_10026793 | 3300026121 | Bacteria | 4979 |
| 169 | Ga0207683_10028008 | 3300026121 | Bacteria | 4870 |
| 170 | Ga0207683_10688302 | 3300026121 | Bacteria | 948 |
| 171 | Ga0268264_12351975 | 3300028381 | Bacteria | 539 |
| 172 | Ga0307508_10922127 | 3300031616 | Bacteria | 502 |
| 173 | Ga0265314_10050019 | 3300031711 | Bacteria | 2922 |
| 174 | Ga0307413_11586744 | 3300031824 | Unclassified | 581 |
| 175 | Ga0307416_101538116 | 3300032002 | Bacteria | 771 |
| 176 | Ga0307416_101638027 | 3300032002 | Unclassified | 749 |
| 177 | Ga0307414_10811338 | 3300032004 | Bacteria | 854 |
| 178 | Ga0436365_0218149 | 3300039437 | Unclassified | 524 |
| 179 | Ga0436365_1188598 | 3300039437 | Bacteria | 793 |
| 180 | Ga0436365_1740763 | 3300039437 | Bacteria | 18760 |
| 181 | Ga0439441_017659 | 3300042001 | Bacteria | 1283 |
| 182 | Ga0451577_0268463 | 3300042876 | Bacteria | 1545 |
| 183 | Ga0495668_0480808 | 3300046616 | Bacteria | 684 |
| 184 | Ga0495686_0000814 | 3300047472 | Bacteria | 40340 |
| 185 | Ga0496100_0031379 | 3300048903 | Bacteria | 3304 |
| 186 | Ga0496104_0096952 | 3300048907 | Bacteria | 2822 |
| 187 | Ga0496105_0444061 | 3300048908 | Bacteria | 1025 |
| 188 | Ga0496115_1283431 | 3300048918 | Bacteria | 546 |
| 189 | Ga0501032_0042193 | 3300049569 | Bacteria | 3095 |
| 190 | Ga0501034_0290695 | 3300049571 | Bacteria | 1572 |
| 191 | Ga0501036_0990709 | 3300049572 | Bacteria | 688 |
| 192 | Ga0501039_0319787 | 3300049575 | Bacteria | 1220 |
| 193 | Ga0501043_0042766 | 3300049579 | Bacteria | 3560 |
| 194 | Ga0501046_0033569 | 3300049580 | Bacteria | 4144 |
| 195 | Ga0501047_0043636 | 3300049581 | Bacteria | 4331 |
| 196 | Ga0501048_0024802 | 3300049582 | Bacteria | 4374 |
| 197 | Ga0501073_0008853 | 3300049589 | Bacteria | 7443 |
| 198 | Ga0501074_0018342 | 3300049590 | Bacteria | 5082 |
| 199 | Ga0501198_045697 | 3300049649 | Unclassified | 769 |
| 200 | Ga0501217_048438 | 3300049661 | Unclassified | 1103 |
| 201 | Ga0501223_029847 | 3300049663 | Unclassified | 1061 |
| 202 | Ga0501242_002161 | 3300049674 | Bacteria | 2053 |
| 203 | Ga0501257_018823 | 3300049686 | Bacteria | 1613 |
| 204 | Ga0501225_0018351 | 3300049705 | Bacteria | 1939 |
| 205 | Ga0501083_0292063 | 3300049744 | Bacteria | 1060 |
| 206 | Ga0501263_005378 | 3300049760 | Bacteria | 1444 |
| 207 | Ga0501035_0241504 | 3300049822 | Bacteria | 1536 |
| 208 | Ga0501044_0001663 | 3300049823 | Bacteria | 26095 |
| 209 | nmdc:mga0n895_134080_c1 | 3300050512 | Bacteria | 2502 |
| 210 | nmdc:mga0rr50_1502660_c1 | 3300050513 | Bacteria | 569 |
| 211 | Ga0500573_0474507 | 3300053140 | Unclassified | 572 |
| 212 | Ga0500616_0118109 | 3300053153 | Bacteria | 1271 |
| 213 | Ga0500622_0000568 | 3300053156 | Bacteria | 33817 |
| 214 | Ga0501084_0260588 | 3300054114 | Bacteria | 1464 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_102322738 | Ga0207675_1023227382 | 101 |
| 2 | 3300021384 | Ga0213876_10084357 | Ga0213876_100843572 | 113 |
| 3 | 3300039437 | Ga0436365_1188598 | Ga0436365_1188598_193_564 | 113 |
| 4 | 3300013297 | Ga0157378_11025558 | Ga0157378_110255582 | 115 |
| 5 | 3300005842 | Ga0068858_100154440 | Ga0068858_1001544402 | 116 |
| 6 | 3300009553 | Ga0105249_10219545 | Ga0105249_102195452 | 116 |
| 7 | 3300010375 | Ga0105239_10017420 | Ga0105239_100174207 | 116 |
| 8 | 3300013306 | Ga0163162_10168443 | Ga0163162_101684431 | 116 |
| 9 | 3300025233 | Ga0209437_100102 | Ga0209437_100102148 | 116 |
| 10 | 3300025913 | Ga0207695_10082084 | Ga0207695_100820842 | 116 |
| 11 | 3300026035 | Ga0207703_10126536 | Ga0207703_101265362 | 116 |
| 12 | 3300046616 | Ga0495668_0480808 | Ga0495668_0480808_154_513 | 116 |
| 13 | 3300053140 | Ga0500573_0474507 | Ga0500573_0474507_57_416 | 116 |
| 14 | 3300002459 | JGI24751J29686_10028602 | JGI24751J29686_100286022 | 117 |
| 15 | 3300005330 | Ga0070690_100016610 | Ga0070690_1000166103 | 117 |
| 16 | 3300005331 | Ga0070670_100032098 | Ga0070670_1000320983 | 117 |
| 17 | 3300005331 | Ga0070670_100576922 | Ga0070670_1005769222 | 117 |
| 18 | 3300005333 | Ga0070677_10243897 | Ga0070677_102438972 | 117 |
| 19 | 3300005334 | Ga0068869_100020182 | Ga0068869_1000201824 | 117 |
| 20 | 3300005335 | Ga0070666_10011816 | Ga0070666_100118161 | 117 |
| 21 | 3300005337 | Ga0070682_100000129 | Ga0070682_10000012912 | 117 |
| 22 | 3300005338 | Ga0068868_100006616 | Ga0068868_1000066168 | 117 |
| 23 | 3300005344 | Ga0070661_100262226 | Ga0070661_1002622262 | 117 |
| 24 | 3300005355 | Ga0070671_100180207 | Ga0070671_1001802072 | 117 |
| 25 | 3300005365 | Ga0070688_101051590 | Ga0070688_1010515902 | 117 |
| 26 | 3300005367 | Ga0070667_100431768 | Ga0070667_1004317682 | 117 |
| 27 | 3300005456 | Ga0070678_100003904 | Ga0070678_10000390410 | 117 |
| 28 | 3300005539 | Ga0068853_100109292 | Ga0068853_1001092922 | 117 |
| 29 | 3300005539 | Ga0068853_100205359 | Ga0068853_1002053592 | 117 |
| 30 | 3300005547 | Ga0070693_100210583 | Ga0070693_1002105832 | 117 |
| 31 | 3300005564 | Ga0070664_100345529 | Ga0070664_1003455292 | 117 |
| 32 | 3300005564 | Ga0070664_100533048 | Ga0070664_1005330482 | 117 |
| 33 | 3300005577 | Ga0068857_100126817 | Ga0068857_1001268172 | 117 |
| 34 | 3300005615 | Ga0070702_101272354 | Ga0070702_1012723541 | 117 |
| 35 | 3300005618 | Ga0068864_100056025 | Ga0068864_1000560252 | 117 |
| 36 | 3300005719 | Ga0068861_101444652 | Ga0068861_1014446522 | 117 |
| 37 | 3300005834 | Ga0068851_10006062 | Ga0068851_100060627 | 117 |
| 38 | 3300005834 | Ga0068851_10687497 | Ga0068851_106874972 | 117 |
| 39 | 3300005841 | Ga0068863_100151773 | Ga0068863_1001517732 | 117 |
| 40 | 3300006237 | Ga0097621_100046326 | Ga0097621_1000463263 | 117 |
| 41 | 3300006358 | Ga0068871_101271632 | Ga0068871_1012716322 | 117 |
| 42 | 3300006881 | Ga0068865_100224900 | Ga0068865_1002249002 | 117 |
| 43 | 3300007076 | Ga0075435_100643463 | Ga0075435_1006434631 | 117 |
| 44 | 3300007076 | Ga0075435_101100351 | Ga0075435_1011003512 | 117 |
| 45 | 3300009098 | Ga0105245_10323701 | Ga0105245_103237013 | 117 |
| 46 | 3300009176 | Ga0105242_10576135 | Ga0105242_105761352 | 117 |
| 47 | 3300009553 | Ga0105249_10018555 | Ga0105249_100185552 | 117 |
| 48 | 3300013296 | Ga0157374_10002410 | Ga0157374_1000241015 | 117 |
| 49 | 3300013306 | Ga0163162_11353837 | Ga0163162_113538372 | 117 |
| 50 | 3300013308 | Ga0157375_10005435 | Ga0157375_1000543514 | 117 |
| 51 | 3300014325 | Ga0163163_10894450 | Ga0163163_108944502 | 117 |
| 52 | 3300014969 | Ga0157376_10104550 | Ga0157376_101045501 | 117 |
| 53 | 3300014969 | Ga0157376_10153346 | Ga0157376_101533463 | 117 |
| 54 | 3300025321 | Ga0207656_10002981 | Ga0207656_100029812 | 117 |
| 55 | 3300025903 | Ga0207680_10253454 | Ga0207680_102534542 | 117 |
| 56 | 3300025925 | Ga0207650_10128202 | Ga0207650_101282022 | 117 |
| 57 | 3300025934 | Ga0207686_10045182 | Ga0207686_100451823 | 117 |
| 58 | 3300025942 | Ga0207689_10025266 | Ga0207689_100252663 | 117 |
| 59 | 3300025944 | Ga0207661_11508759 | Ga0207661_115087592 | 117 |
| 60 | 3300025945 | Ga0207679_10088461 | Ga0207679_100884612 | 117 |
| 61 | 3300025945 | Ga0207679_10554115 | Ga0207679_105541152 | 117 |
| 62 | 3300026023 | Ga0207677_11395927 | Ga0207677_113959272 | 117 |
| 63 | 3300026041 | Ga0207639_10128320 | Ga0207639_101283202 | 117 |
| 64 | 3300026041 | Ga0207639_11218485 | Ga0207639_112184852 | 117 |
| 65 | 3300026089 | Ga0207648_10486013 | Ga0207648_104860131 | 117 |
| 66 | 3300026095 | Ga0207676_10340058 | Ga0207676_103400582 | 117 |
| 67 | 3300026116 | Ga0207674_10142389 | Ga0207674_101423892 | 117 |
| 68 | 3300026121 | Ga0207683_10026793 | Ga0207683_100267934 | 117 |
| 69 | 3300028381 | Ga0268264_12351975 | Ga0268264_123519751 | 117 |
| 70 | 3300032004 | Ga0307414_10811338 | Ga0307414_108113382 | 117 |
| 71 | 3300049649 | Ga0501198_045697 | Ga0501198_045697_83_463 | 117 |
| 72 | 3300049661 | Ga0501217_048438 | Ga0501217_048438_300_680 | 117 |
| 73 | 3300049663 | Ga0501223_029847 | Ga0501223_029847_305_685 | 117 |
| 74 | 3300049674 | Ga0501242_002161 | Ga0501242_002161_1130_1510 | 117 |
| 75 | 3300049686 | Ga0501257_018823 | Ga0501257_018823_41_421 | 117 |
| 76 | 3300049705 | Ga0501225_0018351 | Ga0501225_0018351_1158_1538 | 117 |
| 77 | 3300049760 | Ga0501263_005378 | Ga0501263_005378_755_1135 | 117 |
| 78 | 3300050513 | nmdc:mga0rr50_1502660_c1 | nmdc:mga0rr50_1502660_c1_55_435 | 117 |
| 79 | 3300053153 | Ga0500616_0118109 | Ga0500616_0118109_516_902 | 117 |
| 80 | 3300005355 | Ga0070671_100022897 | Ga0070671_1000228975 | 118 |
| 81 | 3300005456 | Ga0070678_100440648 | Ga0070678_1004406482 | 118 |
| 82 | 3300005459 | Ga0068867_100169489 | Ga0068867_1001694892 | 118 |
| 83 | 3300005563 | Ga0068855_100771996 | Ga0068855_1007719961 | 118 |
| 84 | 3300005718 | Ga0068866_10398282 | Ga0068866_103982822 | 118 |
| 85 | 3300005841 | Ga0068863_100063235 | Ga0068863_1000632355 | 118 |
| 86 | 3300006163 | Ga0070715_10140901 | Ga0070715_101409012 | 118 |
| 87 | 3300006237 | Ga0097621_100000611 | Ga0097621_1000006118 | 118 |
| 88 | 3300006358 | Ga0068871_100000634 | Ga0068871_1000006345 | 118 |
| 89 | 3300009101 | Ga0105247_10471734 | Ga0105247_104717341 | 118 |
| 90 | 3300009176 | Ga0105242_10249179 | Ga0105242_102491792 | 118 |
| 91 | 3300009177 | Ga0105248_10051086 | Ga0105248_100510865 | 118 |
| 92 | 3300009553 | Ga0105249_10000679 | Ga0105249_1000067937 | 118 |
| 93 | 3300009553 | Ga0105249_11073079 | Ga0105249_110730791 | 118 |
| 94 | 3300013102 | Ga0157371_11300676 | Ga0157371_113006761 | 118 |
| 95 | 3300013297 | Ga0157378_10025398 | Ga0157378_100253985 | 118 |
| 96 | 3300013306 | Ga0163162_10000595 | Ga0163162_1000059521 | 118 |
| 97 | 3300013306 | Ga0163162_10002439 | Ga0163162_1000243916 | 118 |
| 98 | 3300013307 | Ga0157372_10308319 | Ga0157372_103083193 | 118 |
| 99 | 3300013307 | Ga0157372_10331873 | Ga0157372_103318732 | 118 |
| 100 | 3300013307 | Ga0157372_12611363 | Ga0157372_126113632 | 118 |
| 101 | 3300013308 | Ga0157375_10000614 | Ga0157375_1000061418 | 118 |
| 102 | 3300014968 | Ga0157379_10050247 | Ga0157379_100502472 | 118 |
| 103 | 3300014969 | Ga0157376_10024787 | Ga0157376_100247875 | 118 |
| 104 | 3300017792 | Ga0163161_10000968 | Ga0163161_1000096824 | 118 |
| 105 | 3300025900 | Ga0207710_10571103 | Ga0207710_105711031 | 118 |
| 106 | 3300025903 | Ga0207680_10324548 | Ga0207680_103245481 | 118 |
| 107 | 3300025905 | Ga0207685_10073281 | Ga0207685_100732812 | 118 |
| 108 | 3300025931 | Ga0207644_10142070 | Ga0207644_101420701 | 118 |
| 109 | 3300025934 | Ga0207686_10353045 | Ga0207686_103530452 | 118 |
| 110 | 3300025938 | Ga0207704_10823605 | Ga0207704_108236051 | 118 |
| 111 | 3300025941 | Ga0207711_10056409 | Ga0207711_100564092 | 118 |
| 112 | 3300025961 | Ga0207712_10413280 | Ga0207712_104132802 | 118 |
| 113 | 3300026088 | Ga0207641_10012106 | Ga0207641_100121067 | 118 |
| 114 | 3300026089 | Ga0207648_10250447 | Ga0207648_102504472 | 118 |
| 115 | 3300039437 | Ga0436365_0218149 | Ga0436365_0218149_42_431 | 118 |
| 116 | 3300042876 | Ga0451577_0268463 | Ga0451577_0268463_241_609 | 118 |
| 117 | 3300047472 | Ga0495686_0000814 | Ga0495686_0000814_11252_11635 | 118 |
| 118 | 3300048903 | Ga0496100_0031379 | Ga0496100_0031379_1403_1780 | 118 |
| 119 | 3300048907 | Ga0496104_0096952 | Ga0496104_0096952_926_1288 | 118 |
| 120 | 3300048908 | Ga0496105_0444061 | Ga0496105_0444061_420_797 | 118 |
| 121 | 3300053156 | Ga0500622_0000568 | Ga0500622_0000568_30666_31040 | 118 |
| 122 | iso_pu_bacteria | 2881955468 | 2881956896 | 118 |
| 123 | iso_pu_bacteria | 2929154850 | 2929158425 | 118 |
| 124 | 2162886007 | SwRhRL2b_contig_677025 | SwRhRL2b_0927.00002130 | 119 |
| 125 | 3300001989 | JGI24739J22299_10027236 | JGI24739J22299_100272362 | 119 |
| 126 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133276 | 119 |
| 127 | 3300005343 | Ga0070687_101102776 | Ga0070687_1011027761 | 119 |
| 128 | 3300005347 | Ga0070668_100036105 | Ga0070668_1000361052 | 119 |
| 129 | 3300005355 | Ga0070671_101843654 | Ga0070671_1018436541 | 119 |
| 130 | 3300005356 | Ga0070674_100217349 | Ga0070674_1002173492 | 119 |
| 131 | 3300005438 | Ga0070701_11055362 | Ga0070701_110553621 | 119 |
| 132 | 3300005456 | Ga0070678_100025779 | Ga0070678_1000257794 | 119 |
| 133 | 3300005456 | Ga0070678_100482848 | Ga0070678_1004828481 | 119 |
| 134 | 3300005457 | Ga0070662_100888416 | Ga0070662_1008884162 | 119 |
| 135 | 3300005459 | Ga0068867_102268513 | Ga0068867_1022685131 | 119 |
| 136 | 3300005467 | Ga0070706_100760411 | Ga0070706_1007604111 | 119 |
| 137 | 3300005539 | Ga0068853_101568871 | Ga0068853_1015688712 | 119 |
| 138 | 3300005543 | Ga0070672_100336936 | Ga0070672_1003369362 | 119 |
| 139 | 3300005543 | Ga0070672_101965916 | Ga0070672_1019659161 | 119 |
| 140 | 3300005563 | Ga0068855_100958873 | Ga0068855_1009588732 | 119 |
| 141 | 3300005577 | Ga0068857_100864120 | Ga0068857_1008641202 | 119 |
| 142 | 3300005578 | Ga0068854_100242214 | Ga0068854_1002422142 | 119 |
| 143 | 3300005617 | Ga0068859_100057532 | Ga0068859_1000575323 | 119 |
| 144 | 3300005617 | Ga0068859_100227543 | Ga0068859_1002275432 | 119 |
| 145 | 3300005617 | Ga0068859_101681833 | Ga0068859_1016818332 | 119 |
| 146 | 3300005719 | Ga0068861_100042263 | Ga0068861_1000422635 | 119 |
| 147 | 3300005840 | Ga0068870_10255913 | Ga0068870_102559131 | 119 |
| 148 | 3300005840 | Ga0068870_10635151 | Ga0068870_106351512 | 119 |
| 149 | 3300005841 | Ga0068863_101663675 | Ga0068863_1016636752 | 119 |
| 150 | 3300005842 | Ga0068858_102238832 | Ga0068858_1022388321 | 119 |
| 151 | 3300005844 | Ga0068862_101800847 | Ga0068862_1018008471 | 119 |
| 152 | 3300006237 | Ga0097621_100598510 | Ga0097621_1005985102 | 119 |
| 153 | 3300006358 | Ga0068871_102043957 | Ga0068871_1020439571 | 119 |
| 154 | 3300006871 | Ga0075434_100409693 | Ga0075434_1004096932 | 119 |
| 155 | 3300006931 | Ga0097620_100057536 | Ga0097620_1000575363 | 119 |
| 156 | 3300006931 | Ga0097620_100227544 | Ga0097620_1002275442 | 119 |
| 157 | 3300006931 | Ga0097620_101681343 | Ga0097620_1016813432 | 119 |
| 158 | 3300009176 | Ga0105242_10127674 | Ga0105242_101276742 | 119 |
| 159 | 3300009176 | Ga0105242_12558348 | Ga0105242_125583482 | 119 |
| 160 | 3300009176 | Ga0105242_12558349 | Ga0105242_125583492 | 119 |
| 161 | 3300009553 | Ga0105249_10392819 | Ga0105249_103928192 | 119 |
| 162 | 3300009553 | Ga0105249_12911450 | Ga0105249_129114502 | 119 |
| 163 | 3300010375 | Ga0105239_11315500 | Ga0105239_113155002 | 119 |
| 164 | 3300013102 | Ga0157371_10105920 | Ga0157371_101059202 | 119 |
| 165 | 3300013105 | Ga0157369_10171993 | Ga0157369_101719932 | 119 |
| 166 | 3300013297 | Ga0157378_12172591 | Ga0157378_121725912 | 119 |
| 167 | 3300013306 | Ga0163162_13139536 | Ga0163162_131395361 | 119 |
| 168 | 3300013307 | Ga0157372_10012017 | Ga0157372_100120177 | 119 |
| 169 | 3300013307 | Ga0157372_10265639 | Ga0157372_102656392 | 119 |
| 170 | 3300013307 | Ga0157372_10610797 | Ga0157372_106107972 | 119 |
| 171 | 3300014325 | Ga0163163_10908187 | Ga0163163_109081872 | 119 |
| 172 | 3300014326 | Ga0157380_10574835 | Ga0157380_105748352 | 119 |
| 173 | 3300014745 | Ga0157377_11321410 | Ga0157377_113214101 | 119 |
| 174 | 3300014745 | Ga0157377_11615362 | Ga0157377_116153621 | 119 |
| 175 | 3300014969 | Ga0157376_12905679 | Ga0157376_129056791 | 119 |
| 176 | 3300017792 | Ga0163161_10605062 | Ga0163161_106050622 | 119 |
| 177 | 3300021384 | Ga0213876_10004817 | Ga0213876_100048172 | 119 |
| 178 | 3300025908 | Ga0207643_10314342 | Ga0207643_103143422 | 119 |
| 179 | 3300025918 | Ga0207662_10435822 | Ga0207662_104358221 | 119 |
| 180 | 3300025926 | Ga0207659_10165215 | Ga0207659_101652152 | 119 |
| 181 | 3300025933 | Ga0207706_10010295 | Ga0207706_100102959 | 119 |
| 182 | 3300025934 | Ga0207686_10154934 | Ga0207686_101549342 | 119 |
| 183 | 3300025934 | Ga0207686_10630670 | Ga0207686_106306702 | 119 |
| 184 | 3300025940 | Ga0207691_11067360 | Ga0207691_110673602 | 119 |
| 185 | 3300025942 | Ga0207689_10109636 | Ga0207689_101096362 | 119 |
| 186 | 3300025942 | Ga0207689_10284514 | Ga0207689_102845142 | 119 |
| 187 | 3300025972 | Ga0207668_10254815 | Ga0207668_102548152 | 119 |
| 188 | 3300026041 | Ga0207639_10475849 | Ga0207639_104758492 | 119 |
| 189 | 3300026075 | Ga0207708_10240636 | Ga0207708_102406362 | 119 |
| 190 | 3300026089 | Ga0207648_10258512 | Ga0207648_102585122 | 119 |
| 191 | 3300026118 | Ga0207675_100119273 | Ga0207675_1001192733 | 119 |
| 192 | 3300026121 | Ga0207683_10028008 | Ga0207683_100280083 | 119 |
| 193 | 3300026121 | Ga0207683_10688302 | Ga0207683_106883021 | 119 |
| 194 | 3300031616 | Ga0307508_10922127 | Ga0307508_109221271 | 119 |
| 195 | 3300031711 | Ga0265314_10050019 | Ga0265314_100500195 | 119 |
| 196 | 3300031824 | Ga0307413_11586744 | Ga0307413_115867441 | 119 |
| 197 | 3300032002 | Ga0307416_101538116 | Ga0307416_1015381161 | 119 |
| 198 | 3300032002 | Ga0307416_101638027 | Ga0307416_1016380271 | 119 |
| 199 | 3300039437 | Ga0436365_1740763 | Ga0436365_1740763_6835_7215 | 119 |
| 200 | 3300042001 | Ga0439441_017659 | Ga0439441_017659_429_926 | 119 |
| 201 | 3300048918 | Ga0496115_1283431 | Ga0496115_1283431_97_474 | 119 |
| 202 | 3300049569 | Ga0501032_0042193 | Ga0501032_0042193_341_736 | 119 |
| 203 | 3300049571 | Ga0501034_0290695 | Ga0501034_0290695_854_1249 | 119 |
| 204 | 3300049572 | Ga0501036_0990709 | Ga0501036_0990709_38_433 | 119 |
| 205 | 3300049575 | Ga0501039_0319787 | Ga0501039_0319787_196_591 | 119 |
| 206 | 3300049579 | Ga0501043_0042766 | Ga0501043_0042766_1007_1402 | 119 |
| 207 | 3300049580 | Ga0501046_0033569 | Ga0501046_0033569_489_884 | 119 |
| 208 | 3300049581 | Ga0501047_0043636 | Ga0501047_0043636_3331_3726 | 119 |
| 209 | 3300049582 | Ga0501048_0024802 | Ga0501048_0024802_159_554 | 119 |
| 210 | 3300049589 | Ga0501073_0008853 | Ga0501073_0008853_6284_6679 | 119 |
| 211 | 3300049590 | Ga0501074_0018342 | Ga0501074_0018342_4357_4752 | 119 |
| 212 | 3300049744 | Ga0501083_0292063 | Ga0501083_0292063_266_661 | 119 |
| 213 | 3300049822 | Ga0501035_0241504 | Ga0501035_0241504_639_1034 | 119 |
| 214 | 3300049823 | Ga0501044_0001663 | Ga0501044_0001663_9916_10311 | 119 |
| 215 | 3300050512 | nmdc:mga0n895_134080_c1 | nmdc:mga0n895_134080_c1_1361_1753 | 119 |
| 216 | 3300054114 | Ga0501084_0260588 | Ga0501084_0260588_491_886 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7s5c-assembly1.cif.gz_F | m. xanthus ferritin-like protein encb | 0.931 | 35 | 85 |
| 6sv1-assembly1.cif.gz_B | crystal structure of rhodospirillum rubrum rru_a0973 e34a variant | 0.9252 | 33 | 86 |
| 6suw-assembly1.cif.gz_D | crystal structure of rhodospirillum rubrum rru_a0973 e31a variant | 0.9251 | 33 | 86 |
| 6suw-assembly2.cif.gz_R | crystal structure of rhodospirillum rubrum rru_a0973 e31a variant | 0.9244 | 33 | 86 |
| 5l89-assembly3.cif.gz_U | crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a | 0.9228 | 33 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WEV5_108_185_1.10.287.660 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9424 | 59 | 118 | 1.10.287.660 |
| 5l8gG00 | Special;Helix non-globular;Helix Hairpins; | 0.9331 | 33 | 86 | 6.10.140.1960 |
| 5l8gO00 | Special;Helix non-globular;Helix Hairpins; | 0.9313 | 33 | 86 | 6.10.140.1960 |
| 5l89M00 | Special;Helix non-globular;Helix Hairpins; | 0.9291 | 33 | 86 | 6.10.140.1960 |
| 5l8bL00 | Special;Helix non-globular;Helix Hairpins; | 0.9249 | 33 | 86 | 6.10.140.1960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0UJT4-F1-model_v4 | Four helix bundle protein | 0.9661 | 8 | 117 |
|
| AF-A0A554MNA0-F1-model_v4 | S23 ribosomal protein | 0.966 | 8 | 117 |
GO:0005840
|
| AF-A0A2H5W476-F1-model_v4 | Four helix bundle protein | 0.9655 | 10 | 118 |
|
| AF-A0A2E2NZZ6-F1-model_v4 | Four helix bundle protein | 0.9651 | 8 | 115 |
|
| AF-A0A4Q3EQM9-F1-model_v4 | Four helix bundle protein | 0.9633 | 4 | 117 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar