F327381

General Info

Members Datasets Scaffolds Average Seq Length
216 158 432 100

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100403235|Ga0070704_1004032352
Length 107
Sequence MTETVKKPAVKKLTETELNQALLGLKGWQLVGGKLQRTYQFLDFVEAWGFMSSAALVVQQMDHHPEWFNVYHTVKIDLVTHDAGGVTARDVELAGRMEEIATRRERA

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
127 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
156 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
157 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
158 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 4.63
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.85
Rhizosphere 89.35
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100403235 3300005549 Bacteria 1167
2 rootL2_10033970 3300003322 Bacteria 1141
3 Ga0065707_11032946 3300005295 Bacteria 531
4 Ga0070658_10394014 3300005327 Bacteria 1189
5 Ga0070658_11040392 3300005327 Bacteria 712
6 Ga0070690_100067168 3300005330 Bacteria 2323
7 Ga0068869_100000117 3300005334 Bacteria 38306
8 Ga0068869_100266020 3300005334 Unclassified 1374
9 Ga0068869_101180525 3300005334 Bacteria 672
10 Ga0070680_100573204 3300005336 Bacteria 968
11 Ga0068868_100114971 3300005338 Bacteria 2190
12 Ga0068868_100222334 3300005338 Bacteria 1581
13 Ga0068868_101399451 3300005338 Bacteria 652
14 Ga0070689_100010435 3300005340 Bacteria 6621
15 Ga0070687_100073674 3300005343 Unclassified 1841
16 Ga0070661_101182740 3300005344 Bacteria 639
17 Ga0070692_10064559 3300005345 Bacteria 1936
18 Ga0070692_10566563 3300005345 Bacteria 746
19 Ga0070675_101259846 3300005354 Bacteria 681
20 Ga0070688_100001425 3300005365 Bacteria 11905
21 Ga0070688_100163311 3300005365 Bacteria 1532
22 Ga0070709_10780822 3300005434 Bacteria 748
23 Ga0070714_100013688 3300005435 Bacteria 6506
24 Ga0070713_100007234 3300005436 Bacteria 7772
25 Ga0070713_100030425 3300005436 Bacteria 4288
26 Ga0070701_10133580 3300005438 Unclassified 1412
27 Ga0070700_100498393 3300005441 Unclassified 936
28 Ga0070694_100246801 3300005444 Bacteria 1349
29 Ga0070694_101241971 3300005444 Bacteria 625
30 Ga0070663_100011087 3300005455 Bacteria 5644
31 Ga0070663_102060632 3300005455 Bacteria 514
32 Ga0070678_100005000 3300005456 Bacteria 7598
33 Ga0070681_10764340 3300005458 Bacteria 883
34 Ga0070681_10850593 3300005458 Bacteria 830
35 Ga0068867_100482189 3300005459 Bacteria 1063
36 Ga0070685_10409081 3300005466 Bacteria 941
37 Ga0070699_100143163 3300005518 Bacteria 2112
38 Ga0070699_101236199 3300005518 Unclassified 685
39 Ga0070699_101676803 3300005518 Bacteria 582
40 Ga0070679_100605361 3300005530 Bacteria 1039
41 Ga0070679_102194170 3300005530 Bacteria 502
42 Ga0070697_102087104 3300005536 Bacteria 507
43 Ga0068853_100248994 3300005539 Bacteria 1630
44 Ga0070686_100277795 3300005544 Bacteria 1234
45 Ga0070696_100097878 3300005546 Bacteria 2098
46 Ga0070665_100338930 3300005548 Bacteria 1508
47 Ga0070665_100797415 3300005548 Bacteria 957
48 Ga0070704_101675610 3300005549 Unclassified 587
49 Ga0068855_100082351 3300005563 Bacteria 3730
50 Ga0068855_100237714 3300005563 Bacteria 2037
51 Ga0068855_102188153 3300005563 Bacteria 555
52 Ga0068857_100053859 3300005577 Bacteria 3569
53 Ga0068852_100105959 3300005616 Bacteria 2548
54 Ga0068852_100884081 3300005616 Bacteria 910
55 Ga0068859_100038692 3300005617 Bacteria 4784
56 Ga0068859_100324650 3300005617 Bacteria 1633
57 Ga0068861_100213711 3300005719 Bacteria 1626
58 Ga0068870_10341170 3300005840 Unclassified 958
59 Ga0068863_101708037 3300005841 Bacteria 639
60 Ga0068860_100793228 3300005843 Bacteria 960
61 Ga0068862_100740734 3300005844 Bacteria 955
62 Ga0081540_1070587 3300005983 Bacteria 1617
63 Ga0081540_1147689 3300005983 Bacteria 933
64 Ga0070712_100420685 3300006175 Bacteria 1107
65 Ga0075367_10633395 3300006178 Bacteria 680
66 Ga0097621_100002047 3300006237 Bacteria 13797
67 Ga0068871_100046695 3300006358 Bacteria 3489
68 Ga0075428_100051377 3300006844 Bacteria 4521
69 Ga0075434_100951933 3300006871 Bacteria 873
70 Ga0068865_100005224 3300006881 Bacteria 7852
71 Ga0075436_100859318 3300006914 Bacteria 677
72 Ga0097620_100038692 3300006931 Bacteria 4784
73 Ga0097620_100324629 3300006931 Bacteria 1633
74 Ga0111539_10163317 3300009094 Bacteria 2605
75 Ga0105245_10566289 3300009098 Bacteria 1159
76 Ga0105245_11499469 3300009098 Bacteria 725
77 Ga0105243_11978843 3300009148 Bacteria 617
78 Ga0105242_10565207 3300009176 Bacteria 1093
79 Ga0105248_12164283 3300009177 Bacteria 633
80 Ga0105237_10332378 3300009545 Bacteria 1524
81 Ga0105238_10983358 3300009551 Bacteria 864
82 Ga0105239_10509097 3300010375 Bacteria 1369
83 Ga0157370_11730184 3300013104 Bacteria 561
84 Ga0157369_10013544 3300013105 Bacteria 9217
85 Ga0157374_10173253 3300013296 Bacteria 2106
86 Ga0157374_11619023 3300013296 Bacteria 672
87 Ga0157378_10998940 3300013297 Bacteria 871
88 Ga0157378_11118707 3300013297 Bacteria 825
89 Ga0163162_10142470 3300013306 Bacteria 2511
90 Ga0157372_11631765 3300013307 Bacteria 742
91 Ga0157375_10331956 3300013308 Unclassified 1686
92 Ga0157375_10528306 3300013308 Bacteria 1342
93 Ga0163163_12028888 3300014325 Bacteria 635
94 Ga0157380_11277549 3300014326 Unclassified 780
95 Ga0157377_10076402 3300014745 Bacteria 1948
96 Ga0197907_10313448 3300020069 Bacteria 1299
97 Ga0197907_10823111 3300020069 Bacteria 635
98 Ga0197907_11486715 3300020069 Bacteria 689
99 Ga0206356_11435607 3300020070 Bacteria 1757
100 Ga0206355_1612851 3300020076 Bacteria 515
101 Ga0206352_11013907 3300020078 Bacteria 1007
102 Ga0206350_11073170 3300020080 Bacteria 830
103 Ga0206354_10538473 3300020081 Bacteria 1973
104 Ga0206353_10165397 3300020082 Bacteria 1033
105 Ga0213874_10001226 3300021377 Bacteria 5277
106 Ga0213874_10430312 3300021377 Bacteria 518
107 Ga0213876_10135853 3300021384 Bacteria 1308
108 Ga0213876_10385997 3300021384 Bacteria 745
109 Ga0224712_10081300 3300022467 Bacteria 1338
110 Ga0207707_11020099 3300025912 Bacteria 678
111 Ga0207695_10045566 3300025913 Bacteria 4654
112 Ga0207662_10119765 3300025918 Bacteria 1650
113 Ga0207649_10822458 3300025920 Bacteria 726
114 Ga0207694_10720778 3300025924 Bacteria 841
115 Ga0207687_10148732 3300025927 Bacteria 1785
116 Ga0207700_10025211 3300025928 Bacteria 4127
117 Ga0207700_10221873 3300025928 Bacteria 1603
118 Ga0207664_10010422 3300025929 Bacteria 6562
119 Ga0207706_11181781 3300025933 Bacteria 636
120 Ga0207709_10783732 3300025935 Bacteria 768
121 Ga0207670_10079722 3300025936 Bacteria 2287
122 Ga0207704_10017396 3300025938 Bacteria 3726
123 Ga0207704_10662950 3300025938 Bacteria 860
124 Ga0207689_10000433 3300025942 Bacteria 39201
125 Ga0207689_10411491 3300025942 Bacteria 1128
126 Ga0207689_10513638 3300025942 Bacteria 1004
127 Ga0207667_10199888 3300025949 Bacteria 2051
128 Ga0207667_10711465 3300025949 Bacteria 1006
129 Ga0207677_10191509 3300026023 Bacteria 1618
130 Ga0207677_10346112 3300026023 Bacteria 1244
131 Ga0207677_10885974 3300026023 Bacteria 804
132 Ga0207678_10081467 3300026067 Bacteria 2770
133 Ga0207678_11529583 3300026067 Bacteria 589
134 Ga0207708_10508603 3300026075 Unclassified 1010
135 Ga0207641_11061510 3300026088 Bacteria 808
136 Ga0207648_10002456 3300026089 Bacteria 19925
137 Ga0207648_10134646 3300026089 Bacteria 2176
138 Ga0207648_11437052 3300026089 Bacteria 648
139 Ga0207648_12195719 3300026089 Bacteria 513
140 Ga0207675_100205812 3300026118 Unclassified 1891
141 Ga0268266_10933736 3300028379 Bacteria 839
142 Ga0265338_10040439 3300028800 Bacteria 4379
143 Ga0307408_100000007 3300031548 Bacteria 463086
144 Ga0307408_101865114 3300031548 Bacteria 576
145 Ga0307405_10151800 3300031731 Bacteria 1630
146 Ga0307405_10323045 3300031731 Unclassified 1180
147 Ga0307413_10059945 3300031824 Bacteria 2341
148 Ga0307410_10000036 3300031852 Bacteria 48225
149 Ga0307410_10023211 3300031852 Bacteria 3852
150 Ga0307406_10043915 3300031901 Bacteria 2799
151 Ga0307407_10022479 3300031903 Bacteria 3273
152 Ga0307407_10045342 3300031903 Bacteria 2483
153 Ga0307412_10172890 3300031911 Bacteria 1617
154 Ga0307412_11620585 3300031911 Unclassified 591
155 Ga0307409_100001819 3300031995 Bacteria 10822
156 Ga0307409_100002888 3300031995 Bacteria 9107
157 Ga0307416_100000065 3300032002 Bacteria 94719
158 Ga0307416_100504748 3300032002 Bacteria 1275
159 Ga0307414_10299791 3300032004 Bacteria 1359
160 Ga0307411_10285153 3300032005 Bacteria 1316
161 Ga0307411_11047017 3300032005 Unclassified 733
162 Ga0307415_101985461 3300032126 Bacteria 566
163 Ga0307507_10428163 3300033179 Bacteria 740
164 Ga0373929_0234176 3300035085 Bacteria 527
165 Ga0373923_0122339 3300035111 Bacteria 1164
166 Ga0373946_0076755 3300035171 Bacteria 1455
167 Ga0373946_0311574 3300035171 Bacteria 780
168 Ga0373946_0319709 3300035171 Bacteria 771
169 Ga0373935_0628856 3300035692 Bacteria 786
170 Ga0373927_0136656 3300035695 Bacteria 1602
171 Ga0373947_0479079 3300035725 Bacteria 844
172 Ga0436364_0975733 3300037853 Bacteria 2173
173 Ga0395901_0251245 3300038443 Bacteria 1842
174 Ga0436365_0463496 3300039437 Bacteria 1439
175 Ga0436365_0471923 3300039437 Bacteria 4871
176 Ga0436363_0783737 3300039450 Bacteria 742
177 Ga0436363_1361534 3300039450 Bacteria 8627
178 Ga0451807_0041596 3300041486 Bacteria 625
179 Ga0451851_0287867 3300041507 Bacteria 910
180 Ga0439443_049666 3300042003 Bacteria 732
181 Ga0453683_0554729 3300044673 Bacteria 748
182 Ga0451576_0032678 3300045051 Bacteria 5536
183 Ga0451576_0385363 3300045051 Unclassified 1469
184 Ga0466967_0171102 3300045976 Bacteria 2044
185 Ga0466967_0843650 3300045976 Bacteria 910
186 Ga0495603_0127439 3300046455 Bacteria 1483
187 Ga0495641_0128441 3300046461 Bacteria 1131
188 Ga0495653_0831716 3300046463 Bacteria 553
189 Ga0495662_0498859 3300046476 Bacteria 597
190 Ga0495664_0052722 3300046477 Bacteria 2418
191 Ga0495594_0308709 3300046499 Bacteria 901
192 Ga0495596_0065688 3300046500 Bacteria 1411
193 Ga0495606_0003660 3300046507 Bacteria 16112
194 Ga0495652_0421600 3300046529 Bacteria 940
195 Ga0495587_0212555 3300046536 Bacteria 1092
196 Ga0495668_0252199 3300046616 Bacteria 966
197 Ga0495668_0340610 3300046616 Bacteria 823
198 Ga0495635_0471215 3300046663 Bacteria 829
199 Ga0495599_0034649 3300046678 Bacteria 3171
200 Ga0495624_0774628 3300046690 Bacteria 568
201 Ga0495674_0164976 3300047319 Bacteria 1852
202 Ga0495676_0194682 3300047321 Bacteria 1412
203 Ga0495685_042415 3300047447 Bacteria 1553
204 Ga0495686_0087751 3300047472 Bacteria 1892
205 Ga0496104_0620574 3300048907 Bacteria 991
206 Ga0496112_0000035 3300048915 Bacteria 106983
207 Ga0496112_0050225 3300048915 Bacteria 4090
208 Ga0496124_0145572 3300048927 Bacteria 1865
209 Ga0496126_0175510 3300048929 Bacteria 1823
210 Ga0496126_0253232 3300048929 Bacteria 1466
211 nmdc:mga08y16_874600_c1 3300050511 Bacteria 886
212 nmdc:mga08x19_698136_c1 3300050514 Bacteria 720
213 2676488406 2675903060 Bacteria 10051191
214 2884702060 2884693830 Bacteria 11273186
215 2895445400 2895442618 Bacteria 11027144
216 3005509063 3005506211 Bacteria 6943378
217 Ga0070704_100403235
218 rootL2_10033970
219 Ga0065707_11032946
220 Ga0070658_10394014
221 Ga0070658_11040392
222 Ga0070690_100067168
223 Ga0068869_100000117
224 Ga0068869_100266020
225 Ga0068869_101180525
226 Ga0070680_100573204
227 Ga0068868_100114971
228 Ga0068868_100222334
229 Ga0068868_101399451
230 Ga0070689_100010435
231 Ga0070687_100073674
232 Ga0070661_101182740
233 Ga0070692_10064559
234 Ga0070692_10566563
235 Ga0070675_101259846
236 Ga0070688_100001425
237 Ga0070688_100163311
238 Ga0070709_10780822
239 Ga0070714_100013688
240 Ga0070713_100007234
241 Ga0070713_100030425
242 Ga0070701_10133580
243 Ga0070700_100498393
244 Ga0070694_100246801
245 Ga0070694_101241971
246 Ga0070663_100011087
247 Ga0070663_102060632
248 Ga0070678_100005000
249 Ga0070681_10764340
250 Ga0070681_10850593
251 Ga0068867_100482189
252 Ga0070685_10409081
253 Ga0070699_100143163
254 Ga0070699_101236199
255 Ga0070699_101676803
256 Ga0070679_100605361
257 Ga0070679_102194170
258 Ga0070697_102087104
259 Ga0068853_100248994
260 Ga0070686_100277795
261 Ga0070696_100097878
262 Ga0070665_100338930
263 Ga0070665_100797415
264 Ga0070704_101675610
265 Ga0068855_100082351
266 Ga0068855_100237714
267 Ga0068855_102188153
268 Ga0068857_100053859
269 Ga0068852_100105959
270 Ga0068852_100884081
271 Ga0068859_100038692
272 Ga0068859_100324650
273 Ga0068861_100213711
274 Ga0068870_10341170
275 Ga0068863_101708037
276 Ga0068860_100793228
277 Ga0068862_100740734
278 Ga0081540_1070587
279 Ga0081540_1147689
280 Ga0070712_100420685
281 Ga0075367_10633395
282 Ga0097621_100002047
283 Ga0068871_100046695
284 Ga0075428_100051377
285 Ga0075434_100951933
286 Ga0068865_100005224
287 Ga0075436_100859318
288 Ga0097620_100038692
289 Ga0097620_100324629
290 Ga0111539_10163317
291 Ga0105245_10566289
292 Ga0105245_11499469
293 Ga0105243_11978843
294 Ga0105242_10565207
295 Ga0105248_12164283
296 Ga0105237_10332378
297 Ga0105238_10983358
298 Ga0105239_10509097
299 Ga0157370_11730184
300 Ga0157369_10013544
301 Ga0157374_10173253
302 Ga0157374_11619023
303 Ga0157378_10998940
304 Ga0157378_11118707
305 Ga0163162_10142470
306 Ga0157372_11631765
307 Ga0157375_10331956
308 Ga0157375_10528306
309 Ga0163163_12028888
310 Ga0157380_11277549
311 Ga0157377_10076402
312 Ga0197907_10313448
313 Ga0197907_10823111
314 Ga0197907_11486715
315 Ga0206356_11435607
316 Ga0206355_1612851
317 Ga0206352_11013907
318 Ga0206350_11073170
319 Ga0206354_10538473
320 Ga0206353_10165397
321 Ga0213874_10001226
322 Ga0213874_10430312
323 Ga0213876_10135853
324 Ga0213876_10385997
325 Ga0224712_10081300
326 Ga0207707_11020099
327 Ga0207695_10045566
328 Ga0207662_10119765
329 Ga0207649_10822458
330 Ga0207694_10720778
331 Ga0207687_10148732
332 Ga0207700_10025211
333 Ga0207700_10221873
334 Ga0207664_10010422
335 Ga0207706_11181781
336 Ga0207709_10783732
337 Ga0207670_10079722
338 Ga0207704_10017396
339 Ga0207704_10662950
340 Ga0207689_10000433
341 Ga0207689_10411491
342 Ga0207689_10513638
343 Ga0207667_10199888
344 Ga0207667_10711465
345 Ga0207677_10191509
346 Ga0207677_10346112
347 Ga0207677_10885974
348 Ga0207678_10081467
349 Ga0207678_11529583
350 Ga0207708_10508603
351 Ga0207641_11061510
352 Ga0207648_10002456
353 Ga0207648_10134646
354 Ga0207648_11437052
355 Ga0207648_12195719
356 Ga0207675_100205812
357 Ga0268266_10933736
358 Ga0265338_10040439
359 Ga0307408_100000007
360 Ga0307408_101865114
361 Ga0307405_10151800
362 Ga0307405_10323045
363 Ga0307413_10059945
364 Ga0307410_10000036
365 Ga0307410_10023211
366 Ga0307406_10043915
367 Ga0307407_10022479
368 Ga0307407_10045342
369 Ga0307412_10172890
370 Ga0307412_11620585
371 Ga0307409_100001819
372 Ga0307409_100002888
373 Ga0307416_100000065
374 Ga0307416_100504748
375 Ga0307414_10299791
376 Ga0307411_10285153
377 Ga0307411_11047017
378 Ga0307415_101985461
379 Ga0307507_10428163
380 Ga0373929_0234176
381 Ga0373923_0122339
382 Ga0373946_0076755
383 Ga0373946_0311574
384 Ga0373946_0319709
385 Ga0373935_0628856
386 Ga0373927_0136656
387 Ga0373947_0479079
388 Ga0436364_0975733
389 Ga0395901_0251245
390 Ga0436365_0463496
391 Ga0436365_0471923
392 Ga0436363_0783737
393 Ga0436363_1361534
394 Ga0451807_0041596
395 Ga0451851_0287867
396 Ga0439443_049666
397 Ga0453683_0554729
398 Ga0451576_0032678
399 Ga0451576_0385363
400 Ga0466967_0171102
401 Ga0466967_0843650
402 Ga0495603_0127439
403 Ga0495641_0128441
404 Ga0495653_0831716
405 Ga0495662_0498859
406 Ga0495664_0052722
407 Ga0495594_0308709
408 Ga0495596_0065688
409 Ga0495606_0003660
410 Ga0495652_0421600
411 Ga0495587_0212555
412 Ga0495668_0252199
413 Ga0495668_0340610
414 Ga0495635_0471215
415 Ga0495599_0034649
416 Ga0495624_0774628
417 Ga0495674_0164976
418 Ga0495676_0194682
419 Ga0495685_042415
420 Ga0495686_0087751
421 Ga0496104_0620574
422 Ga0496112_0000035
423 Ga0496112_0050225
424 Ga0496124_0145572
425 Ga0496126_0175510
426 Ga0496126_0253232
427 nmdc:mga08y16_874600_c1
428 nmdc:mga08x19_698136_c1
429 2676488406
430 2884702060
431 2895445400
432 3005509063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

11

100

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9382 5 96
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9373 21 95
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9307 5 94
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9207 6 95
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9172 6 95
ID Description Score Start End Superfamily
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9897 5 96 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9726 5 94 3.30.1360.20
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.944 4 96 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9389 5 96 3.30.1360.20
af_E9AH74_29_105_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9328 27 93 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A350DLC3-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 1.002 4 87 GO:0006729
GO:0008124
AF-A0A644UGE5-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 1.001 27 94 GO:0006729
GO:0008124
AF-A0A1N7KNP9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9996 21 93 GO:0006729
GO:0008124
AF-A0A2H9VSL8-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9991 21 95 GO:0006729
GO:0008124
AF-A0A1E5SUY8-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9987 21 94 GO:0006729
GO:0008124

Map