F326575

General Info

Members Datasets Scaffolds Average Seq Length
215 179 213 81

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10195127|Ga0265325_101951272
Length 88
Sequence MPTVLWIGNLRVVVYPNDHRPAHVHVIGQGREAVFELMNRPAGRTVEGPVTLRENYGFSRRDLARIERALIQHLIELLRAWERIHGEA

Samples

Sample ID Description Type Environment
1 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
167 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0.47
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0.47
Rhizoplane 3.26
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10226198 3300005289 Unclassified 1057
2 Ga0065712_10504165 3300005290 Bacteria 647
3 Ga0065715_10525295 3300005293 Bacteria 760
4 Ga0070658_10120638 3300005327 Bacteria 2178
5 Ga0070670_100277348 3300005331 Bacteria 1464
6 Ga0070677_10682955 3300005333 Bacteria 577
7 Ga0068869_101485098 3300005334 Bacteria 601
8 Ga0070666_10254916 3300005335 Bacteria 1243
9 Ga0068868_100792645 3300005338 Unclassified 854
10 Ga0070691_10887745 3300005341 Bacteria 549
11 Ga0070675_100237279 3300005354 Bacteria 1592
12 Ga0070675_101508398 3300005354 Bacteria 620
13 Ga0070671_100079561 3300005355 Bacteria 2740
14 Ga0070681_11942259 3300005458 Unclassified 516
15 Ga0070706_101101430 3300005467 Unclassified 731
16 Ga0070697_100389971 3300005536 Unclassified 1207
17 Ga0070672_101755888 3300005543 Bacteria 558
18 Ga0070665_100014298 3300005548 Bacteria 7970
19 Ga0070665_100320296 3300005548 Unclassified 1555
20 Ga0070704_101593094 3300005549 Unclassified 602
21 Ga0068855_100274752 3300005563 Bacteria 1873
22 Ga0068855_102603521 3300005563 Bacteria 502
23 Ga0068857_100572950 3300005577 Bacteria 1065
24 Ga0068859_100195545 3300005617 Bacteria 2107
25 Ga0068864_100335854 3300005618 Bacteria 1423
26 Ga0068861_101200874 3300005719 Bacteria 733
27 Ga0068862_100946639 3300005844 Bacteria 849
28 Ga0068862_101354513 3300005844 Unclassified 714
29 Ga0081455_10012712 3300005937 Bacteria 8376
30 Ga0081455_10600474 3300005937 Unclassified 718
31 Ga0081538_10195446 3300005981 Bacteria 840
32 Ga0070716_100621901 3300006173 Unclassified 815
33 Ga0075428_100618159 3300006844 Bacteria 1156
34 Ga0075430_101506021 3300006846 Unclassified 553
35 Ga0068865_100516259 3300006881 Bacteria 998
36 Ga0097620_100195541 3300006931 Bacteria 2107
37 Ga0099794_10811136 3300007265 Unclassified 500
38 Ga0105240_12094227 3300009093 Bacteria 587
39 Ga0105245_11381006 3300009098 Bacteria 754
40 Ga0105247_11188028 3300009101 Bacteria 607
41 Ga0105248_11470641 3300009177 Unclassified 771
42 Ga0105238_10324840 3300009551 Bacteria 1525
43 Ga0105246_10224035 3300011119 Bacteria 1476
44 Ga0157370_10055206 3300013104 Bacteria 3785
45 Ga0157374_10202110 3300013296 Bacteria 1946
46 Ga0157378_11137286 3300013297 Unclassified 819
47 Ga0163162_10361302 3300013306 Bacteria 1585
48 Ga0157372_13080863 3300013307 Unclassified 532
49 Ga0163163_10025431 3300014325 Bacteria 5643
50 Ga0163163_12493501 3300014325 Bacteria 575
51 Ga0182008_10857737 3300014497 Bacteria 531
52 Ga0157376_10255842 3300014969 Bacteria 1638
53 Ga0206353_10185164 3300020082 Bacteria 717
54 Ga0209233_1064407 3300025261 Unclassified 697
55 Ga0209676_1006388 3300025292 Bacteria 5833
56 Ga0209758_1000657 3300025297 Bacteria 51923
57 Ga0209050_1006764 3300025298 Bacteria 6686
58 Ga0209051_1004310 3300025303 Bacteria 8833
59 Ga0207647_10623429 3300025904 Unclassified 593
60 Ga0207705_10823942 3300025909 Unclassified 720
61 Ga0207684_10048589 3300025910 Bacteria 3598
62 Ga0207707_10873993 3300025912 Unclassified 745
63 Ga0207650_11367605 3300025925 Bacteria 602
64 Ga0207650_11688985 3300025925 Bacteria 537
65 Ga0207659_10052238 3300025926 Bacteria 2910
66 Ga0207644_10642953 3300025931 Unclassified 882
67 Ga0207644_11314636 3300025931 Bacteria 608
68 Ga0207704_10777132 3300025938 Unclassified 798
69 Ga0207667_10241383 3300025949 Bacteria 1849
70 Ga0207677_11257069 3300026023 Unclassified 679
71 Ga0207641_10427595 3300026088 Bacteria 1276
72 Ga0207676_10056085 3300026095 Bacteria 3096
73 Ga0207675_101423241 3300026118 Bacteria 714
74 Ga0209969_1027109 3300027360 Bacteria 868
75 Ga0209974_10162849 3300027876 Bacteria 810
76 Ga0268266_10272956 3300028379 Bacteria 1570
77 Ga0268266_10273350 3300028379 Unclassified 1569
78 Ga0268265_11240470 3300028380 Bacteria 744
79 Ga0265328_10050823 3300031239 Bacteria 1522
80 Ga0265325_10195127 3300031241 Unclassified 936
81 Ga0265340_10000772 3300031247 Bacteria 18216
82 Ga0265331_10000667 3300031250 Bacteria 29636
83 Ga0265327_10068661 3300031251 Bacteria 1782
84 Ga0265316_10009099 3300031344 Bacteria 9148
85 Ga0307408_101428567 3300031548 Bacteria 652
86 Ga0265313_10158031 3300031595 Unclassified 964
87 Ga0265342_10587432 3300031712 Unclassified 562
88 Ga0307413_10170156 3300031824 Bacteria 1541
89 Ga0307410_10809563 3300031852 Bacteria 797
90 Ga0307407_10137542 3300031903 Bacteria 1572
91 Ga0307416_103218173 3300032002 Bacteria 546
92 Ga0307414_11218347 3300032004 Bacteria 697
93 Ga0307411_10086195 3300032005 Bacteria 2178
94 Ga0373939_0217342 3300035114 Bacteria 730
95 Ga0373935_0584129 3300035692 Unclassified 816
96 Ga0373927_0009843 3300035695 Bacteria 6407
97 Ga0373925_0054894 3300037068 Bacteria 2981
98 Ga0395898_1631337 3300037466 Bacteria 569
99 Ga0436364_0127163 3300037853 Bacteria 2393
100 Ga0436361_0519900 3300039447 Bacteria 708
101 Ga0436361_0751754 3300039447 Bacteria 2422
102 Ga0439459_0053119 3300042438 Bacteria 895
103 Ga0451577_0004803 3300042876 Bacteria 14111
104 Ga0466961_0005605 3300044693 Bacteria 7932
105 Ga0466967_1683127 3300045976 Bacteria 632
106 Ga0495603_0023640 3300046455 Bacteria 3717
107 Ga0495638_0003283 3300046460 Bacteria 12754
108 Ga0495638_0367612 3300046460 Bacteria 755
109 Ga0495582_0525279 3300046473 Unclassified 684
110 Ga0495639_0048230 3300046475 Bacteria 1931
111 Ga0495662_0617918 3300046476 Unclassified 530
112 Ga0495584_0000004 3300046491 Bacteria 314714
113 Ga0495584_0047086 3300046491 Bacteria 2174
114 Ga0495585_0003217 3300046492 Bacteria 11146
115 Ga0495585_0030971 3300046492 Bacteria 3041
116 Ga0495585_0124038 3300046492 Bacteria 1364
117 Ga0495594_0030393 3300046499 Bacteria 2922
118 Ga0495594_0631003 3300046499 Unclassified 607
119 Ga0495596_0006435 3300046500 Bacteria 5403
120 Ga0495607_0001604 3300046501 Bacteria 19640
121 Ga0495607_0026729 3300046501 Bacteria 3578
122 Ga0495607_0092805 3300046501 Bacteria 1632
123 Ga0495583_0022755 3300046506 Bacteria 3188
124 Ga0495583_0205773 3300046506 Unclassified 798
125 Ga0495606_0004819 3300046507 Bacteria 13252
126 Ga0495606_0133240 3300046507 Bacteria 1475
127 Ga0495606_0397693 3300046507 Bacteria 718
128 Ga0495610_0344775 3300046512 Bacteria 562
129 Ga0495616_0139361 3300046513 Bacteria 1105
130 Ga0495631_0036882 3300046518 Bacteria 2180
131 Ga0495632_0065364 3300046519 Bacteria 1757
132 Ga0495643_0061464 3300046522 Bacteria 1992
133 Ga0495644_0085506 3300046523 Bacteria 1189
134 Ga0495666_0064898 3300046526 Bacteria 1742
135 Ga0495666_0183693 3300046526 Unclassified 965
136 Ga0495642_0014832 3300046528 Bacteria 3024
137 Ga0495642_0025191 3300046528 Bacteria 2356
138 Ga0495642_0199814 3300046528 Bacteria 871
139 Ga0495654_0000401 3300046530 Bacteria 37059
140 Ga0495609_0077111 3300046538 Bacteria 1460
141 Ga0495609_0230316 3300046538 Bacteria 767
142 Ga0495597_0023282 3300046542 Bacteria 2865
143 Ga0495622_0014080 3300046557 Bacteria 3712
144 Ga0495622_0337955 3300046557 Unclassified 653
145 Ga0495656_0489548 3300046615 Bacteria 651
146 Ga0495668_0099301 3300046616 Bacteria 1592
147 Ga0495611_0005256 3300046648 Bacteria 5545
148 Ga0495625_0020882 3300046660 Bacteria 5048
149 Ga0495625_0264391 3300046660 Bacteria 1112
150 Ga0495625_0321421 3300046660 Bacteria 985
151 Ga0495661_0005185 3300046665 Bacteria 9285
152 Ga0495661_0178881 3300046665 Bacteria 1125
153 Ga0495588_0358264 3300046674 Bacteria 766
154 Ga0495647_0050940 3300046681 Bacteria 1608
155 Ga0495658_0051726 3300046683 Bacteria 2327
156 Ga0495613_0606499 3300046689 Unclassified 728
157 Ga0495670_0001678 3300046691 Bacteria 10870
158 Ga0495670_0007275 3300046691 Bacteria 5441
159 Ga0495670_0298899 3300046691 Bacteria 862
160 Ga0495671_0016811 3300046692 Bacteria 3901
161 Ga0495589_0029813 3300046794 Bacteria 2750
162 Ga0495660_0231735 3300046810 Bacteria 865
163 Ga0495581_0553534 3300047315 Bacteria 668
164 Ga0495636_0343410 3300047318 Bacteria 704
165 Ga0495676_0053435 3300047321 Bacteria 3219
166 Ga0495683_0156302 3300047323 Bacteria 1057
167 Ga0495677_0039845 3300047445 Bacteria 1717
168 Ga0495685_110035 3300047447 Bacteria 907
169 Ga0495681_0092494 3300047470 Bacteria 1333
170 Ga0495626_0005488 3300048091 Bacteria 7390
171 Ga0496102_0047261 3300048905 Bacteria 3910
172 Ga0496102_0105101 3300048905 Bacteria 2627
173 Ga0496103_0686700 3300048906 Bacteria 649
174 Ga0496103_0867202 3300048906 Unclassified 567
175 Ga0496109_1914835 3300048912 Unclassified 525
176 Ga0496112_0890576 3300048915 Unclassified 812
177 Ga0496114_0000303 3300048917 Bacteria 36267
178 Ga0496117_0004150 3300048920 Bacteria 16193
179 Ga0496118_0004731 3300048921 Bacteria 15932
180 Ga0496121_0001871 3300048924 Bacteria 33787
181 Ga0496126_0000393 3300048929 Bacteria 89680
182 Ga0501292_087367 3300049515 Unclassified 601
183 Ga0501031_0002303 3300049568 Bacteria 12104
184 Ga0501032_0003319 3300049569 Bacteria 12381
185 Ga0501034_0004525 3300049571 Bacteria 15457
186 Ga0501036_0003592 3300049572 Bacteria 12398
187 Ga0501037_0002958 3300049573 Bacteria 12321
188 Ga0501038_0000097 3300049574 Bacteria 74005
189 Ga0501039_0001820 3300049575 Bacteria 15765
190 Ga0501040_0002357 3300049576 Bacteria 12131
191 Ga0501042_0086439 3300049578 Unclassified 2249
192 Ga0501043_0003815 3300049579 Bacteria 12398
193 Ga0501043_0166533 3300049579 Unclassified 1721
194 Ga0501046_0180463 3300049580 Unclassified 1579
195 Ga0501046_0782858 3300049580 Unclassified 669
196 Ga0501047_0009518 3300049581 Bacteria 9183
197 Ga0501048_0004320 3300049582 Bacteria 10824
198 Ga0501070_0306550 3300049586 Bacteria 1293
199 Ga0501070_0403007 3300049586 Bacteria 1106
200 Ga0501238_073744 3300049671 Bacteria 532
201 Ga0501269_004772 3300049766 Bacteria 1631
202 Ga0501035_0005332 3300049822 Bacteria 12163
203 Ga0501044_0002793 3300049823 Bacteria 19890
204 Ga0501044_0658830 3300049823 Bacteria 935
205 Ga0501045_0007801 3300049824 Bacteria 7444
206 nmdc:mga05p37_12673_c1 3300050507 Bacteria 10073
207 nmdc:mga08y16_482585_c1 3300050511 Unclassified 1261
208 Ga0500578_0204713 3300053086 Unclassified 1206
209 Ga0500572_032772 3300053111 Bacteria 1461
210 Ga0500593_265335 3300053117 Unclassified 571
211 Ga0500618_006148 3300053125 Bacteria 3554
212 Ga0500655_004540 3300053133 Bacteria 2500
213 Ga0501082_0033542 3300060353 Bacteria 4429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_11314636 Ga0207644_113146361 65
2 3300039447 Ga0436361_0751754 Ga0436361_0751754_134_337 66
3 3300053086 Ga0500578_0204713 Ga0500578_0204713_387_635 66
4 3300031824 Ga0307413_10170156 Ga0307413_101701562 69
5 3300046523 Ga0495644_0085506 Ga0495644_0085506_943_1155 69
6 3300046557 Ga0495622_0337955 Ga0495622_0337955_28_240 69
7 3300047323 Ga0495683_0156302 Ga0495683_0156302_835_1047 69
8 3300047447 Ga0495685_110035 Ga0495685_110035_34_246 69
9 3300005467 Ga0070706_101101430 Ga0070706_1011014302 70
10 3300044693 Ga0466961_0005605 Ga0466961_0005605_6320_6538 70
11 3300048906 Ga0496103_0867202 Ga0496103_0867202_113_334 72
12 3300060353 Ga0501082_0033542 Ga0501082_0033542_26_247 72
13 iso_pu_bacteria 641522639 641568617 75
14 3300049515 Ga0501292_087367 Ga0501292_087367_14_247 76
15 3300025261 Ga0209233_1064407 Ga0209233_10644071 77
16 iso_pu_bacteria 2791355253 2793280397 77
17 3300031239 Ga0265328_10050823 Ga0265328_100508232 78
18 3300031250 Ga0265331_10000667 Ga0265331_1000066716 78
19 3300006173 Ga0070716_100621901 Ga0070716_1006219012 79
20 3300006846 Ga0075430_101506021 Ga0075430_1015060211 79
21 3300046665 Ga0495661_0005185 Ga0495661_0005185_7122_7364 79
22 3300046691 Ga0495670_0001678 Ga0495670_0001678_4313_4555 79
23 3300020082 Ga0206353_10185164 Ga0206353_101851641 80
24 3300031548 Ga0307408_101428567 Ga0307408_1014285672 80
25 3300031852 Ga0307410_10809563 Ga0307410_108095631 80
26 3300031903 Ga0307407_10137542 Ga0307407_101375423 80
27 3300032002 Ga0307416_103218173 Ga0307416_1032181731 80
28 3300032004 Ga0307414_11218347 Ga0307414_112183471 80
29 3300032005 Ga0307411_10086195 Ga0307411_100861952 80
30 3300005289 Ga0065704_10226198 Ga0065704_102261982 81
31 3300005290 Ga0065712_10504165 Ga0065712_105041652 81
32 3300005293 Ga0065715_10525295 Ga0065715_105252952 81
33 3300005327 Ga0070658_10120638 Ga0070658_101206382 81
34 3300005331 Ga0070670_100277348 Ga0070670_1002773482 81
35 3300005333 Ga0070677_10682955 Ga0070677_106829552 81
36 3300005334 Ga0068869_101485098 Ga0068869_1014850981 81
37 3300005335 Ga0070666_10254916 Ga0070666_102549163 81
38 3300005338 Ga0068868_100792645 Ga0068868_1007926452 81
39 3300005341 Ga0070691_10887745 Ga0070691_108877451 81
40 3300005354 Ga0070675_100237279 Ga0070675_1002372793 81
41 3300005354 Ga0070675_101508398 Ga0070675_1015083982 81
42 3300005355 Ga0070671_100079561 Ga0070671_1000795613 81
43 3300005458 Ga0070681_11942259 Ga0070681_119422591 81
44 3300005536 Ga0070697_100389971 Ga0070697_1003899712 81
45 3300005543 Ga0070672_101755888 Ga0070672_1017558882 81
46 3300005548 Ga0070665_100014298 Ga0070665_1000142983 81
47 3300005548 Ga0070665_100320296 Ga0070665_1003202962 81
48 3300005549 Ga0070704_101593094 Ga0070704_1015930942 81
49 3300005563 Ga0068855_100274752 Ga0068855_1002747523 81
50 3300005563 Ga0068855_102603521 Ga0068855_1026035212 81
51 3300005577 Ga0068857_100572950 Ga0068857_1005729503 81
52 3300005617 Ga0068859_100195545 Ga0068859_1001955453 81
53 3300005618 Ga0068864_100335854 Ga0068864_1003358543 81
54 3300005719 Ga0068861_101200874 Ga0068861_1012008741 81
55 3300005844 Ga0068862_100946639 Ga0068862_1009466392 81
56 3300005844 Ga0068862_101354513 Ga0068862_1013545132 81
57 3300005937 Ga0081455_10012712 Ga0081455_100127124 81
58 3300005937 Ga0081455_10600474 Ga0081455_106004742 81
59 3300005981 Ga0081538_10195446 Ga0081538_101954462 81
60 3300006844 Ga0075428_100618159 Ga0075428_1006181593 81
61 3300006881 Ga0068865_100516259 Ga0068865_1005162591 81
62 3300006931 Ga0097620_100195541 Ga0097620_1001955413 81
63 3300007265 Ga0099794_10811136 Ga0099794_108111362 81
64 3300009093 Ga0105240_12094227 Ga0105240_120942272 81
65 3300009098 Ga0105245_11381006 Ga0105245_113810062 81
66 3300009101 Ga0105247_11188028 Ga0105247_111880281 81
67 3300009177 Ga0105248_11470641 Ga0105248_114706412 81
68 3300009551 Ga0105238_10324840 Ga0105238_103248402 81
69 3300011119 Ga0105246_10224035 Ga0105246_102240353 81
70 3300013104 Ga0157370_10055206 Ga0157370_100552061 81
71 3300013296 Ga0157374_10202110 Ga0157374_102021103 81
72 3300013297 Ga0157378_11137286 Ga0157378_111372862 81
73 3300013306 Ga0163162_10361302 Ga0163162_103613023 81
74 3300013307 Ga0157372_13080863 Ga0157372_130808631 81
75 3300014325 Ga0163163_10025431 Ga0163163_100254312 81
76 3300014325 Ga0163163_12493501 Ga0163163_124935012 81
77 3300014497 Ga0182008_10857737 Ga0182008_108577372 81
78 3300014969 Ga0157376_10255842 Ga0157376_102558422 81
79 3300025292 Ga0209676_1006388 Ga0209676_10063883 81
80 3300025297 Ga0209758_1000657 Ga0209758_100065738 81
81 3300025298 Ga0209050_1006764 Ga0209050_10067643 81
82 3300025303 Ga0209051_1004310 Ga0209051_100431010 81
83 3300025904 Ga0207647_10623429 Ga0207647_106234292 81
84 3300025909 Ga0207705_10823942 Ga0207705_108239422 81
85 3300025910 Ga0207684_10048589 Ga0207684_100485893 81
86 3300025912 Ga0207707_10873993 Ga0207707_108739931 81
87 3300025925 Ga0207650_11367605 Ga0207650_113676052 81
88 3300025925 Ga0207650_11688985 Ga0207650_116889851 81
89 3300025926 Ga0207659_10052238 Ga0207659_100522383 81
90 3300025931 Ga0207644_10642953 Ga0207644_106429532 81
91 3300025938 Ga0207704_10777132 Ga0207704_107771321 81
92 3300025949 Ga0207667_10241383 Ga0207667_102413832 81
93 3300026023 Ga0207677_11257069 Ga0207677_112570692 81
94 3300026088 Ga0207641_10427595 Ga0207641_104275953 81
95 3300026095 Ga0207676_10056085 Ga0207676_100560852 81
96 3300026118 Ga0207675_101423241 Ga0207675_1014232411 81
97 3300027360 Ga0209969_1027109 Ga0209969_10271091 81
98 3300027876 Ga0209974_10162849 Ga0209974_101628492 81
99 3300028379 Ga0268266_10272956 Ga0268266_102729563 81
100 3300028379 Ga0268266_10273350 Ga0268266_102733502 81
101 3300028380 Ga0268265_11240470 Ga0268265_112404702 81
102 3300031241 Ga0265325_10195127 Ga0265325_101951272 81
103 3300031247 Ga0265340_10000772 Ga0265340_1000077212 81
104 3300031251 Ga0265327_10068661 Ga0265327_100686613 81
105 3300031344 Ga0265316_10009099 Ga0265316_100090992 81
106 3300031595 Ga0265313_10158031 Ga0265313_101580312 81
107 3300031712 Ga0265342_10587432 Ga0265342_105874321 81
108 3300035114 Ga0373939_0217342 Ga0373939_0217342_436_687 81
109 3300035692 Ga0373935_0584129 Ga0373935_0584129_372_620 81
110 3300035695 Ga0373927_0009843 Ga0373927_0009843_3941_4189 81
111 3300037068 Ga0373925_0054894 Ga0373925_0054894_376_624 81
112 3300037466 Ga0395898_1631337 Ga0395898_1631337_12_260 81
113 3300037853 Ga0436364_0127163 Ga0436364_0127163_707_955 81
114 3300039447 Ga0436361_0519900 Ga0436361_0519900_422_676 81
115 3300042438 Ga0439459_0053119 Ga0439459_0053119_303_551 81
116 3300042876 Ga0451577_0004803 Ga0451577_0004803_12126_12374 81
117 3300045976 Ga0466967_1683127 Ga0466967_1683127_181_429 81
118 3300046455 Ga0495603_0023640 Ga0495603_0023640_2371_2619 81
119 3300046460 Ga0495638_0003283 Ga0495638_0003283_1796_2044 81
120 3300046460 Ga0495638_0367612 Ga0495638_0367612_214_462 81
121 3300046473 Ga0495582_0525279 Ga0495582_0525279_52_300 81
122 3300046475 Ga0495639_0048230 Ga0495639_0048230_918_1166 81
123 3300046476 Ga0495662_0617918 Ga0495662_0617918_126_374 81
124 3300046491 Ga0495584_0000004 Ga0495584_0000004_285396_285644 81
125 3300046491 Ga0495584_0047086 Ga0495584_0047086_944_1192 81
126 3300046492 Ga0495585_0003217 Ga0495585_0003217_1153_1401 81
127 3300046492 Ga0495585_0030971 Ga0495585_0030971_2012_2260 81
128 3300046492 Ga0495585_0124038 Ga0495585_0124038_367_615 81
129 3300046499 Ga0495594_0030393 Ga0495594_0030393_1044_1292 81
130 3300046499 Ga0495594_0631003 Ga0495594_0631003_112_360 81
131 3300046500 Ga0495596_0006435 Ga0495596_0006435_2658_2906 81
132 3300046501 Ga0495607_0001604 Ga0495607_0001604_18745_18993 81
133 3300046501 Ga0495607_0026729 Ga0495607_0026729_875_1123 81
134 3300046501 Ga0495607_0092805 Ga0495607_0092805_560_808 81
135 3300046506 Ga0495583_0022755 Ga0495583_0022755_1372_1620 81
136 3300046506 Ga0495583_0205773 Ga0495583_0205773_39_287 81
137 3300046507 Ga0495606_0004819 Ga0495606_0004819_11651_11899 81
138 3300046507 Ga0495606_0133240 Ga0495606_0133240_987_1235 81
139 3300046507 Ga0495606_0397693 Ga0495606_0397693_449_697 81
140 3300046512 Ga0495610_0344775 Ga0495610_0344775_140_388 81
141 3300046513 Ga0495616_0139361 Ga0495616_0139361_590_838 81
142 3300046518 Ga0495631_0036882 Ga0495631_0036882_1006_1254 81
143 3300046519 Ga0495632_0065364 Ga0495632_0065364_277_525 81
144 3300046522 Ga0495643_0061464 Ga0495643_0061464_1296_1544 81
145 3300046526 Ga0495666_0064898 Ga0495666_0064898_1019_1267 81
146 3300046526 Ga0495666_0183693 Ga0495666_0183693_162_410 81
147 3300046528 Ga0495642_0014832 Ga0495642_0014832_592_840 81
148 3300046528 Ga0495642_0025191 Ga0495642_0025191_1134_1382 81
149 3300046528 Ga0495642_0199814 Ga0495642_0199814_587_835 81
150 3300046530 Ga0495654_0000401 Ga0495654_0000401_4949_5197 81
151 3300046538 Ga0495609_0077111 Ga0495609_0077111_16_264 81
152 3300046538 Ga0495609_0230316 Ga0495609_0230316_503_751 81
153 3300046542 Ga0495597_0023282 Ga0495597_0023282_2136_2384 81
154 3300046557 Ga0495622_0014080 Ga0495622_0014080_2381_2629 81
155 3300046615 Ga0495656_0489548 Ga0495656_0489548_35_283 81
156 3300046616 Ga0495668_0099301 Ga0495668_0099301_25_273 81
157 3300046648 Ga0495611_0005256 Ga0495611_0005256_595_843 81
158 3300046660 Ga0495625_0020882 Ga0495625_0020882_1651_1899 81
159 3300046660 Ga0495625_0264391 Ga0495625_0264391_455_703 81
160 3300046660 Ga0495625_0321421 Ga0495625_0321421_278_526 81
161 3300046665 Ga0495661_0178881 Ga0495661_0178881_188_436 81
162 3300046674 Ga0495588_0358264 Ga0495588_0358264_201_449 81
163 3300046681 Ga0495647_0050940 Ga0495647_0050940_592_840 81
164 3300046683 Ga0495658_0051726 Ga0495658_0051726_1440_1688 81
165 3300046689 Ga0495613_0606499 Ga0495613_0606499_276_524 81
166 3300046691 Ga0495670_0007275 Ga0495670_0007275_5033_5281 81
167 3300046691 Ga0495670_0298899 Ga0495670_0298899_271_519 81
168 3300046692 Ga0495671_0016811 Ga0495671_0016811_577_840 81
169 3300046794 Ga0495589_0029813 Ga0495589_0029813_1033_1281 81
170 3300046810 Ga0495660_0231735 Ga0495660_0231735_409_657 81
171 3300047315 Ga0495581_0553534 Ga0495581_0553534_370_618 81
172 3300047318 Ga0495636_0343410 Ga0495636_0343410_246_494 81
173 3300047321 Ga0495676_0053435 Ga0495676_0053435_2054_2302 81
174 3300047445 Ga0495677_0039845 Ga0495677_0039845_1010_1258 81
175 3300047470 Ga0495681_0092494 Ga0495681_0092494_770_1018 81
176 3300048091 Ga0495626_0005488 Ga0495626_0005488_295_543 81
177 3300048905 Ga0496102_0047261 Ga0496102_0047261_388_639 81
178 3300048905 Ga0496102_0105101 Ga0496102_0105101_1907_2155 81
179 3300048906 Ga0496103_0686700 Ga0496103_0686700_294_545 81
180 3300048912 Ga0496109_1914835 Ga0496109_1914835_10_258 81
181 3300048915 Ga0496112_0890576 Ga0496112_0890576_233_481 81
182 3300048917 Ga0496114_0000303 Ga0496114_0000303_35005_35256 81
183 3300048920 Ga0496117_0004150 Ga0496117_0004150_8867_9118 81
184 3300048921 Ga0496118_0004731 Ga0496118_0004731_6695_6946 81
185 3300048924 Ga0496121_0001871 Ga0496121_0001871_8871_9119 81
186 3300048929 Ga0496126_0000393 Ga0496126_0000393_63802_64053 81
187 3300049568 Ga0501031_0002303 Ga0501031_0002303_7026_7277 81
188 3300049569 Ga0501032_0003319 Ga0501032_0003319_7050_7301 81
189 3300049571 Ga0501034_0004525 Ga0501034_0004525_7050_7301 81
190 3300049572 Ga0501036_0003592 Ga0501036_0003592_7285_7536 81
191 3300049573 Ga0501037_0002958 Ga0501037_0002958_4845_5096 81
192 3300049574 Ga0501038_0000097 Ga0501038_0000097_53868_54119 81
193 3300049575 Ga0501039_0001820 Ga0501039_0001820_7358_7609 81
194 3300049576 Ga0501040_0002357 Ga0501040_0002357_4856_5107 81
195 3300049578 Ga0501042_0086439 Ga0501042_0086439_1265_1516 81
196 3300049579 Ga0501043_0003815 Ga0501043_0003815_4863_5114 81
197 3300049579 Ga0501043_0166533 Ga0501043_0166533_1192_1443 81
198 3300049580 Ga0501046_0180463 Ga0501046_0180463_95_346 81
199 3300049580 Ga0501046_0782858 Ga0501046_0782858_392_640 81
200 3300049581 Ga0501047_0009518 Ga0501047_0009518_1883_2134 81
201 3300049582 Ga0501048_0004320 Ga0501048_0004320_5760_6011 81
202 3300049586 Ga0501070_0306550 Ga0501070_0306550_100_348 81
203 3300049586 Ga0501070_0403007 Ga0501070_0403007_378_626 81
204 3300049671 Ga0501238_073744 Ga0501238_073744_177_425 81
205 3300049766 Ga0501269_004772 Ga0501269_004772_1018_1266 81
206 3300049822 Ga0501035_0005332 Ga0501035_0005332_4863_5114 81
207 3300049823 Ga0501044_0002793 Ga0501044_0002793_12414_12665 81
208 3300049823 Ga0501044_0658830 Ga0501044_0658830_161_409 81
209 3300049824 Ga0501045_0007801 Ga0501045_0007801_2342_2593 81
210 3300050507 nmdc:mga05p37_12673_c1 nmdc:mga05p37_12673_c1_9090_9335 81
211 3300050511 nmdc:mga08y16_482585_c1 nmdc:mga08y16_482585_c1_468_719 81
212 3300053111 Ga0500572_032772 Ga0500572_032772_904_1152 81
213 3300053117 Ga0500593_265335 Ga0500593_265335_276_524 81
214 3300053125 Ga0500618_006148 Ga0500618_006148_2543_2791 81
215 3300053133 Ga0500655_004540 Ga0500655_004540_688_936 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13711

DUF4160

Domain of unknown function (DUF4160)

9

82

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvp-assembly1.cif.gz_B crystal structure of uncharacterized protein ymzc precursor from bacillus subtilis, northeast structural genomics consortium target sr378a 0.7908 23 49
7zty-assembly1.cif.gz_A structure of vps39 n-terminal domain from chaetomium thermophilum 0.7174 12 49
4j0x-assembly2.cif.gz_B structure of rrp9 0.6788 23 54
7suk-assembly1.cif.gz_SG structure of bfr2-lcp5 complex observed in the small subunit processome isolated from r2tp-depleted yeast cells 0.6675 23 54
7xbj-assembly1.cif.gz_A txp40, an insecticidal toxin protein from xenorhabdus nematophila 0.6614 23 49
ID Description Score Start End Superfamily
3kvpE00 Special;Other non-globular;Immunoglobulin-like; 0.751 23 49 6.20.140.10
af_A0A1D6GPS2_239_532_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7079 23 54 2.130.10.10
3f3pI01 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6838 23 53 2.130.10.10
4j0xA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6747 23 54 2.130.10.10
af_A0A1D8PNG5_289_465_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6463 23 53 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1H6NY44-F1-model_v4 DUF4160 domain-containing protein 0.9925 1 79
AF-A0A0N0E1N5-F1-model_v4 DUF4160 domain-containing protein 0.9917 1 80
AF-A0A259PBI2-F1-model_v4 deleted 0.9847 1 81
AF-A0A255XPP6-F1-model_v4 DUF4160 domain-containing protein 0.9842 1 81
AF-A0A258CEB7-F1-model_v4 deleted 0.9788 1 73

Feature Viewer

pLDDT pTM Quality
92.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map