F326727

General Info

Members Datasets Scaffolds Average Seq Length
215 141 430 334

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0827323|Ga0451841_0827323_331_1419
Length 362
Sequence LFYHLFDQDMESERMPQANFAYSPTIDAFDSEAQDPAANLVAGLPLALSVFADRAHVRDQMRDDAAAAGFRIAEVADMASLLEGDARPLGDVVLLDCPVISGAGLAALSRLDLRAANSGAQLIVSTSVDALDDVFACLDQSGPQLLVDPGRGERVVALGRALAQIPNLRVRELGEEDRLMLLRLTEQVSQIAQRLERLAPSPAAARIDRARDGDEAGRAFRFESPKPGFSGDVDDESKRLARSTRPALPEPRLVRRIIRQRQLRARFFDGDLFADPAWDILLDLTAARAEHARVSVTSLCIASGVPPTTALRWIAQMVETGLLERIEDEVDRRRAFIALTDKAADSMARYFAELGSTGTRLT

Samples

Sample ID Description Type Environment
1 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
113 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
125 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
126 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
127 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
128 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
129 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
130 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
131 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
132 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
133 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
134 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
135 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
136 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
137 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
138 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
139 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
140 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
141 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 0
Isolates 6.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.07
Nodule 1.4
Rhizoplane 5.12
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451841_0827323 3300041498 Bacteria 2247
2 SwRhRL2b_contig_1294097 2162886007 Bacteria 7314
3 Ga0065704_10072029 3300005289 Bacteria 9354
4 Ga0070670_100044452 3300005331 Bacteria 3820
5 Ga0070666_10058199 3300005335 Bacteria 2613
6 Ga0070666_10209678 3300005335 Bacteria 1372
7 Ga0070668_100051408 3300005347 Bacteria 3175
8 Ga0070668_100075885 3300005347 Bacteria 2625
9 Ga0070669_100000135 3300005353 Bacteria 66559
10 Ga0070669_100000143 3300005353 Bacteria 64072
11 Ga0070669_100133816 3300005353 Bacteria 1905
12 Ga0070671_100000499 3300005355 Bacteria 27413
13 Ga0070671_100003628 3300005355 Bacteria 12080
14 Ga0070667_100003364 3300005367 Bacteria 13653
15 Ga0070667_100004988 3300005367 Bacteria 11124
16 Ga0070667_100008402 3300005367 Bacteria 8561
17 Ga0070665_100000150 3300005548 Bacteria 127885
18 Ga0070665_100002115 3300005548 Bacteria 22199
19 Ga0070665_100005585 3300005548 Bacteria 12932
20 Ga0068854_100008016 3300005578 Bacteria 6767
21 Ga0068854_100377461 3300005578 Bacteria 1167
22 Ga0068864_100005038 3300005618 Bacteria 10821
23 Ga0068863_100000052 3300005841 Bacteria 125430
24 Ga0068863_100012521 3300005841 Bacteria 8185
25 Ga0068863_100296376 3300005841 Bacteria 1568
26 Ga0068858_100005693 3300005842 Bacteria 12179
27 Ga0068858_100086705 3300005842 Bacteria 2912
28 Ga0068860_100000007 3300005843 Bacteria 429329
29 Ga0068860_100062473 3300005843 Bacteria 3539
30 Ga0068860_100324461 3300005843 Bacteria 1511
31 Ga0068862_100006744 3300005844 Bacteria 9519
32 Ga0068862_100009481 3300005844 Bacteria 8054
33 Ga0068862_100010618 3300005844 Bacteria 7610
34 Ga0068862_100198450 3300005844 Bacteria 1808
35 Ga0075365_10006021 3300006038 Bacteria 6623
36 Ga0075368_10030699 3300006042 Bacteria 2081
37 Ga0075363_100049393 3300006048 Bacteria 2240
38 Ga0075364_10023956 3300006051 Bacteria 3870
39 Ga0075364_10074375 3300006051 Bacteria 2240
40 Ga0075362_10000001 3300006177 Bacteria 215983
41 Ga0075362_10006406 3300006177 Bacteria 4387
42 Ga0075367_10010256 3300006178 Bacteria 4918
43 Ga0075369_10000698 3300006186 Bacteria 10786
44 Ga0075369_10003854 3300006186 Bacteria 5500
45 Ga0075369_10037418 3300006186 Bacteria 2067
46 Ga0075366_10002103 3300006195 Bacteria 10130
47 Ga0075366_10031528 3300006195 Bacteria 3120
48 Ga0075370_10000317 3300006353 Bacteria 17336
49 Ga0079104_1014131 3300006946 Bacteria 2424
50 Ga0079104_1033371 3300006946 Bacteria 1260
51 Ga0105251_10000622 3300009011 Bacteria 32588
52 Ga0105247_10094767 3300009101 Bacteria 1900
53 Ga0114129_10425316 3300009147 Bacteria 1746
54 Ga0105248_10028710 3300009177 Bacteria 6200
55 Ga0105248_10142103 3300009177 Bacteria 2708
56 Ga0105248_10191531 3300009177 Bacteria 2304
57 Ga0105249_10376060 3300009553 Bacteria 1445
58 Ga0157371_10174428 3300013102 Bacteria 1537
59 Ga0163162_10026301 3300013306 Bacteria 5751
60 Ga0163162_10093125 3300013306 Bacteria 3098
61 Ga0163161_10045989 3300017792 Bacteria 3148
62 Ga0207696_1006177 3300025711 Bacteria 4869
63 Ga0207713_1001095 3300025735 Bacteria 23209
64 Ga0207680_10098850 3300025903 Bacteria 1871
65 Ga0207681_10000062 3300025923 Bacteria 99856
66 Ga0207681_10000252 3300025923 Bacteria 40749
67 Ga0207650_10183466 3300025925 Bacteria 1669
68 Ga0207644_10006639 3300025931 Bacteria 7537
69 Ga0207644_10090473 3300025931 Bacteria 2280
70 Ga0207711_10009515 3300025941 Bacteria 8106
71 Ga0207711_10130363 3300025941 Bacteria 2254
72 Ga0207640_10031298 3300025981 Bacteria 3286
73 Ga0207640_10214192 3300025981 Bacteria 1470
74 Ga0207658_10001033 3300025986 Bacteria 22656
75 Ga0207658_10002523 3300025986 Bacteria 13322
76 Ga0207658_10027686 3300025986 Bacteria 3985
77 Ga0207703_10005705 3300026035 Bacteria 9986
78 Ga0207703_10081833 3300026035 Bacteria 2693
79 Ga0207641_10000042 3300026088 Bacteria 186384
80 Ga0207641_10002632 3300026088 Bacteria 16447
81 Ga0207698_10078057 3300026142 Bacteria 2657
82 Ga0209281_1006861 3300027111 Bacteria 2909
83 Ga0209983_1003157 3300027665 Bacteria 3540
84 Ga0209813_10000127 3300027866 Bacteria 27860
85 Ga0268266_10000124 3300028379 Bacteria 153051
86 Ga0268266_10010445 3300028379 Bacteria 8113
87 Ga0268265_10007579 3300028380 Bacteria 7321
88 Ga0268265_10008854 3300028380 Bacteria 6801
89 Ga0268265_10019291 3300028380 Bacteria 4736
90 Ga0268264_10000134 3300028381 Bacteria 179475
91 Ga0268264_10003710 3300028381 Bacteria 13120
92 Ga0268264_10017486 3300028381 Bacteria 5871
93 Ga0265327_10100069 3300031251 Bacteria 1400
94 Ga0307405_10001926 3300031731 Bacteria 8946
95 Ga0307413_10013341 3300031824 Bacteria 4127
96 Ga0307413_10076602 3300031824 Bacteria 2126
97 Ga0307413_10296574 3300031824 Bacteria 1224
98 Ga0307410_10031797 3300031852 Bacteria 3390
99 Ga0307410_10069827 3300031852 Bacteria 2431
100 Ga0307410_10094558 3300031852 Bacteria 2129
101 Ga0307406_10031283 3300031901 Bacteria 3239
102 Ga0307412_10041914 3300031911 Bacteria 2970
103 Ga0307412_10089299 3300031911 Bacteria 2152
104 Ga0307409_100054595 3300031995 Bacteria 3078
105 Ga0307409_100082863 3300031995 Bacteria 2598
106 Ga0307416_100233216 3300032002 Bacteria 1776
107 Ga0307414_10076564 3300032004 Bacteria 2431
108 Ga0307411_10185706 3300032005 Bacteria 1582
109 Ga0307411_10204251 3300032005 Bacteria 1520
110 Ga0307415_100022746 3300032126 Bacteria 3876
111 Ga0307415_100149167 3300032126 Bacteria 1797
112 Ga0307510_10139335 3300033180 Bacteria 2074
113 Ga0316582_0001258 3300036647 Bacteria 10946
114 Ga0316584_0011183 3300036712 Bacteria 6300
115 Ga0451853_0180335 3300041512 Bacteria 2547
116 Ga0453684_0416764 3300044712 Bacteria 1501
117 Ga0451576_0000007 3300045051 Bacteria 782228
118 Ga0495627_000090 3300046453 Bacteria 109622
119 Ga0495638_0033289 3300046460 Bacteria 3297
120 Ga0495650_0000818 3300046471 Bacteria 37910
121 Ga0495605_0103008 3300046474 Bacteria 1309
122 Ga0495596_0000045 3300046500 Bacteria 89699
123 Ga0495607_0001139 3300046501 Bacteria 24100
124 Ga0495607_0014587 3300046501 Bacteria 5110
125 Ga0495606_0012474 3300046507 Bacteria 6810
126 Ga0495610_0000015 3300046512 Bacteria 391489
127 Ga0495610_0000756 3300046512 Bacteria 30516
128 Ga0495632_0001659 3300046519 Bacteria 18247
129 Ga0495632_0025921 3300046519 Bacteria 3094
130 Ga0495643_0000048 3300046522 Bacteria 212788
131 Ga0495643_0003479 3300046522 Bacteria 11494
132 Ga0495643_0035453 3300046522 Bacteria 2747
133 Ga0495654_0078225 3300046530 Bacteria 1555
134 Ga0495598_0011323 3300046537 Bacteria 2160
135 Ga0495609_0002650 3300046538 Bacteria 10851
136 Ga0495625_0008004 3300046660 Bacteria 9077
137 Ga0495625_0039565 3300046660 Bacteria 3442
138 Ga0495661_0152747 3300046665 Bacteria 1246
139 Ga0495681_0000048 3300047470 Bacteria 110216
140 Ga0496100_0003172 3300048903 Bacteria 8531
141 Ga0496101_0004917 3300048904 Bacteria 8480
142 Ga0496102_0021366 3300048905 Bacteria 5724
143 Ga0496103_0000097 3300048906 Bacteria 97276
144 Ga0496103_0087111 3300048906 Bacteria 1968
145 Ga0496104_0000047 3300048907 Bacteria 148896
146 Ga0496104_0089306 3300048907 Bacteria 2944
147 Ga0496105_0000786 3300048908 Bacteria 21442
148 Ga0496105_0000977 3300048908 Bacteria 19670
149 Ga0496107_0063838 3300048910 Bacteria 2669
150 Ga0496113_0001015 3300048916 Bacteria 15095
151 Ga0496117_0132908 3300048920 Bacteria 1504
152 Ga0496118_0003311 3300048921 Bacteria 20433
153 Ga0496118_0029043 3300048921 Bacteria 4645
154 Ga0496119_0000928 3300048922 Bacteria 37926
155 Ga0496120_0000668 3300048923 Bacteria 50396
156 Ga0496121_0000070 3300048924 Bacteria 249187
157 Ga0496121_0000513 3300048924 Bacteria 73772
158 Ga0496121_0004464 3300048924 Bacteria 18796
159 Ga0496121_0012165 3300048924 Bacteria 9441
160 Ga0496121_0121808 3300048924 Bacteria 1969
161 Ga0496122_0001260 3300048925 Bacteria 42389
162 Ga0496123_0004311 3300048926 Bacteria 15097
163 Ga0496123_0056867 3300048926 Bacteria 2552
164 Ga0496124_0190408 3300048927 Bacteria 1570
165 Ga0496125_0003543 3300048928 Bacteria 18804
166 Ga0496125_0004257 3300048928 Bacteria 16663
167 Ga0496126_0001290 3300048929 Bacteria 40086
168 Ga0496126_0008823 3300048929 Bacteria 10812
169 Ga0501034_0078616 3300049571 Bacteria 3303
170 Ga0501034_0186447 3300049571 Bacteria 2038
171 Ga0501038_0245467 3300049574 Bacteria 1420
172 Ga0501044_0010788 3300049823 Bacteria 9912
173 nmdc:mga03683_100_c1 3300050489 Bacteria 30068
174 nmdc:mga03683_158_c1 3300050489 Bacteria 22670
175 nmdc:mga03n38_1236_c1 3300050490 Bacteria 7179
176 nmdc:mga00v17_53621_c1 3300050491 Bacteria 2458
177 nmdc:mga00v17_5959_c1 3300050491 Bacteria 6447
178 nmdc:mga0k408_93_c1 3300050493 Bacteria 42678
179 nmdc:mga06z11_100_c1 3300050494 Bacteria 36184
180 nmdc:mga04h51_149_c1 3300050495 Bacteria 20513
181 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
182 nmdc:mga07m45_41_c1 3300050496 Bacteria 61718
183 nmdc:mga05p37_392236_c1 3300050507 Bacteria 1623
184 nmdc:mga08x19_312723_c1 3300050514 Bacteria 1092
185 nmdc:mga0sz30_109_c1 3300050516 Bacteria 31084
186 nmdc:mga0sz30_45968_c1 3300050516 Bacteria 1842
187 nmdc:mga0sz30_4864_c1 3300050516 Bacteria 2730
188 nmdc:mga0sz30_885_c1 3300050516 Bacteria 10786
189 Ga0500643_000001 3300053087 Bacteria 1440111
190 Ga0500643_015661 3300053087 Bacteria 2592
191 Ga0500643_047551 3300053087 Bacteria 1236
192 Ga0500607_000168 3300053121 Bacteria 57382
193 Ga0500608_053442 3300053122 Bacteria 1939
194 Ga0500618_001115 3300053125 Bacteria 13135
195 Ga0500559_0002823 3300053136 Bacteria 8775
196 Ga0500564_001861 3300053138 Bacteria 7518
197 Ga0500573_0128897 3300053140 Bacteria 1403
198 Ga0500590_000486 3300053148 Bacteria 13628
199 Ga0500567_000970 3300053723 Bacteria 10984
200 Ga0500625_000019 3300053729 Bacteria 93445
201 2511127475 2510917021 Bacteria 5705459
202 2643948624 2643221588 Bacteria 3692460
203 2738711283 2738541275 Bacteria 4830863
204 2738849708 2738541301 Bacteria 4834102
205 2738865437 2738541304 Bacteria 4833665
206 2739297955 2738543022 Bacteria 4835059
207 2739359633 2738543033 Bacteria 4833336
208 2739649174 2739367664 Bacteria 4114334
209 2740027647 2739367865 Bacteria 4114482
210 2882808473 2882806704 Bacteria 3007728
211 2895884239 2895880812 Bacteria 11255272
212 2919139495 2919138771 Bacteria 5281312
213 2928104029 2928100450 Bacteria 4837635
214 2928961428 2928959182 Bacteria 4725774
215 8054305068 8054302542 Bacteria 5698134
216 Ga0451841_0827323
217 SwRhRL2b_contig_1294097
218 Ga0065704_10072029
219 Ga0070670_100044452
220 Ga0070666_10058199
221 Ga0070666_10209678
222 Ga0070668_100051408
223 Ga0070668_100075885
224 Ga0070669_100000135
225 Ga0070669_100000143
226 Ga0070669_100133816
227 Ga0070671_100000499
228 Ga0070671_100003628
229 Ga0070667_100003364
230 Ga0070667_100004988
231 Ga0070667_100008402
232 Ga0070665_100000150
233 Ga0070665_100002115
234 Ga0070665_100005585
235 Ga0068854_100008016
236 Ga0068854_100377461
237 Ga0068864_100005038
238 Ga0068863_100000052
239 Ga0068863_100012521
240 Ga0068863_100296376
241 Ga0068858_100005693
242 Ga0068858_100086705
243 Ga0068860_100000007
244 Ga0068860_100062473
245 Ga0068860_100324461
246 Ga0068862_100006744
247 Ga0068862_100009481
248 Ga0068862_100010618
249 Ga0068862_100198450
250 Ga0075365_10006021
251 Ga0075368_10030699
252 Ga0075363_100049393
253 Ga0075364_10023956
254 Ga0075364_10074375
255 Ga0075362_10000001
256 Ga0075362_10006406
257 Ga0075367_10010256
258 Ga0075369_10000698
259 Ga0075369_10003854
260 Ga0075369_10037418
261 Ga0075366_10002103
262 Ga0075366_10031528
263 Ga0075370_10000317
264 Ga0079104_1014131
265 Ga0079104_1033371
266 Ga0105251_10000622
267 Ga0105247_10094767
268 Ga0114129_10425316
269 Ga0105248_10028710
270 Ga0105248_10142103
271 Ga0105248_10191531
272 Ga0105249_10376060
273 Ga0157371_10174428
274 Ga0163162_10026301
275 Ga0163162_10093125
276 Ga0163161_10045989
277 Ga0207696_1006177
278 Ga0207713_1001095
279 Ga0207680_10098850
280 Ga0207681_10000062
281 Ga0207681_10000252
282 Ga0207650_10183466
283 Ga0207644_10006639
284 Ga0207644_10090473
285 Ga0207711_10009515
286 Ga0207711_10130363
287 Ga0207640_10031298
288 Ga0207640_10214192
289 Ga0207658_10001033
290 Ga0207658_10002523
291 Ga0207658_10027686
292 Ga0207703_10005705
293 Ga0207703_10081833
294 Ga0207641_10000042
295 Ga0207641_10002632
296 Ga0207698_10078057
297 Ga0209281_1006861
298 Ga0209983_1003157
299 Ga0209813_10000127
300 Ga0268266_10000124
301 Ga0268266_10010445
302 Ga0268265_10007579
303 Ga0268265_10008854
304 Ga0268265_10019291
305 Ga0268264_10000134
306 Ga0268264_10003710
307 Ga0268264_10017486
308 Ga0265327_10100069
309 Ga0307405_10001926
310 Ga0307413_10013341
311 Ga0307413_10076602
312 Ga0307413_10296574
313 Ga0307410_10031797
314 Ga0307410_10069827
315 Ga0307410_10094558
316 Ga0307406_10031283
317 Ga0307412_10041914
318 Ga0307412_10089299
319 Ga0307409_100054595
320 Ga0307409_100082863
321 Ga0307416_100233216
322 Ga0307414_10076564
323 Ga0307411_10185706
324 Ga0307411_10204251
325 Ga0307415_100022746
326 Ga0307415_100149167
327 Ga0307510_10139335
328 Ga0316582_0001258
329 Ga0316584_0011183
330 Ga0451853_0180335
331 Ga0453684_0416764
332 Ga0451576_0000007
333 Ga0495627_000090
334 Ga0495638_0033289
335 Ga0495650_0000818
336 Ga0495605_0103008
337 Ga0495596_0000045
338 Ga0495607_0001139
339 Ga0495607_0014587
340 Ga0495606_0012474
341 Ga0495610_0000015
342 Ga0495610_0000756
343 Ga0495632_0001659
344 Ga0495632_0025921
345 Ga0495643_0000048
346 Ga0495643_0003479
347 Ga0495643_0035453
348 Ga0495654_0078225
349 Ga0495598_0011323
350 Ga0495609_0002650
351 Ga0495625_0008004
352 Ga0495625_0039565
353 Ga0495661_0152747
354 Ga0495681_0000048
355 Ga0496100_0003172
356 Ga0496101_0004917
357 Ga0496102_0021366
358 Ga0496103_0000097
359 Ga0496103_0087111
360 Ga0496104_0000047
361 Ga0496104_0089306
362 Ga0496105_0000786
363 Ga0496105_0000977
364 Ga0496107_0063838
365 Ga0496113_0001015
366 Ga0496117_0132908
367 Ga0496118_0003311
368 Ga0496118_0029043
369 Ga0496119_0000928
370 Ga0496120_0000668
371 Ga0496121_0000070
372 Ga0496121_0000513
373 Ga0496121_0004464
374 Ga0496121_0012165
375 Ga0496121_0121808
376 Ga0496122_0001260
377 Ga0496123_0004311
378 Ga0496123_0056867
379 Ga0496124_0190408
380 Ga0496125_0003543
381 Ga0496125_0004257
382 Ga0496126_0001290
383 Ga0496126_0008823
384 Ga0501034_0078616
385 Ga0501034_0186447
386 Ga0501038_0245467
387 Ga0501044_0010788
388 nmdc:mga03683_100_c1
389 nmdc:mga03683_158_c1
390 nmdc:mga03n38_1236_c1
391 nmdc:mga00v17_53621_c1
392 nmdc:mga00v17_5959_c1
393 nmdc:mga0k408_93_c1
394 nmdc:mga06z11_100_c1
395 nmdc:mga04h51_149_c1
396 nmdc:mga07m45_15_c1
397 nmdc:mga07m45_41_c1
398 nmdc:mga05p37_392236_c1
399 nmdc:mga08x19_312723_c1
400 nmdc:mga0sz30_109_c1
401 nmdc:mga0sz30_45968_c1
402 nmdc:mga0sz30_4864_c1
403 nmdc:mga0sz30_885_c1
404 Ga0500643_000001
405 Ga0500643_015661
406 Ga0500643_047551
407 Ga0500607_000168
408 Ga0500608_053442
409 Ga0500618_001115
410 Ga0500559_0002823
411 Ga0500564_001861
412 Ga0500573_0128897
413 Ga0500590_000486
414 Ga0500567_000970
415 Ga0500625_000019
416 2511127475
417 2643948624
418 2738711283
419 2738849708
420 2738865437
421 2739297955
422 2739359633
423 2739649174
424 2740027647
425 2882808473
426 2895884239
427 2919139495
428 2928104029
429 2928961428
430 8054305068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13463

HTH_27

Winged helix DNA-binding domain

280

343

0.85

Map