F327009

General Info

Members Datasets Scaffolds Average Seq Length
215 161 430 126

Family's Representative Sequence

Representative Sequence 3300053154|Ga0500619_229800|Ga0500619_229800_14_523
Length 147
Sequence MARSVMSARLPIGVATTYSAPGTEKSSTTQVAGDAGEARALAHLLAQGLTLVQRNYRVARGPNARGGEIDLIMRDRDGTLVFVEVRSRGSGDFGGAAASVSVAKQRSLVLAARHYLARLRTAPPCRFDVVAIDGDRIEWLRAAFDAA

Samples

Sample ID Description Type Environment
1 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
150 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
151 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0.93
Rhizoplane 4.19
Rhizosphere 77.67
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500619_229800 3300053154 Bacteria 616
2 rootL2_10125392 3300003322 Bacteria 1860
3 Ga0055540_1019128 3300003792 Bacteria 1856
4 Ga0070690_100243302 3300005330 Bacteria 1269
5 Ga0070677_10158247 3300005333 Bacteria 1060
6 Ga0068869_100037679 3300005334 Bacteria 3439
7 Ga0068869_100718851 3300005334 Bacteria 853
8 Ga0070666_10004964 3300005335 Bacteria 8137
9 Ga0068868_100071179 3300005338 Bacteria 2773
10 Ga0068868_100205272 3300005338 Bacteria 1645
11 Ga0070689_100108153 3300005340 Bacteria 2209
12 Ga0070687_100007350 3300005343 Bacteria 4586
13 Ga0070661_100542744 3300005344 Bacteria 935
14 Ga0070692_10317560 3300005345 Bacteria 957
15 Ga0070668_100011220 3300005347 Bacteria 6672
16 Ga0070668_100417392 3300005347 Bacteria 1148
17 Ga0070668_100690298 3300005347 Bacteria 900
18 Ga0070669_100005052 3300005353 Bacteria 9535
19 Ga0070675_102175861 3300005354 Bacteria 511
20 Ga0070671_100081189 3300005355 Bacteria 2711
21 Ga0070671_101444877 3300005355 Unclassified 608
22 Ga0070674_100014971 3300005356 Bacteria 4831
23 Ga0070674_100036414 3300005356 Bacteria 3303
24 Ga0070674_100045232 3300005356 Bacteria 3007
25 Ga0070674_100447357 3300005356 Bacteria 1065
26 Ga0070674_100514355 3300005356 Bacteria 999
27 Ga0070659_100340187 3300005366 Bacteria 1257
28 Ga0070667_100003930 3300005367 Bacteria 12627
29 Ga0070667_100014033 3300005367 Bacteria 6622
30 Ga0070667_100374430 3300005367 Bacteria 1292
31 Ga0070700_100100239 3300005441 Bacteria 1907
32 Ga0070700_100149068 3300005441 Bacteria 1598
33 Ga0070678_100031929 3300005456 Bacteria 3639
34 Ga0070678_100155384 3300005456 Bacteria 1847
35 Ga0070678_100471080 3300005456 Bacteria 1103
36 Ga0068867_100005419 3300005459 Bacteria 9026
37 Ga0068867_100019779 3300005459 Bacteria 4798
38 Ga0068867_100365794 3300005459 Bacteria 1207
39 Ga0070698_101058147 3300005471 Bacteria 759
40 Ga0070672_100684004 3300005543 Bacteria 898
41 Ga0070686_100137162 3300005544 Bacteria 1699
42 Ga0070686_100304726 3300005544 Bacteria 1183
43 Ga0068855_100195850 3300005563 Bacteria 2277
44 Ga0068852_100127462 3300005616 Bacteria 2339
45 Ga0068852_101788807 3300005616 Unclassified 637
46 Ga0068859_100103112 3300005617 Bacteria 2911
47 Ga0068866_10112329 3300005718 Bacteria 1523
48 Ga0068861_100012288 3300005719 Bacteria 5972
49 Ga0068863_100024587 3300005841 Bacteria 5744
50 Ga0068860_100005573 3300005843 Bacteria 12731
51 Ga0068862_100046119 3300005844 Bacteria 3720
52 Ga0075368_10073739 3300006042 Bacteria 1382
53 Ga0075364_10013870 3300006051 Bacteria 4967
54 Ga0070716_100390439 3300006173 Bacteria 998
55 Ga0075367_10143102 3300006178 Bacteria 1482
56 Ga0075366_10001589 3300006195 Bacteria 11365
57 Ga0075370_10004362 3300006353 Bacteria 6858
58 Ga0075370_10105188 3300006353 Bacteria 1636
59 Ga0068865_100073414 3300006881 Bacteria 2433
60 Ga0068865_100468702 3300006881 Bacteria 1044
61 Ga0097620_100103108 3300006931 Bacteria 2911
62 Ga0099826_10000008 3300006948 Bacteria 380974
63 Ga0111539_10284496 3300009094 Bacteria 1924
64 Ga0105245_11324443 3300009098 Bacteria 769
65 Ga0105245_11622427 3300009098 Bacteria 699
66 Ga0105247_10637804 3300009101 Bacteria 794
67 Ga0105243_10028423 3300009148 Bacteria 4293
68 Ga0105243_11260467 3300009148 Bacteria 755
69 Ga0105242_10321691 3300009176 Bacteria 1419
70 Ga0105242_11644674 3300009176 Bacteria 677
71 Ga0105248_11517244 3300009177 Bacteria 759
72 Ga0105249_10024011 3300009553 Bacteria 5476
73 Ga0105249_10244903 3300009553 Bacteria 1774
74 Ga0157371_10231147 3300013102 Bacteria 1329
75 Ga0157370_11198949 3300013104 Bacteria 685
76 Ga0163162_10255727 3300013306 Bacteria 1883
77 Ga0157375_10081299 3300013308 Bacteria 3280
78 Ga0157380_10012446 3300014326 Bacteria 6173
79 Ga0157380_10013453 3300014326 Bacteria 5966
80 Ga0157380_10140606 3300014326 Bacteria 2074
81 Ga0157380_11333230 3300014326 Bacteria 766
82 Ga0157377_10168055 3300014745 Bacteria 1369
83 Ga0157379_10153561 3300014968 Bacteria 2076
84 Ga0157376_11061038 3300014969 Bacteria 835
85 Ga0157376_12456171 3300014969 Bacteria 561
86 Ga0157376_12515270 3300014969 Bacteria 555
87 Ga0209051_1002733 3300025303 Bacteria 12248
88 Ga0207656_10629447 3300025321 Bacteria 548
89 Ga0207682_10007508 3300025893 Bacteria 4337
90 Ga0207642_10839845 3300025899 Bacteria 586
91 Ga0207688_10071005 3300025901 Bacteria 1976
92 Ga0207645_10032119 3300025907 Bacteria 3375
93 Ga0207705_10026362 3300025909 Bacteria 4145
94 Ga0207662_10011198 3300025918 Bacteria 4966
95 Ga0207649_10394801 3300025920 Bacteria 1034
96 Ga0207681_10000326 3300025923 Bacteria 34311
97 Ga0207659_10241281 3300025926 Bacteria 1462
98 Ga0207687_10123492 3300025927 Bacteria 1940
99 Ga0207690_10789398 3300025932 Bacteria 784
100 Ga0207706_10060434 3300025933 Bacteria 3337
101 Ga0207706_10436632 3300025933 Bacteria 1134
102 Ga0207709_10020486 3300025935 Bacteria 3731
103 Ga0207709_10921993 3300025935 Bacteria 711
104 Ga0207669_10021656 3300025937 Bacteria 3398
105 Ga0207669_10077795 3300025937 Bacteria 2111
106 Ga0207669_10448359 3300025937 Bacteria 1022
107 Ga0207691_10046443 3300025940 Bacteria 3990
108 Ga0207689_10046880 3300025942 Bacteria 3570
109 Ga0207667_10165069 3300025949 Bacteria 2277
110 Ga0207712_10757619 3300025961 Bacteria 851
111 Ga0207668_10005962 3300025972 Bacteria 7183
112 Ga0207640_10096488 3300025981 Bacteria 2061
113 Ga0207658_10001421 3300025986 Bacteria 18669
114 Ga0207677_10671962 3300026023 Bacteria 916
115 Ga0207703_10001042 3300026035 Bacteria 26535
116 Ga0207708_10033746 3300026075 Bacteria 3890
117 Ga0207708_10061551 3300026075 Bacteria 2866
118 Ga0207641_10005975 3300026088 Bacteria 10314
119 Ga0207648_10026948 3300026089 Bacteria 5104
120 Ga0207648_10031284 3300026089 Bacteria 4705
121 Ga0207674_10491911 3300026116 Bacteria 1185
122 Ga0207683_10025621 3300026121 Bacteria 5088
123 Ga0207698_10162904 3300026142 Bacteria 1953
124 Ga0207698_11375069 3300026142 Bacteria 721
125 Ga0209282_1000005 3300027666 Bacteria 380858
126 Ga0209813_10036621 3300027866 Bacteria 1475
127 Ga0207428_10110601 3300027907 Bacteria 2115
128 Ga0268265_10023943 3300028380 Bacteria 4312
129 Ga0307515_10040816 3300028794 Bacteria 7325
130 Ga0265327_10000085 3300031251 Bacteria 203068
131 Ga0307513_10047770 3300031456 Bacteria 4653
132 Ga0307513_10094761 3300031456 Bacteria 3029
133 Ga0307509_10012095 3300031507 Bacteria 10355
134 Ga0307509_10118719 3300031507 Bacteria 2627
135 Ga0307509_10121555 3300031507 Bacteria 2588
136 Ga0307509_10168437 3300031507 Bacteria 2074
137 Ga0307509_10168862 3300031507 Bacteria 2071
138 Ga0307509_10243064 3300031507 Bacteria 1591
139 Ga0307509_10391601 3300031507 Bacteria 1099
140 Ga0307508_10075010 3300031616 Bacteria 2959
141 Ga0307516_10393931 3300031730 Bacteria 1045
142 Ga0307516_10708369 3300031730 Bacteria 664
143 Ga0307410_10150195 3300031852 Bacteria 1734
144 Ga0307412_10073456 3300031911 Bacteria 2340
145 Ga0307416_100031585 3300032002 Bacteria 3989
146 Ga0307414_10632440 3300032004 Bacteria 963
147 Ga0307411_10112109 3300032005 Bacteria 1954
148 Ga0307411_11274684 3300032005 Bacteria 669
149 Ga0307415_100337762 3300032126 Bacteria 1263
150 Ga0307507_10127490 3300033179 Bacteria 2006
151 Ga0307510_10045661 3300033180 Bacteria 4724
152 Ga0373928_0069024 3300035084 Bacteria 870
153 Ga0373939_0061306 3300035114 Bacteria 1198
154 Ga0373931_0011986 3300035691 Bacteria 4196
155 Ga0373931_0033043 3300035691 Bacteria 2679
156 Ga0373925_0598429 3300037068 Bacteria 908
157 Ga0436364_0750065 3300037853 Bacteria 607
158 Ga0451802_1455081 3300041460 Bacteria 585
159 Ga0451802_1503012 3300041460 Bacteria 582
160 Ga0451853_0015134 3300041512 Bacteria 1952
161 Ga0451853_3113767 3300041512 Bacteria 810
162 Ga0450907_014807 3300042146 Bacteria 1302
163 Ga0451576_0195603 3300045051 Bacteria 2112
164 Ga0495590_0307482 3300046457 Bacteria 597
165 Ga0495650_0004038 3300046471 Bacteria 10282
166 Ga0495585_0109724 3300046492 Bacteria 1468
167 Ga0495583_0214922 3300046506 Bacteria 778
168 Ga0495606_0129129 3300046507 Bacteria 1504
169 Ga0495606_0569321 3300046507 Bacteria 560
170 Ga0495631_0016306 3300046518 Bacteria 3545
171 Ga0495631_0041190 3300046518 Bacteria 2044
172 Ga0495642_0107759 3300046528 Bacteria 1189
173 Ga0495586_0680988 3300046535 Bacteria 594
174 Ga0495597_0015392 3300046542 Bacteria 3623
175 Ga0495597_0143090 3300046542 Bacteria 985
176 Ga0495597_0188923 3300046542 Bacteria 829
177 Ga0495622_0460305 3300046557 Bacteria 545
178 Ga0495668_0037627 3300046616 Bacteria 2707
179 Ga0495661_0077886 3300046665 Bacteria 1919
180 Ga0495588_0186199 3300046674 Bacteria 1097
181 Ga0495669_0073730 3300046684 Bacteria 1559
182 Ga0495670_0343011 3300046691 Bacteria 803
183 Ga0495671_0053143 3300046692 Bacteria 2011
184 Ga0495604_0139657 3300047317 Bacteria 1732
185 Ga0495683_0076358 3300047323 Bacteria 1639
186 Ga0495677_0113861 3300047445 Bacteria 1029
187 Ga0495681_0227537 3300047470 Bacteria 745
188 Ga0495615_0154818 3300048090 Bacteria 685
189 Ga0495626_0000005 3300048091 Bacteria 337534
190 Ga0496102_0008960 3300048905 Bacteria 8584
191 Ga0496102_0011310 3300048905 Bacteria 7688
192 Ga0496105_0108397 3300048908 Bacteria 2293
193 Ga0496109_0037860 3300048912 Bacteria 4359
194 Ga0496110_0097255 3300048913 Bacteria 2638
195 Ga0496110_0236824 3300048913 Bacteria 1661
196 Ga0496115_0001797 3300048918 Bacteria 15376
197 Ga0501042_0664686 3300049578 Bacteria 757
198 Ga0501043_0000071 3300049579 Bacteria 89105
199 Ga0501046_0005339 3300049580 Bacteria 11495
200 Ga0501047_0000087 3300049581 Bacteria 117516
201 Ga0501048_0005504 3300049582 Bacteria 9635
202 Ga0501068_0981715 3300049584 Bacteria 557
203 Ga0501241_090965 3300049758 Bacteria 646
204 Ga0501265_001742 3300049762 Bacteria 2470
205 Ga0501270_174847 3300049767 Bacteria 504
206 Ga0501045_0004384 3300049824 Bacteria 9729
207 nmdc:mga00v17_1830_c2 3300050491 Bacteria 9313
208 nmdc:mga0k408_16757_c1 3300050493 Bacteria 4072
209 nmdc:mga07m45_185180_c1 3300050496 Bacteria 1211
210 nmdc:mga08y16_319018_c1 3300050511 Bacteria 1600
211 Ga0500572_273180 3300053111 Bacteria 547
212 Ga0500595_013895 3300053119 Bacteria 3072
213 Ga0500614_040193 3300053123 Bacteria 1186
214 Ga0500652_075088 3300053131 Bacteria 1404
215 Ga0500590_031142 3300053148 Bacteria 2765
216 Ga0500619_229800
217 rootL2_10125392
218 Ga0055540_1019128
219 Ga0070690_100243302
220 Ga0070677_10158247
221 Ga0068869_100037679
222 Ga0068869_100718851
223 Ga0070666_10004964
224 Ga0068868_100071179
225 Ga0068868_100205272
226 Ga0070689_100108153
227 Ga0070687_100007350
228 Ga0070661_100542744
229 Ga0070692_10317560
230 Ga0070668_100011220
231 Ga0070668_100417392
232 Ga0070668_100690298
233 Ga0070669_100005052
234 Ga0070675_102175861
235 Ga0070671_100081189
236 Ga0070671_101444877
237 Ga0070674_100014971
238 Ga0070674_100036414
239 Ga0070674_100045232
240 Ga0070674_100447357
241 Ga0070674_100514355
242 Ga0070659_100340187
243 Ga0070667_100003930
244 Ga0070667_100014033
245 Ga0070667_100374430
246 Ga0070700_100100239
247 Ga0070700_100149068
248 Ga0070678_100031929
249 Ga0070678_100155384
250 Ga0070678_100471080
251 Ga0068867_100005419
252 Ga0068867_100019779
253 Ga0068867_100365794
254 Ga0070698_101058147
255 Ga0070672_100684004
256 Ga0070686_100137162
257 Ga0070686_100304726
258 Ga0068855_100195850
259 Ga0068852_100127462
260 Ga0068852_101788807
261 Ga0068859_100103112
262 Ga0068866_10112329
263 Ga0068861_100012288
264 Ga0068863_100024587
265 Ga0068860_100005573
266 Ga0068862_100046119
267 Ga0075368_10073739
268 Ga0075364_10013870
269 Ga0070716_100390439
270 Ga0075367_10143102
271 Ga0075366_10001589
272 Ga0075370_10004362
273 Ga0075370_10105188
274 Ga0068865_100073414
275 Ga0068865_100468702
276 Ga0097620_100103108
277 Ga0099826_10000008
278 Ga0111539_10284496
279 Ga0105245_11324443
280 Ga0105245_11622427
281 Ga0105247_10637804
282 Ga0105243_10028423
283 Ga0105243_11260467
284 Ga0105242_10321691
285 Ga0105242_11644674
286 Ga0105248_11517244
287 Ga0105249_10024011
288 Ga0105249_10244903
289 Ga0157371_10231147
290 Ga0157370_11198949
291 Ga0163162_10255727
292 Ga0157375_10081299
293 Ga0157380_10012446
294 Ga0157380_10013453
295 Ga0157380_10140606
296 Ga0157380_11333230
297 Ga0157377_10168055
298 Ga0157379_10153561
299 Ga0157376_11061038
300 Ga0157376_12456171
301 Ga0157376_12515270
302 Ga0209051_1002733
303 Ga0207656_10629447
304 Ga0207682_10007508
305 Ga0207642_10839845
306 Ga0207688_10071005
307 Ga0207645_10032119
308 Ga0207705_10026362
309 Ga0207662_10011198
310 Ga0207649_10394801
311 Ga0207681_10000326
312 Ga0207659_10241281
313 Ga0207687_10123492
314 Ga0207690_10789398
315 Ga0207706_10060434
316 Ga0207706_10436632
317 Ga0207709_10020486
318 Ga0207709_10921993
319 Ga0207669_10021656
320 Ga0207669_10077795
321 Ga0207669_10448359
322 Ga0207691_10046443
323 Ga0207689_10046880
324 Ga0207667_10165069
325 Ga0207712_10757619
326 Ga0207668_10005962
327 Ga0207640_10096488
328 Ga0207658_10001421
329 Ga0207677_10671962
330 Ga0207703_10001042
331 Ga0207708_10033746
332 Ga0207708_10061551
333 Ga0207641_10005975
334 Ga0207648_10026948
335 Ga0207648_10031284
336 Ga0207674_10491911
337 Ga0207683_10025621
338 Ga0207698_10162904
339 Ga0207698_11375069
340 Ga0209282_1000005
341 Ga0209813_10036621
342 Ga0207428_10110601
343 Ga0268265_10023943
344 Ga0307515_10040816
345 Ga0265327_10000085
346 Ga0307513_10047770
347 Ga0307513_10094761
348 Ga0307509_10012095
349 Ga0307509_10118719
350 Ga0307509_10121555
351 Ga0307509_10168437
352 Ga0307509_10168862
353 Ga0307509_10243064
354 Ga0307509_10391601
355 Ga0307508_10075010
356 Ga0307516_10393931
357 Ga0307516_10708369
358 Ga0307410_10150195
359 Ga0307412_10073456
360 Ga0307416_100031585
361 Ga0307414_10632440
362 Ga0307411_10112109
363 Ga0307411_11274684
364 Ga0307415_100337762
365 Ga0307507_10127490
366 Ga0307510_10045661
367 Ga0373928_0069024
368 Ga0373939_0061306
369 Ga0373931_0011986
370 Ga0373931_0033043
371 Ga0373925_0598429
372 Ga0436364_0750065
373 Ga0451802_1455081
374 Ga0451802_1503012
375 Ga0451853_0015134
376 Ga0451853_3113767
377 Ga0450907_014807
378 Ga0451576_0195603
379 Ga0495590_0307482
380 Ga0495650_0004038
381 Ga0495585_0109724
382 Ga0495583_0214922
383 Ga0495606_0129129
384 Ga0495606_0569321
385 Ga0495631_0016306
386 Ga0495631_0041190
387 Ga0495642_0107759
388 Ga0495586_0680988
389 Ga0495597_0015392
390 Ga0495597_0143090
391 Ga0495597_0188923
392 Ga0495622_0460305
393 Ga0495668_0037627
394 Ga0495661_0077886
395 Ga0495588_0186199
396 Ga0495669_0073730
397 Ga0495670_0343011
398 Ga0495671_0053143
399 Ga0495604_0139657
400 Ga0495683_0076358
401 Ga0495677_0113861
402 Ga0495681_0227537
403 Ga0495615_0154818
404 Ga0495626_0000005
405 Ga0496102_0008960
406 Ga0496102_0011310
407 Ga0496105_0108397
408 Ga0496109_0037860
409 Ga0496110_0097255
410 Ga0496110_0236824
411 Ga0496115_0001797
412 Ga0501042_0664686
413 Ga0501043_0000071
414 Ga0501046_0005339
415 Ga0501047_0000087
416 Ga0501048_0005504
417 Ga0501068_0981715
418 Ga0501241_090965
419 Ga0501265_001742
420 Ga0501270_174847
421 Ga0501045_0004384
422 nmdc:mga00v17_1830_c2
423 nmdc:mga0k408_16757_c1
424 nmdc:mga07m45_185180_c1
425 nmdc:mga08y16_319018_c1
426 Ga0500572_273180
427 Ga0500595_013895
428 Ga0500614_040193
429 Ga0500652_075088
430 Ga0500590_031142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

36

132

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8943 16 127
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8692 16 127
5gkj-assembly1.cif.gz_A structure of endoms in apo form 0.8067 51 68
5tss-assembly2.cif.gz_B toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form 0.7948 28 63
1ts2-assembly3.cif.gz_C t128a mutant of toxic shock syndrome toxin-1 from s. aureus 0.7748 29 63
ID Description Score Start End Superfamily
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.903 16 127 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8815 17 125 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8775 16 127 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8436 17 125 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8008 16 121 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A643FFQ3-F1-model_v4 UPF0102 protein F7Q92_03430 0.9557 2 127 GO:0003676
AF-A0A1I4VAU5-F1-model_v4 UPF0102 protein SAMN05444747_11297 0.9544 13 127 GO:0003676
GO:0004519
AF-A0A1N6VF15-F1-model_v4 UPF0102 protein SAMN05880557_105320 0.9474 10 125 GO:0003676
GO:0004519
AF-A0A7V8FYJ9-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoheptose isomerase (EC 5.3.1.28) (Sedoheptulose 7-phosphate isomerase); UPF0102 protein GAK35_01121] 0.9471 9 126 GO:0003676
GO:0005737
GO:0005975
GO:0008270
GO:0008968
GO:0097367
GO:2001061
AF-A0A4Q5WER5-F1-model_v4 deleted 0.9445 13 127

Map