F326361

General Info

Members Datasets Scaffolds Average Seq Length
215 160 430 253

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10005903|Ga0111539_100059032
Length 284
Sequence VRGANTTDREDFVMTDQPTTPDASTIRDAAKPAVVDRAVFQAELDRLRLREKAHTREGDALAAARRRLPMVEVDPRTPLTGAGGRVPLIDVFDGRSQLVVYFHMWHPGRPTAEQCEGCTFNTSHVTELSYLHSRDVSYAVFCEGPYEEAARYRDFMGYPVPWYSVPPDSVDRLVADRHFGILASYLRDGDRVFETYWTTGRGNEPMDASYGLLDRTVYGRQELWEDSPEGWPQRWGSKGGQFTTDGRPTAQWSRIRAGRDDDLGPLPDGWTACSCSLHTGPPAA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
144 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
153 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
154 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
155 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
156 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
157 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
158 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
159 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
160 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 0.47
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.63
Nodule 0
Rhizoplane 8.84
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10005903 3300009094 Bacteria 15817
2 JGI24751J29686_10041847 3300002459 Bacteria 947
3 Ga0070683_100017068 3300005329 Bacteria 6408
4 Ga0068869_100298733 3300005334 Bacteria 1300
5 Ga0068868_100003059 3300005338 Bacteria 11645
6 Ga0070661_100176481 3300005344 Bacteria 1624
7 Ga0070675_100000299 3300005354 Bacteria 33243
8 Ga0070671_100005830 3300005355 Bacteria 9814
9 Ga0070674_100173681 3300005356 Bacteria 1645
10 Ga0070659_100033858 3300005366 Bacteria 3971
11 Ga0070667_100015369 3300005367 Bacteria 6328
12 Ga0070667_100136626 3300005367 Bacteria 2144
13 Ga0070667_100195094 3300005367 Bacteria 1795
14 Ga0070709_10094366 3300005434 Bacteria 1979
15 Ga0070714_100009398 3300005435 Bacteria 7686
16 Ga0070711_100031730 3300005439 Bacteria 3509
17 Ga0070700_100012064 3300005441 Bacteria 4805
18 Ga0070708_100119416 3300005445 Bacteria 2430
19 Ga0070678_100323179 3300005456 Bacteria 1318
20 Ga0070662_100004679 3300005457 Bacteria 8680
21 Ga0070681_10349193 3300005458 Bacteria 1389
22 Ga0070706_100357824 3300005467 Bacteria 1360
23 Ga0070706_100386213 3300005467 Bacteria 1303
24 Ga0070707_100128268 3300005468 Bacteria 2465
25 Ga0070698_100154886 3300005471 Bacteria 2237
26 Ga0070699_100019481 3300005518 Bacteria 5843
27 Ga0070697_100098358 3300005536 Bacteria 2428
28 Ga0070665_100627151 3300005548 Bacteria 1088
29 Ga0070664_100027465 3300005564 Bacteria 4730
30 Ga0070664_100276759 3300005564 Bacteria 1513
31 Ga0068854_100170966 3300005578 Bacteria 1691
32 Ga0068856_100087224 3300005614 Bacteria 3102
33 Ga0068861_100019457 3300005719 Bacteria 4850
34 Ga0068870_10256758 3300005840 Bacteria 1086
35 Ga0068863_100022910 3300005841 Bacteria 5969
36 Ga0068863_100033597 3300005841 Bacteria 4886
37 Ga0068858_100118300 3300005842 Bacteria 2477
38 Ga0068858_100191968 3300005842 Bacteria 1930
39 Ga0068860_100594366 3300005843 Bacteria 1112
40 Ga0068862_100009559 3300005844 Bacteria 8018
41 Ga0068862_100332132 3300005844 Bacteria 1406
42 Ga0081455_10020491 3300005937 Bacteria 6223
43 Ga0081455_10024676 3300005937 Bacteria 5563
44 Ga0081455_10086208 3300005937 Bacteria 2558
45 Ga0081455_10133240 3300005937 Bacteria 1940
46 Ga0081540_1108569 3300005983 Bacteria 1179
47 Ga0081539_10072050 3300005985 Bacteria 1848
48 Ga0075365_10003536 3300006038 Bacteria 8081
49 Ga0075363_100079980 3300006048 Bacteria 1787
50 Ga0075363_100114495 3300006048 Bacteria 1501
51 Ga0075364_10082152 3300006051 Bacteria 2131
52 Ga0075362_10037446 3300006177 Bacteria 2126
53 Ga0075367_10096739 3300006178 Bacteria 1801
54 Ga0075369_10014199 3300006186 Bacteria 3178
55 Ga0075369_10044978 3300006186 Bacteria 1897
56 Ga0075370_10007037 3300006353 Bacteria 5706
57 Ga0075370_10248056 3300006353 Bacteria 1055
58 Ga0068871_100214201 3300006358 Bacteria 1667
59 Ga0075428_100005745 3300006844 Bacteria 13782
60 Ga0075428_100012033 3300006844 Bacteria 9625
61 Ga0075428_100255515 3300006844 Bacteria 1888
62 Ga0075430_100039993 3300006846 Bacteria 3969
63 Ga0075429_100195698 3300006880 Bacteria 1771
64 Ga0105250_10027960 3300009092 Bacteria 2271
65 Ga0105245_10177842 3300009098 Bacteria 2031
66 Ga0114129_10002697 3300009147 Bacteria 24711
67 Ga0114129_10042642 3300009147 Bacteria 6387
68 Ga0114129_10289074 3300009147 Bacteria 2188
69 Ga0105241_10198658 3300009174 Bacteria 1673
70 Ga0105248_10468433 3300009177 Bacteria 1420
71 Ga0105238_10564782 3300009551 Bacteria 1143
72 Ga0105249_10024603 3300009553 Bacteria 5413
73 Ga0105246_10441753 3300011119 Bacteria 1091
74 Ga0157369_10008178 3300013105 Bacteria 12003
75 Ga0157372_10116882 3300013307 Bacteria 3058
76 Ga0163163_10004448 3300014325 Bacteria 11954
77 Ga0163163_10112459 3300014325 Bacteria 2752
78 Ga0182008_10167972 3300014497 Bacteria 1107
79 Ga0157377_10027399 3300014745 Bacteria 3059
80 Ga0157376_10279107 3300014969 Bacteria 1573
81 Ga0206350_11139258 3300020080 Bacteria 1552
82 Ga0213876_10273911 3300021384 Bacteria 897
83 Ga0207696_1038115 3300025711 Bacteria 1420
84 Ga0207699_10086685 3300025906 Bacteria 1956
85 Ga0207645_10042603 3300025907 Bacteria 2905
86 Ga0207684_10008452 3300025910 Bacteria 9159
87 Ga0207684_10060709 3300025910 Bacteria 3211
88 Ga0207684_10148434 3300025910 Bacteria 2017
89 Ga0207707_10221513 3300025912 Bacteria 1647
90 Ga0207663_10029272 3300025916 Bacteria 3233
91 Ga0207660_10383591 3300025917 Bacteria 1130
92 Ga0207657_10042368 3300025919 Bacteria 4017
93 Ga0207649_10044658 3300025920 Bacteria 2714
94 Ga0207646_10109672 3300025922 Bacteria 2476
95 Ga0207659_10015079 3300025926 Bacteria 4998
96 Ga0207687_10111845 3300025927 Bacteria 2028
97 Ga0207664_10006628 3300025929 Bacteria 7976
98 Ga0207644_10086195 3300025931 Bacteria 2331
99 Ga0207690_10122466 3300025932 Bacteria 1891
100 Ga0207690_10301827 3300025932 Bacteria 1253
101 Ga0207706_10003750 3300025933 Bacteria 14494
102 Ga0207669_10097392 3300025937 Bacteria 1934
103 Ga0207711_10175501 3300025941 Bacteria 1947
104 Ga0207689_10001180 3300025942 Bacteria 25130
105 Ga0207679_10014253 3300025945 Bacteria 5222
106 Ga0207679_10240192 3300025945 Bacteria 1535
107 Ga0207712_10033705 3300025961 Bacteria 3464
108 Ga0207640_10132770 3300025981 Bacteria 1802
109 Ga0207658_10010832 3300025986 Bacteria 6204
110 Ga0207658_10206259 3300025986 Bacteria 1644
111 Ga0207703_10249105 3300026035 Bacteria 1600
112 Ga0207708_10004343 3300026075 Bacteria 10439
113 Ga0207641_10005640 3300026088 Bacteria 10665
114 Ga0207641_10073698 3300026088 Bacteria 2943
115 Ga0207641_10197393 3300026088 Bacteria 1853
116 Ga0207676_10018896 3300026095 Bacteria 5018
117 Ga0207674_10006440 3300026116 Bacteria 13807
118 Ga0207675_100104136 3300026118 Bacteria 2674
119 Ga0207683_10295448 3300026121 Bacteria 1482
120 Ga0268264_10462534 3300028381 Bacteria 1231
121 Ga0307515_10023476 3300028794 Bacteria 10805
122 Ga0265338_10003404 3300028800 Bacteria 22431
123 Ga0265338_10053605 3300028800 Bacteria 3605
124 Ga0307512_10010759 3300030522 Bacteria 8698
125 Ga0307513_10118034 3300031456 Bacteria 2628
126 Ga0307508_10047696 3300031616 Bacteria 3818
127 Ga0307413_10000606 3300031824 Bacteria 12029
128 Ga0307406_10003157 3300031901 Bacteria 8968
129 Ga0307406_10071211 3300031901 Bacteria 2278
130 Ga0307406_10123049 3300031901 Bacteria 1807
131 Ga0307406_10262628 3300031901 Bacteria 1307
132 Ga0307407_10067486 3300031903 Bacteria 2114
133 Ga0307409_100000141 3300031995 Bacteria 26989
134 Ga0307409_100023147 3300031995 Bacteria 4298
135 Ga0307409_100064984 3300031995 Bacteria 2869
136 Ga0307416_100000136 3300032002 Bacteria 43072
137 Ga0307416_100172435 3300032002 Bacteria 2016
138 Ga0307416_100193068 3300032002 Bacteria 1923
139 Ga0307411_10316938 3300032005 Bacteria 1258
140 Ga0307415_100000322 3300032126 Bacteria 20735
141 Ga0307415_100027872 3300032126 Bacteria 3585
142 Ga0307415_100137626 3300032126 Bacteria 1860
143 Ga0307415_100196119 3300032126 Bacteria 1598
144 Ga0307510_10000959 3300033180 Bacteria 30502
145 Ga0307510_10233291 3300033180 Bacteria 1341
146 Ga0373927_0000090 3300035695 Bacteria 68407
147 Ga0373927_0251012 3300035695 Bacteria 1163
148 Ga0436365_0241155 3300039437 Bacteria 2402
149 Ga0436360_0278974 3300039438 Bacteria 830
150 Ga0436361_1101474 3300039447 Bacteria 1797
151 Ga0436362_0015108 3300039453 Bacteria 1047
152 Ga0439431_0026872 3300041997 Bacteria 1412
153 Ga0466967_0665132 3300045976 Bacteria 1030
154 Ga0495632_0016260 3300046519 Bacteria 4146
155 Ga0496102_0001298 3300048905 Bacteria 22464
156 Ga0496102_0024986 3300048905 Bacteria 5315
157 Ga0496103_0030326 3300048906 Bacteria 3291
158 Ga0496104_0019767 3300048907 Bacteria 6166
159 Ga0496104_0339362 3300048907 Bacteria 1415
160 Ga0496108_0005733 3300048911 Bacteria 10055
161 Ga0496108_0062699 3300048911 Bacteria 3130
162 Ga0496109_0028223 3300048912 Bacteria 5017
163 Ga0496109_0086561 3300048912 Bacteria 2894
164 Ga0496110_0087507 3300048913 Bacteria 2782
165 Ga0496110_0307004 3300048913 Bacteria 1445
166 Ga0496111_0007746 3300048914 Bacteria 7067
167 Ga0496111_0069707 3300048914 Bacteria 2557
168 Ga0496111_0255802 3300048914 Bacteria 1299
169 Ga0496112_0004586 3300048915 Bacteria 11749
170 Ga0496112_0372018 3300048915 Bacteria 1370
171 Ga0496113_0008857 3300048916 Bacteria 6579
172 Ga0496113_0135801 3300048916 Bacteria 1932
173 Ga0496115_0013393 3300048918 Bacteria 6203
174 Ga0501039_0317431 3300049575 Bacteria 1225
175 Ga0501043_0232630 3300049579 Bacteria 1423
176 Ga0501043_0393355 3300049579 Bacteria 1048
177 Ga0501068_0017191 3300049584 Bacteria 4179
178 Ga0501081_0257876 3300049743 Bacteria 1274
179 nmdc:mga03683_10141_c1 3300050489 Bacteria 3372
180 nmdc:mga03n38_269957_c1 3300050490 Bacteria 904
181 nmdc:mga00v17_65454_c1 3300050491 Bacteria 2242
182 nmdc:mga0yw44_1866_c1 3300050492 Bacteria 8658
183 nmdc:mga06z11_44897_c1 3300050494 Bacteria 2231
184 nmdc:mga05p37_193011_c1 3300050507 Bacteria 2471
185 nmdc:mga05p37_43734_c1 3300050507 Bacteria 5511
186 nmdc:mga05p37_6788_c1 3300050507 Bacteria 13488
187 nmdc:mga09592_124185_c1 3300050508 Bacteria 2218
188 nmdc:mga09592_19741_c1 3300050508 Bacteria 5536
189 nmdc:mga0qj67_1446_c1 3300050509 Bacteria 16627
190 nmdc:mga0qj67_4267_c1 3300050509 Bacteria 10358
191 nmdc:mga06r32_373_c1 3300050510 Bacteria 13697
192 nmdc:mga06r32_540996_c1 3300050510 Bacteria 1139
193 nmdc:mga0sz30_4295_c1 3300050516 Bacteria 5141
194 nmdc:mga0sz30_46314_c1 3300050516 Bacteria 1836
195 Ga0500644_0014409 3300053088 Bacteria 2232
196 Ga0500651_0009222 3300053093 Bacteria 5852
197 Ga0500641_0040478 3300053096 Bacteria 1882
198 Ga0500569_017566 3300053109 Bacteria 1831
199 Ga0500652_010172 3300053131 Bacteria 3211
200 Ga0500658_0111244 3300053134 Bacteria 1206
201 Ga0500559_0002692 3300053136 Bacteria 9037
202 Ga0500568_0000034 3300053139 Bacteria 140490
203 Ga0501084_0136998 3300054114 Bacteria 2061
204 Ga0501082_0342448 3300060353 Bacteria 1303
205 Ga0501082_0492932 3300060353 Bacteria 1071
206 Ga0530510_0033312 3300061734 Bacteria 3710
207 2515852113 2515154155 Bacteria 7985436
208 2623588351 2622736626 Bacteria 7181580
209 2809593107 2808606522 Bacteria 9488490
210 2868092365 2868088558 Bacteria 7609351
211 2884698578 2884693830 Bacteria 11273186
212 2895427522 2895427314 Bacteria 13147766
213 2895451175 2895442618 Bacteria 11027144
214 2964329536 2964326757 Bacteria 3290868
215 8055070297 8055066027 Bacteria 9479577
216 Ga0111539_10005903
217 JGI24751J29686_10041847
218 Ga0070683_100017068
219 Ga0068869_100298733
220 Ga0068868_100003059
221 Ga0070661_100176481
222 Ga0070675_100000299
223 Ga0070671_100005830
224 Ga0070674_100173681
225 Ga0070659_100033858
226 Ga0070667_100015369
227 Ga0070667_100136626
228 Ga0070667_100195094
229 Ga0070709_10094366
230 Ga0070714_100009398
231 Ga0070711_100031730
232 Ga0070700_100012064
233 Ga0070708_100119416
234 Ga0070678_100323179
235 Ga0070662_100004679
236 Ga0070681_10349193
237 Ga0070706_100357824
238 Ga0070706_100386213
239 Ga0070707_100128268
240 Ga0070698_100154886
241 Ga0070699_100019481
242 Ga0070697_100098358
243 Ga0070665_100627151
244 Ga0070664_100027465
245 Ga0070664_100276759
246 Ga0068854_100170966
247 Ga0068856_100087224
248 Ga0068861_100019457
249 Ga0068870_10256758
250 Ga0068863_100022910
251 Ga0068863_100033597
252 Ga0068858_100118300
253 Ga0068858_100191968
254 Ga0068860_100594366
255 Ga0068862_100009559
256 Ga0068862_100332132
257 Ga0081455_10020491
258 Ga0081455_10024676
259 Ga0081455_10086208
260 Ga0081455_10133240
261 Ga0081540_1108569
262 Ga0081539_10072050
263 Ga0075365_10003536
264 Ga0075363_100079980
265 Ga0075363_100114495
266 Ga0075364_10082152
267 Ga0075362_10037446
268 Ga0075367_10096739
269 Ga0075369_10014199
270 Ga0075369_10044978
271 Ga0075370_10007037
272 Ga0075370_10248056
273 Ga0068871_100214201
274 Ga0075428_100005745
275 Ga0075428_100012033
276 Ga0075428_100255515
277 Ga0075430_100039993
278 Ga0075429_100195698
279 Ga0105250_10027960
280 Ga0105245_10177842
281 Ga0114129_10002697
282 Ga0114129_10042642
283 Ga0114129_10289074
284 Ga0105241_10198658
285 Ga0105248_10468433
286 Ga0105238_10564782
287 Ga0105249_10024603
288 Ga0105246_10441753
289 Ga0157369_10008178
290 Ga0157372_10116882
291 Ga0163163_10004448
292 Ga0163163_10112459
293 Ga0182008_10167972
294 Ga0157377_10027399
295 Ga0157376_10279107
296 Ga0206350_11139258
297 Ga0213876_10273911
298 Ga0207696_1038115
299 Ga0207699_10086685
300 Ga0207645_10042603
301 Ga0207684_10008452
302 Ga0207684_10060709
303 Ga0207684_10148434
304 Ga0207707_10221513
305 Ga0207663_10029272
306 Ga0207660_10383591
307 Ga0207657_10042368
308 Ga0207649_10044658
309 Ga0207646_10109672
310 Ga0207659_10015079
311 Ga0207687_10111845
312 Ga0207664_10006628
313 Ga0207644_10086195
314 Ga0207690_10122466
315 Ga0207690_10301827
316 Ga0207706_10003750
317 Ga0207669_10097392
318 Ga0207711_10175501
319 Ga0207689_10001180
320 Ga0207679_10014253
321 Ga0207679_10240192
322 Ga0207712_10033705
323 Ga0207640_10132770
324 Ga0207658_10010832
325 Ga0207658_10206259
326 Ga0207703_10249105
327 Ga0207708_10004343
328 Ga0207641_10005640
329 Ga0207641_10073698
330 Ga0207641_10197393
331 Ga0207676_10018896
332 Ga0207674_10006440
333 Ga0207675_100104136
334 Ga0207683_10295448
335 Ga0268264_10462534
336 Ga0307515_10023476
337 Ga0265338_10003404
338 Ga0265338_10053605
339 Ga0307512_10010759
340 Ga0307513_10118034
341 Ga0307508_10047696
342 Ga0307413_10000606
343 Ga0307406_10003157
344 Ga0307406_10071211
345 Ga0307406_10123049
346 Ga0307406_10262628
347 Ga0307407_10067486
348 Ga0307409_100000141
349 Ga0307409_100023147
350 Ga0307409_100064984
351 Ga0307416_100000136
352 Ga0307416_100172435
353 Ga0307416_100193068
354 Ga0307411_10316938
355 Ga0307415_100000322
356 Ga0307415_100027872
357 Ga0307415_100137626
358 Ga0307415_100196119
359 Ga0307510_10000959
360 Ga0307510_10233291
361 Ga0373927_0000090
362 Ga0373927_0251012
363 Ga0436365_0241155
364 Ga0436360_0278974
365 Ga0436361_1101474
366 Ga0436362_0015108
367 Ga0439431_0026872
368 Ga0466967_0665132
369 Ga0495632_0016260
370 Ga0496102_0001298
371 Ga0496102_0024986
372 Ga0496103_0030326
373 Ga0496104_0019767
374 Ga0496104_0339362
375 Ga0496108_0005733
376 Ga0496108_0062699
377 Ga0496109_0028223
378 Ga0496109_0086561
379 Ga0496110_0087507
380 Ga0496110_0307004
381 Ga0496111_0007746
382 Ga0496111_0069707
383 Ga0496111_0255802
384 Ga0496112_0004586
385 Ga0496112_0372018
386 Ga0496113_0008857
387 Ga0496113_0135801
388 Ga0496115_0013393
389 Ga0501039_0317431
390 Ga0501043_0232630
391 Ga0501043_0393355
392 Ga0501068_0017191
393 Ga0501081_0257876
394 nmdc:mga03683_10141_c1
395 nmdc:mga03n38_269957_c1
396 nmdc:mga00v17_65454_c1
397 nmdc:mga0yw44_1866_c1
398 nmdc:mga06z11_44897_c1
399 nmdc:mga05p37_193011_c1
400 nmdc:mga05p37_43734_c1
401 nmdc:mga05p37_6788_c1
402 nmdc:mga09592_124185_c1
403 nmdc:mga09592_19741_c1
404 nmdc:mga0qj67_1446_c1
405 nmdc:mga0qj67_4267_c1
406 nmdc:mga06r32_373_c1
407 nmdc:mga06r32_540996_c1
408 nmdc:mga0sz30_4295_c1
409 nmdc:mga0sz30_46314_c1
410 Ga0500644_0014409
411 Ga0500651_0009222
412 Ga0500641_0040478
413 Ga0500569_017566
414 Ga0500652_010172
415 Ga0500658_0111244
416 Ga0500559_0002692
417 Ga0500568_0000034
418 Ga0501084_0136998
419 Ga0501082_0342448
420 Ga0501082_0492932
421 Ga0530510_0033312
422 2515852113
423 2623588351
424 2809593107
425 2868092365
426 2884698578
427 2895427522
428 2895451175
429 2964329536
430 8055070297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

29

255

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t4c-assembly2.cif.gz_B membrane-associated thioredoxin oxidoreductase fete from campylobacter jejuni 0.7291 59 166
2f51-assembly2.cif.gz_B structure of trichomonas vaginalis thioredoxin 0.7027 59 175
2lja-assembly1.cif.gz_A solution structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus 0.6586 62 176
5xbs-assembly2.cif.gz_D peroxiredoxin from aeropyrum pernix (6m mutant) 0.6504 46 166
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.6436 61 173
ID Description Score Start End Superfamily
2f51B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7028 59 175 3.40.30.10
af_I6XYM2_34_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6702 62 166 3.40.30.10
af_O75715_24_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6676 62 109 3.40.30.10
af_E1JGY6_1529_1626_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6644 57 175 3.40.30.10
2ljaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6586 62 176 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W2DJM3-F1-model_v4 DUF899 domain-containing protein 0.8722 57 130
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.8104 48 158
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.7728 48 158
AF-A0A4Q3W5X3-F1-model_v4 TlpA family protein disulfide reductase 0.7541 62 150 GO:0016209
GO:0016491
AF-A0A2M7ZFQ7-F1-model_v4 Methylamine utilisation protein MauE domain-containing protein 0.7532 61 165 GO:0016020
GO:0030416

Map