F327258

General Info

Members Datasets Scaffolds Average Seq Length
216 134 432 479

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10027351|Ga0070692_100273512
Length 529
Sequence VGHQFPLRSARGLGLQLTFANRSRQGADGFDLTFAPQLRINREQQLSIENLINSRLRAIAVVILVWAVIYLPALGSIAIKGEEGRRILPAVRMLETGNYIVPQVGSNPYYRKPPLVNWLVAASFKLFGVRNEWTARLPSALSVLAVAIAFVTVARASLGPRGSIIAAMIWLTNIGIIEKGRLIEIEALYVSLCGLAIILWLSFFLQKKSPWLIWLPASVFLGLGLLAKGPLHLIFFYGIVIAVLAYWKDWRVLVHPAHFVGLVVMVGIAAAWAIPFLRSTTSHVAIDKWSGQYTGRLKGIDFKFSDWIQNIPRGLIYFLPWVLLFPFARFSRLHEHSEQRLARALSWGIAVPVLALNLVPGAIPRYSMPAIVAESWLLGMICAGNAFQWPRGWMKDERVWARVMAAFVVLGLVIGAIGYPVTAIVLKNRQQVKTAAAEINALVPTNETLYAVNPDYQPVFFYVKSPVQYVSHVKNLPPNVRYFLVRNKNETEALIARDWAPLRARPIARVRDYSKREMVLFKVAPADED

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 7.87
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 21.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10027351 3300005345 Bacteria 2826
2 CNXas_1000007 3300000545 Bacteria 43751
3 JGI24035J26624_1000834 3300002126 Bacteria 2914
4 JGI25406J46586_10000020 3300003203 Bacteria 86123
5 rootL2_10058241 3300003322 Bacteria 12815
6 Ga0065712_10012578 3300005290 Unclassified 2850
7 Ga0065712_10097634 3300005290 Bacteria 2143
8 Ga0065715_10000762 3300005293 Bacteria 12324
9 Ga0065715_10000982 3300005293 Bacteria 10601
10 Ga0065715_10089220 3300005293 Bacteria 12350
11 Ga0065715_10100179 3300005293 Unclassified 3319
12 Ga0065715_10155493 3300005293 Unclassified 1682
13 Ga0070676_10018485 3300005328 Bacteria 3864
14 Ga0070690_100065920 3300005330 Bacteria 2342
15 Ga0070670_100073967 3300005331 Bacteria 2927
16 Ga0068869_100017030 3300005334 Unclassified 4916
17 Ga0068868_100044277 3300005338 Bacteria 3480
18 Ga0070660_100054924 3300005339 Bacteria 3077
19 Ga0070689_100014752 3300005340 Bacteria 5684
20 Ga0070689_100018989 3300005340 Bacteria 5076
21 Ga0070687_100018982 3300005343 Bacteria 3192
22 Ga0070687_100029196 3300005343 Bacteria 2683
23 Ga0070661_100025384 3300005344 Bacteria 4258
24 Ga0070668_100006655 3300005347 Bacteria 8569
25 Ga0070668_100039531 3300005347 Bacteria 3607
26 Ga0070669_100004081 3300005353 Bacteria 10575
27 Ga0070669_100040571 3300005353 Unclassified 3383
28 Ga0070669_100157796 3300005353 Bacteria 1761
29 Ga0070675_100001583 3300005354 Bacteria 16801
30 Ga0070675_100006473 3300005354 Bacteria 8993
31 Ga0070675_100017661 3300005354 Bacteria 5673
32 Ga0070675_100027645 3300005354 Bacteria 4559
33 Ga0070674_100075951 3300005356 Bacteria 2388
34 Ga0070673_100021136 3300005364 Bacteria 4710
35 Ga0070688_100025086 3300005365 Bacteria 3526
36 Ga0070688_100035476 3300005365 Unclassified 3030
37 Ga0070688_100121018 3300005365 Bacteria 1753
38 Ga0070659_100003742 3300005366 Bacteria 10851
39 Ga0070667_100072629 3300005367 Bacteria 2932
40 Ga0070714_100028987 3300005435 Bacteria 4598
41 Ga0070714_100034231 3300005435 Bacteria 4253
42 Ga0070713_100045503 3300005436 Unclassified 3597
43 Ga0070710_10026705 3300005437 Bacteria 3071
44 Ga0070705_100005709 3300005440 Bacteria 6077
45 Ga0070708_100090599 3300005445 Bacteria 2784
46 Ga0070708_100092227 3300005445 Bacteria 2759
47 Ga0070681_10016646 3300005458 Bacteria 7339
48 Ga0070706_100000012 3300005467 Bacteria 195040
49 Ga0070706_100034432 3300005467 Bacteria 4679
50 Ga0070706_100037566 3300005467 Bacteria 4473
51 Ga0070706_100039827 3300005467 Unclassified 4337
52 Ga0070706_100092831 3300005467 Bacteria 2800
53 Ga0070706_100102422 3300005467 Unclassified 2662
54 Ga0070707_100002304 3300005468 Bacteria 18243
55 Ga0070707_100009888 3300005468 Bacteria 8878
56 Ga0070707_100022855 3300005468 Bacteria 5912
57 Ga0070707_100044240 3300005468 Unclassified 4262
58 Ga0070707_100082020 3300005468 Bacteria 3114
59 Ga0070698_100000413 3300005471 Bacteria 45525
60 Ga0070698_100250890 3300005471 Unclassified 1702
61 Ga0070698_100257786 3300005471 Unclassified 1676
62 Ga0070699_100119026 3300005518 Bacteria 2322
63 Ga0070679_100012779 3300005530 Bacteria 8033
64 Ga0070684_100001230 3300005535 Bacteria 18389
65 Ga0070697_100000877 3300005536 Bacteria 22621
66 Ga0070697_100002803 3300005536 Bacteria 13427
67 Ga0070697_100011039 3300005536 Bacteria 7058
68 Ga0070697_100013419 3300005536 Bacteria 6426
69 Ga0070697_100015168 3300005536 Bacteria 6051
70 Ga0070697_100025936 3300005536 Unclassified 4675
71 Ga0070697_100052690 3300005536 Bacteria 3306
72 Ga0070697_100101489 3300005536 Bacteria 2390
73 Ga0070697_100159215 3300005536 Bacteria 1907
74 Ga0070686_100040139 3300005544 Bacteria 2919
75 Ga0070695_100132076 3300005545 Unclassified 1722
76 Ga0070704_100088572 3300005549 Bacteria 2300
77 Ga0070664_100079260 3300005564 Bacteria 2827
78 Ga0070664_100090156 3300005564 Unclassified 2653
79 Ga0068856_100012502 3300005614 Bacteria 8219
80 Ga0068861_100203989 3300005719 Unclassified 1661
81 Ga0068863_100036246 3300005841 Bacteria 4699
82 Ga0068860_100096599 3300005843 Unclassified 2816
83 Ga0068862_100036518 3300005844 Bacteria 4165
84 Ga0081455_10000547 3300005937 Bacteria 48774
85 Ga0081455_10011367 3300005937 Bacteria 8948
86 Ga0081455_10011991 3300005937 Bacteria 8675
87 Ga0081455_10133117 3300005937 Bacteria 1941
88 Ga0081540_1000016 3300005983 Bacteria 165370
89 Ga0081539_10000052 3300005985 Bacteria 268240
90 Ga0081539_10005712 3300005985 Bacteria 12453
91 Ga0081539_10072898 3300005985 Bacteria 1834
92 Ga0070717_10011302 3300006028 Bacteria 6775
93 Ga0070717_10015078 3300006028 Bacteria 5959
94 Ga0070712_100005686 3300006175 Bacteria 7710
95 Ga0070712_100064104 3300006175 Bacteria 2605
96 Ga0070712_100097844 3300006175 Bacteria 2163
97 Ga0068865_100016346 3300006881 Unclassified 4747
98 Ga0105245_10126848 3300009098 Bacteria 2390
99 Ga0114129_10005519 3300009147 Bacteria 17888
100 Ga0114129_10388886 3300009147 Unclassified 1840
101 Ga0105243_10021771 3300009148 Unclassified 4868
102 Ga0105242_10087159 3300009176 Unclassified 2621
103 Ga0105249_10054488 3300009553 Unclassified 3657
104 Ga0099796_10010993 3300010159 Bacteria 2510
105 Ga0105239_10093380 3300010375 Bacteria 3322
106 Ga0157374_10000124 3300013296 Bacteria 70277
107 Ga0157374_10092005 3300013296 Bacteria 2893
108 Ga0157374_10104911 3300013296 Bacteria 2714
109 Ga0157374_10139578 3300013296 Bacteria 2352
110 Ga0157378_10013648 3300013297 Bacteria 7104
111 Ga0157378_10023356 3300013297 Bacteria 5442
112 Ga0157378_10219404 3300013297 Bacteria 1807
113 Ga0163162_10032556 3300013306 Bacteria 5179
114 Ga0163162_10165197 3300013306 Bacteria 2337
115 Ga0157372_10045387 3300013307 Unclassified 4874
116 Ga0157372_10089930 3300013307 Bacteria 3489
117 Ga0157375_10021927 3300013308 Bacteria 5870
118 Ga0157375_10081515 3300013308 Unclassified 3276
119 Ga0157375_10227194 3300013308 Viruses 2025
120 Ga0163163_10177686 3300014325 Bacteria 2176
121 Ga0163163_10227263 3300014325 Bacteria 1915
122 Ga0157379_10049426 3300014968 Bacteria 3755
123 Ga0157376_10002533 3300014969 Bacteria 12385
124 Ga0163161_10038913 3300017792 Unclassified 3412
125 Ga0213876_10000668 3300021384 Bacteria 24442
126 Ga0209050_1002578 3300025298 Bacteria 15071
127 Ga0207697_10000910 3300025315 Bacteria 16718
128 Ga0207697_10000987 3300025315 Bacteria 15911
129 Ga0207697_10003031 3300025315 Bacteria 8444
130 Ga0207697_10032121 3300025315 Unclassified 2148
131 Ga0207653_10001847 3300025885 Bacteria 6763
132 Ga0207647_10040818 3300025904 Bacteria 2920
133 Ga0207645_10002727 3300025907 Bacteria 13752
134 Ga0207645_10005412 3300025907 Bacteria 9258
135 Ga0207684_10000028 3300025910 Bacteria 306450
136 Ga0207684_10005208 3300025910 Bacteria 12086
137 Ga0207684_10007109 3300025910 Bacteria 10117
138 Ga0207684_10012557 3300025910 Bacteria 7362
139 Ga0207684_10030663 3300025910 Bacteria 4576
140 Ga0207684_10030932 3300025910 Bacteria 4556
141 Ga0207693_10044279 3300025915 Unclassified 3498
142 Ga0207693_10065230 3300025915 Bacteria 2852
143 Ga0207693_10094098 3300025915 Bacteria 2349
144 Ga0207660_10115376 3300025917 Bacteria 2027
145 Ga0207662_10003888 3300025918 Bacteria 7776
146 Ga0207646_10000734 3300025922 Bacteria 42601
147 Ga0207646_10007409 3300025922 Bacteria 11154
148 Ga0207646_10014461 3300025922 Bacteria 7495
149 Ga0207646_10016773 3300025922 Bacteria 6871
150 Ga0207646_10083867 3300025922 Bacteria 2850
151 Ga0207646_10100955 3300025922 Unclassified 2587
152 Ga0207659_10026138 3300025926 Bacteria 3935
153 Ga0207659_10036746 3300025926 Bacteria 3396
154 Ga0207700_10061719 3300025928 Unclassified 2844
155 Ga0207644_10073640 3300025931 Unclassified 2505
156 Ga0207690_10001063 3300025932 Bacteria 17575
157 Ga0207706_10006989 3300025933 Bacteria 10429
158 Ga0207670_10005418 3300025936 Bacteria 6999
159 Ga0207669_10010164 3300025937 Unclassified 4519
160 Ga0207665_10017640 3300025939 Unclassified 4690
161 Ga0207691_10004768 3300025940 Bacteria 13115
162 Ga0207689_10041940 3300025942 Bacteria 3787
163 Ga0207661_10014059 3300025944 Bacteria 5856
164 Ga0207661_10049724 3300025944 Bacteria 3338
165 Ga0207651_10078646 3300025960 Bacteria 2366
166 Ga0207668_10013787 3300025972 Bacteria 4988
167 Ga0207668_10035266 3300025972 Unclassified 3328
168 Ga0207658_10172639 3300025986 Unclassified 1782
169 Ga0207677_10030586 3300026023 Bacteria 3439
170 Ga0207677_10074153 3300026023 Bacteria 2413
171 Ga0207641_10098013 3300026088 Bacteria 2577
172 Ga0207683_10058711 3300026121 Unclassified 3378
173 Ga0209974_10034193 3300027876 Bacteria 1688
174 Ga0268266_10044746 3300028379 Bacteria 3784
175 Ga0307513_10024479 3300031456 Bacteria 7025
176 Ga0373943_0021280 3300035170 Bacteria 2994
177 Ga0373955_0004170 3300035172 Bacteria 6378
178 Ga0373947_0004396 3300035725 Bacteria 8265
179 Ga0373947_0019043 3300035725 Unclassified 3956
180 Ga0373947_0021991 3300035725 Bacteria 3696
181 Ga0395900_0009306 3300037418 Bacteria 10071
182 Ga0395905_0015247 3300037471 Bacteria 7307
183 Ga0436364_0310882 3300037853 Bacteria 2845
184 Ga0395901_0016205 3300038443 Bacteria 7592
185 Ga0436365_1432120 3300039437 Bacteria 33957
186 Ga0439460_0010993 3300042461 Bacteria 2329
187 Ga0466967_0070380 3300045976 Bacteria 3130
188 Ga0495594_0097542 3300046499 Bacteria 1652
189 Ga0495630_0092545 3300046517 Unclassified 2285
190 Ga0495586_0017718 3300046535 Bacteria 3789
191 Ga0495667_0021966 3300046559 Bacteria 4302
192 Ga0495669_0019465 3300046684 Bacteria 2930
193 Ga0495613_0057212 3300046689 Bacteria 2863
194 Ga0495674_0111945 3300047319 Unclassified 2313
195 Ga0496101_0010586 3300048904 Bacteria 6092
196 Ga0496102_0003433 3300048905 Bacteria 13430
197 Ga0496102_0032957 3300048905 Bacteria 4656
198 Ga0496102_0160114 3300048905 Bacteria 2117
199 Ga0496103_0012818 3300048906 Bacteria 4972
200 Ga0496104_0097690 3300048907 Unclassified 2811
201 Ga0496104_0110852 3300048907 Archaea 2631
202 Ga0496107_0001614 3300048910 Bacteria 14042
203 Ga0496108_0081625 3300048911 Unclassified 2740
204 Ga0496109_0012179 3300048912 Bacteria 7420
205 Ga0496109_0248212 3300048912 Unclassified 1676
206 Ga0496110_0106027 3300048913 Unclassified 2522
207 Ga0496111_0049647 3300048914 Unclassified 3026
208 Ga0496112_0038290 3300048915 Bacteria 4682
209 Ga0496113_0112540 3300048916 Bacteria 2120
210 Ga0496114_0019884 3300048917 Bacteria 5445
211 Ga0496115_0015642 3300048918 Bacteria 5759
212 nmdc:mga05p37_3657_c1 3300050507 Bacteria 17976
213 nmdc:mga0n895_141842_c1 3300050512 Unclassified 2431
214 Ga0495601_0029334 3300053077 Unclassified 3411
215 Ga0495612_0020230 3300053078 Unclassified 2668
216 Ga0500616_0002569 3300053153 Bacteria 14952
217 Ga0070692_10027351
218 CNXas_1000007
219 JGI24035J26624_1000834
220 JGI25406J46586_10000020
221 rootL2_10058241
222 Ga0065712_10012578
223 Ga0065712_10097634
224 Ga0065715_10000762
225 Ga0065715_10000982
226 Ga0065715_10089220
227 Ga0065715_10100179
228 Ga0065715_10155493
229 Ga0070676_10018485
230 Ga0070690_100065920
231 Ga0070670_100073967
232 Ga0068869_100017030
233 Ga0068868_100044277
234 Ga0070660_100054924
235 Ga0070689_100014752
236 Ga0070689_100018989
237 Ga0070687_100018982
238 Ga0070687_100029196
239 Ga0070661_100025384
240 Ga0070668_100006655
241 Ga0070668_100039531
242 Ga0070669_100004081
243 Ga0070669_100040571
244 Ga0070669_100157796
245 Ga0070675_100001583
246 Ga0070675_100006473
247 Ga0070675_100017661
248 Ga0070675_100027645
249 Ga0070674_100075951
250 Ga0070673_100021136
251 Ga0070688_100025086
252 Ga0070688_100035476
253 Ga0070688_100121018
254 Ga0070659_100003742
255 Ga0070667_100072629
256 Ga0070714_100028987
257 Ga0070714_100034231
258 Ga0070713_100045503
259 Ga0070710_10026705
260 Ga0070705_100005709
261 Ga0070708_100090599
262 Ga0070708_100092227
263 Ga0070681_10016646
264 Ga0070706_100000012
265 Ga0070706_100034432
266 Ga0070706_100037566
267 Ga0070706_100039827
268 Ga0070706_100092831
269 Ga0070706_100102422
270 Ga0070707_100002304
271 Ga0070707_100009888
272 Ga0070707_100022855
273 Ga0070707_100044240
274 Ga0070707_100082020
275 Ga0070698_100000413
276 Ga0070698_100250890
277 Ga0070698_100257786
278 Ga0070699_100119026
279 Ga0070679_100012779
280 Ga0070684_100001230
281 Ga0070697_100000877
282 Ga0070697_100002803
283 Ga0070697_100011039
284 Ga0070697_100013419
285 Ga0070697_100015168
286 Ga0070697_100025936
287 Ga0070697_100052690
288 Ga0070697_100101489
289 Ga0070697_100159215
290 Ga0070686_100040139
291 Ga0070695_100132076
292 Ga0070704_100088572
293 Ga0070664_100079260
294 Ga0070664_100090156
295 Ga0068856_100012502
296 Ga0068861_100203989
297 Ga0068863_100036246
298 Ga0068860_100096599
299 Ga0068862_100036518
300 Ga0081455_10000547
301 Ga0081455_10011367
302 Ga0081455_10011991
303 Ga0081455_10133117
304 Ga0081540_1000016
305 Ga0081539_10000052
306 Ga0081539_10005712
307 Ga0081539_10072898
308 Ga0070717_10011302
309 Ga0070717_10015078
310 Ga0070712_100005686
311 Ga0070712_100064104
312 Ga0070712_100097844
313 Ga0068865_100016346
314 Ga0105245_10126848
315 Ga0114129_10005519
316 Ga0114129_10388886
317 Ga0105243_10021771
318 Ga0105242_10087159
319 Ga0105249_10054488
320 Ga0099796_10010993
321 Ga0105239_10093380
322 Ga0157374_10000124
323 Ga0157374_10092005
324 Ga0157374_10104911
325 Ga0157374_10139578
326 Ga0157378_10013648
327 Ga0157378_10023356
328 Ga0157378_10219404
329 Ga0163162_10032556
330 Ga0163162_10165197
331 Ga0157372_10045387
332 Ga0157372_10089930
333 Ga0157375_10021927
334 Ga0157375_10081515
335 Ga0157375_10227194
336 Ga0163163_10177686
337 Ga0163163_10227263
338 Ga0157379_10049426
339 Ga0157376_10002533
340 Ga0163161_10038913
341 Ga0213876_10000668
342 Ga0209050_1002578
343 Ga0207697_10000910
344 Ga0207697_10000987
345 Ga0207697_10003031
346 Ga0207697_10032121
347 Ga0207653_10001847
348 Ga0207647_10040818
349 Ga0207645_10002727
350 Ga0207645_10005412
351 Ga0207684_10000028
352 Ga0207684_10005208
353 Ga0207684_10007109
354 Ga0207684_10012557
355 Ga0207684_10030663
356 Ga0207684_10030932
357 Ga0207693_10044279
358 Ga0207693_10065230
359 Ga0207693_10094098
360 Ga0207660_10115376
361 Ga0207662_10003888
362 Ga0207646_10000734
363 Ga0207646_10007409
364 Ga0207646_10014461
365 Ga0207646_10016773
366 Ga0207646_10083867
367 Ga0207646_10100955
368 Ga0207659_10026138
369 Ga0207659_10036746
370 Ga0207700_10061719
371 Ga0207644_10073640
372 Ga0207690_10001063
373 Ga0207706_10006989
374 Ga0207670_10005418
375 Ga0207669_10010164
376 Ga0207665_10017640
377 Ga0207691_10004768
378 Ga0207689_10041940
379 Ga0207661_10014059
380 Ga0207661_10049724
381 Ga0207651_10078646
382 Ga0207668_10013787
383 Ga0207668_10035266
384 Ga0207658_10172639
385 Ga0207677_10030586
386 Ga0207677_10074153
387 Ga0207641_10098013
388 Ga0207683_10058711
389 Ga0209974_10034193
390 Ga0268266_10044746
391 Ga0307513_10024479
392 Ga0373943_0021280
393 Ga0373955_0004170
394 Ga0373947_0004396
395 Ga0373947_0019043
396 Ga0373947_0021991
397 Ga0395900_0009306
398 Ga0395905_0015247
399 Ga0436364_0310882
400 Ga0395901_0016205
401 Ga0436365_1432120
402 Ga0439460_0010993
403 Ga0466967_0070380
404 Ga0495594_0097542
405 Ga0495630_0092545
406 Ga0495586_0017718
407 Ga0495667_0021966
408 Ga0495669_0019465
409 Ga0495613_0057212
410 Ga0495674_0111945
411 Ga0496101_0010586
412 Ga0496102_0003433
413 Ga0496102_0032957
414 Ga0496102_0160114
415 Ga0496103_0012818
416 Ga0496104_0097690
417 Ga0496104_0110852
418 Ga0496107_0001614
419 Ga0496108_0081625
420 Ga0496109_0012179
421 Ga0496109_0248212
422 Ga0496110_0106027
423 Ga0496111_0049647
424 Ga0496112_0038290
425 Ga0496113_0112540
426 Ga0496114_0019884
427 Ga0496115_0015642
428 nmdc:mga05p37_3657_c1
429 nmdc:mga0n895_141842_c1
430 Ga0495601_0029334
431 Ga0495612_0020230
432 Ga0500616_0002569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02366

PMT

Dolichyl-phosphate-mannose-protein mannosyltransferase

88

284

0.81

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

111

274

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iz4-assembly1.cif.gz_B modified e. coli tmrna in the resume state with the trna-like domain in the ribosomal p site interacting with the smpb 0.735 481 506
4rww-assembly1.cif.gz_A crystal structure of l. monocytogenes psta in complex with cyclic-di-amp 0.6625 461 507
6p25-assembly1.cif.gz_A structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor and a peptide acceptor 0.658 39 271
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.6099 467 506
7bx8-assembly1.cif.gz_B "mycobacterium smegmatis arabinosyltransferase complex embb2-acpm2 in symmetric ""resting state""" 0.5953 24 377
ID Description Score Start End Superfamily
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.5506 468 506 2.40.280.10
af_Q4CXJ5_292_479_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.5395 462 506 3.30.70.1230
af_P0AFV2_139_215_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5298 461 502 3.30.70.260
1d5rA01 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5089 411 456 3.90.190.10
af_A4HRF2_233_382_3.10.310.20 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;DHHA2 domain 0.5025 458 506 3.10.310.20
ID Description Score Start End GO Terms
AF-A0A7W1CTL7-F1-model_v4 Glycosyltransferase family 39 protein 0.9603 44 166 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A7W1CTL7-F1-model_v4 Glycosyltransferase family 39 protein 0.9528 44 166 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A2V6FGZ6-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9522 39 294 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A2V6FGZ6-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9379 39 294 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A2V5PNK7-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9325 41 316 GO:0005886
GO:0009103
GO:0010041
GO:0016763

Map