F326315

General Info

Members Datasets Scaffolds Average Seq Length
215 152 430 139

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100045863|Ga0075431_1000458636
Length 149
Sequence VRTVLIDTGPIVAYLSANDTHHAWAVAALGQLRPPLLTCEPVLAEAVYLLRGLSSGSARVFELLRRGAVSVGFTLADELEPVQRVIARYGPGRTDLADACLVRMSEVYADPVVVTIDSQFRDVYRRHGRKTIPTMLPRLPRRRYAPPSG

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 35.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100045863 3300006847 Unclassified 4506
2 Ga0065715_10036508 3300005293 Unclassified 929
3 Ga0065707_10730553 3300005295 Unclassified 626
4 Ga0070658_10067325 3300005327 Bacteria 2926
5 Ga0070690_100635398 3300005330 Bacteria 814
6 Ga0070690_100879795 3300005330 Unclassified 699
7 Ga0068869_100300639 3300005334 Bacteria 1296
8 Ga0070661_100409502 3300005344 Bacteria 1073
9 Ga0070669_100879077 3300005353 Unclassified 765
10 Ga0070703_10054558 3300005406 Bacteria 1288
11 Ga0070709_10013794 3300005434 Bacteria 4554
12 Ga0070714_100638619 3300005435 Bacteria 1024
13 Ga0070713_100295852 3300005436 Unclassified 1489
14 Ga0070713_100550696 3300005436 Bacteria 1092
15 Ga0070713_100934949 3300005436 Unclassified 835
16 Ga0070710_10302893 3300005437 Bacteria 1044
17 Ga0070711_100413937 3300005439 Bacteria 1097
18 Ga0070711_101757876 3300005439 Unclassified 544
19 Ga0070705_100134436 3300005440 Bacteria 1618
20 Ga0070694_100518321 3300005444 Bacteria 951
21 Ga0070708_100068201 3300005445 Bacteria 3196
22 Ga0070708_100186310 3300005445 Bacteria 1941
23 Ga0070708_100599300 3300005445 Unclassified 1039
24 Ga0068867_101957226 3300005459 Unclassified 553
25 Ga0070685_10163421 3300005466 Bacteria 1421
26 Ga0070706_100058535 3300005467 Unclassified 3556
27 Ga0070706_100341813 3300005467 Unclassified 1395
28 Ga0070706_101037984 3300005467 Bacteria 755
29 Ga0070707_100172513 3300005468 Bacteria 2107
30 Ga0070707_100409363 3300005468 Bacteria 1316
31 Ga0070707_100681603 3300005468 Unclassified 991
32 Ga0070707_100833618 3300005468 Unclassified 886
33 Ga0070707_101252787 3300005468 Bacteria 708
34 Ga0070698_100122176 3300005471 Bacteria 2563
35 Ga0070699_100481613 3300005518 Unclassified 1126
36 Ga0070699_100561072 3300005518 Unclassified 1040
37 Ga0070699_100849578 3300005518 Unclassified 836
38 Ga0070697_100144235 3300005536 Bacteria 2003
39 Ga0070697_100304498 3300005536 Bacteria 1370
40 Ga0070697_101569648 3300005536 Bacteria 588
41 Ga0068853_100013719 3300005539 Bacteria 6619
42 Ga0070686_100928867 3300005544 Bacteria 709
43 Ga0070695_100335028 3300005545 Bacteria 1129
44 Ga0070696_100328039 3300005546 Bacteria 1180
45 Ga0070704_100330783 3300005549 Bacteria 1280
46 Ga0068855_100576262 3300005563 Unclassified 1216
47 Ga0070664_101393327 3300005564 Bacteria 663
48 Ga0068856_100188345 3300005614 Bacteria 2077
49 Ga0070702_100714096 3300005615 Unclassified 765
50 Ga0068852_100255152 3300005616 Bacteria 1681
51 Ga0068859_100777527 3300005617 Unclassified 1046
52 Ga0068858_100080596 3300005842 Bacteria 3025
53 Ga0068860_101546955 3300005843 Unclassified 685
54 Ga0068862_100266343 3300005844 Bacteria 1566
55 Ga0081455_10013786 3300005937 Bacteria 7954
56 Ga0081455_10098471 3300005937 Bacteria 2354
57 Ga0081539_10001784 3300005985 Bacteria 34142
58 Ga0070717_10004367 3300006028 Bacteria 10200
59 Ga0070717_10662065 3300006028 Unclassified 948
60 Ga0075365_10408958 3300006038 Bacteria 958
61 Ga0075365_10489155 3300006038 Unclassified 869
62 Ga0075368_10213957 3300006042 Unclassified 818
63 Ga0075364_10016772 3300006051 Bacteria 4562
64 Ga0075364_10089315 3300006051 Bacteria 2043
65 Ga0075362_10162663 3300006177 Unclassified 1075
66 Ga0075367_10026393 3300006178 Bacteria 3294
67 Ga0075366_10008767 3300006195 Bacteria 5631
68 Ga0075370_10054562 3300006353 Bacteria 2270
69 Ga0075428_100134596 3300006844 Bacteria 2688
70 Ga0075430_100078371 3300006846 Bacteria 2770
71 Ga0075430_100176557 3300006846 Bacteria 1777
72 Ga0075431_100084788 3300006847 Bacteria 3270
73 Ga0075434_100094341 3300006871 Bacteria 2997
74 Ga0075434_100132424 3300006871 Bacteria 2513
75 Ga0075429_100095066 3300006880 Bacteria 2599
76 Ga0075436_101352924 3300006914 Unclassified 539
77 Ga0097620_100777522 3300006931 Unclassified 1046
78 Ga0075435_100237972 3300007076 Bacteria 1548
79 Ga0111539_10130862 3300009094 Bacteria 2938
80 Ga0105245_10218992 3300009098 Bacteria 1836
81 Ga0105245_12446693 3300009098 Bacteria 576
82 Ga0114129_10293989 3300009147 Bacteria 2167
83 Ga0114129_10387095 3300009147 Unclassified 1845
84 Ga0114129_11038540 3300009147 Bacteria 1030
85 Ga0114129_11389941 3300009147 Unclassified 867
86 Ga0105243_10832008 3300009148 Bacteria 913
87 Ga0105243_11182737 3300009148 Bacteria 777
88 Ga0105242_10378634 3300009176 Bacteria 1315
89 Ga0105238_10565457 3300009551 Bacteria 1142
90 Ga0105249_10092335 3300009553 Bacteria 2834
91 Ga0105239_10082048 3300010375 Bacteria 3550
92 Ga0105246_10399082 3300011119 Bacteria 1141
93 Ga0157378_11782749 3300013297 Unclassified 663
94 Ga0163163_10807661 3300014325 Bacteria 1001
95 Ga0213876_10000322 3300021384 Bacteria 41914
96 Ga0207699_10021299 3300025906 Unclassified 3492
97 Ga0207695_10336626 3300025913 Bacteria 1397
98 Ga0207663_10011814 3300025916 Bacteria 4701
99 Ga0207646_10131489 3300025922 Bacteria 2253
100 Ga0207646_10737584 3300025922 Unclassified 879
101 Ga0207687_10398541 3300025927 Bacteria 1131
102 Ga0207700_10047652 3300025928 Bacteria 3178
103 Ga0207700_10147217 3300025928 Unclassified 1942
104 Ga0207700_10178980 3300025928 Bacteria 1774
105 Ga0207700_11397527 3300025928 Bacteria 622
106 Ga0207644_10627348 3300025931 Unclassified 894
107 Ga0207706_11002843 3300025933 Bacteria 701
108 Ga0207709_10566123 3300025935 Bacteria 895
109 Ga0207709_10673286 3300025935 Unclassified 826
110 Ga0207689_10058583 3300025942 Unclassified 3168
111 Ga0207667_10472338 3300025949 Unclassified 1273
112 Ga0207712_10172779 3300025961 Bacteria 1691
113 Ga0207639_10001355 3300026041 Bacteria 16538
114 Ga0207708_10112739 3300026075 Bacteria 2112
115 Ga0207698_10121010 3300026142 Bacteria 2215
116 Ga0207428_10000128 3300027907 Bacteria 104604
117 Ga0265319_1149574 3300028563 Unclassified 723
118 Ga0265334_10007504 3300028573 Bacteria 4675
119 Ga0265334_10216219 3300028573 Unclassified 663
120 Ga0265323_10007360 3300028653 Bacteria 4580
121 Ga0265338_10056461 3300028800 Bacteria 3481
122 Ga0265338_10068927 3300028800 Bacteria 3043
123 Ga0265338_10573153 3300028800 Unclassified 788
124 Ga0265329_10000730 3300031242 Bacteria 16682
125 Ga0265340_10129911 3300031247 Bacteria 1156
126 Ga0265316_10000530 3300031344 Bacteria 43046
127 Ga0265316_10015045 3300031344 Bacteria 6781
128 Ga0265316_10062790 3300031344 Bacteria 2882
129 Ga0265316_10084817 3300031344 Bacteria 2425
130 Ga0265316_10403624 3300031344 Bacteria 984
131 Ga0265314_10114941 3300031711 Bacteria 1704
132 Ga0265342_10001020 3300031712 Bacteria 27589
133 Ga0265342_10026557 3300031712 Bacteria 3625
134 Ga0373953_0263008 3300035117 Unclassified 751
135 Ga0373960_0356420 3300035121 Unclassified 556
136 Ga0373943_0275390 3300035170 Unclassified 950
137 Ga0373935_0319337 3300035692 Unclassified 1102
138 Ga0373933_0662634 3300035724 Unclassified 686
139 Ga0373947_0085149 3300035725 Unclassified 1963
140 Ga0373937_0046786 3300036401 Unclassified 3957
141 Ga0373937_0237737 3300036401 Unclassified 1716
142 Ga0373925_0017270 3300037068 Bacteria 5227
143 Ga0373925_0668421 3300037068 Unclassified 856
144 Ga0395900_0775898 3300037418 Bacteria 888
145 Ga0395905_0605815 3300037471 Bacteria 997
146 Ga0436364_0690574 3300037853 Bacteria 1077
147 Ga0436365_0173471 3300039437 Bacteria 110650
148 Ga0436365_1869278 3300039437 Unclassified 1150
149 Ga0451577_0021844 3300042876 Bacteria 5851
150 Ga0451577_0022028 3300042876 Bacteria 5822
151 Ga0453684_0000255 3300044712 Bacteria 229708
152 Ga0466970_0725203 3300044765 Unclassified 580
153 Ga0451576_0129554 3300045051 Bacteria 2629
154 Ga0451576_0705071 3300045051 Bacteria 1060
155 Ga0451576_1840728 3300045051 Unclassified 625
156 Ga0495592_0155547 3300046454 Bacteria 1578
157 Ga0495592_0226160 3300046454 Bacteria 1248
158 Ga0495653_0671132 3300046463 Bacteria 632
159 Ga0495580_0072299 3300046472 Unclassified 2409
160 Ga0495580_0091661 3300046472 Bacteria 2115
161 Ga0495664_0074246 3300046477 Bacteria 2034
162 Ga0495608_0235987 3300046511 Unclassified 1144
163 Ga0495608_0249175 3300046511 Bacteria 1108
164 Ga0495618_0191906 3300046514 Unclassified 1295
165 Ga0495628_0781711 3300046516 Unclassified 669
166 Ga0495630_0069414 3300046517 Bacteria 2651
167 Ga0495640_0054702 3300046533 Bacteria 2732
168 Ga0495587_0190250 3300046536 Unclassified 1162
169 Ga0495645_0119719 3300046543 Bacteria 1855
170 Ga0495645_0386925 3300046543 Unclassified 894
171 Ga0495667_0177232 3300046559 Bacteria 1369
172 Ga0495634_0160859 3300046642 Bacteria 1416
173 Ga0495635_0239542 3300046663 Bacteria 1224
174 Ga0495599_0065999 3300046678 Unclassified 2261
175 Ga0495623_0059116 3300046679 Bacteria 2409
176 Ga0495669_0011170 3300046684 Bacteria 3808
177 Ga0495613_0674537 3300046689 Unclassified 682
178 Ga0495670_0816335 3300046691 Unclassified 509
179 Ga0495600_0482254 3300046809 Unclassified 764
180 Ga0495581_0425734 3300047315 Unclassified 774
181 Ga0495636_0036923 3300047318 Bacteria 2017
182 Ga0495674_0097993 3300047319 Bacteria 2497
183 Ga0495674_0240100 3300047319 Bacteria 1493
184 Ga0495674_0560879 3300047319 Unclassified 908
185 Ga0495674_0599349 3300047319 Unclassified 873
186 Ga0495675_0045453 3300047444 Unclassified 2796
187 Ga0495684_0040106 3300047471 Bacteria 3590
188 Ga0495684_0078414 3300047471 Bacteria 2507
189 Ga0495684_0275869 3300047471 Unclassified 1215
190 Ga0495602_0231913 3300048088 Bacteria 1386
191 Ga0496112_0217869 3300048915 Bacteria 1865
192 Ga0501071_0531218 3300049587 Bacteria 903
193 Ga0501076_0639686 3300049592 Bacteria 878
194 Ga0501076_1668772 3300049592 Bacteria 523
195 Ga0501080_0102553 3300049742 Unclassified 2654
196 nmdc:mga03683_22816_c1 3300050489 Bacteria 2430
197 nmdc:mga00v17_56530_c1 3300050491 Bacteria 2399
198 nmdc:mga0yw44_439573_c1 3300050492 Bacteria 884
199 nmdc:mga0yw44_69344_c1 3300050492 Bacteria 2183
200 nmdc:mga06z11_4072_c1 3300050494 Bacteria 5714
201 nmdc:mga05p37_1049140_c1 3300050507 Unclassified 860
202 nmdc:mga09592_101218_c1 3300050508 Bacteria 2468
203 nmdc:mga06r32_111087_c1 3300050510 Bacteria 2697
204 nmdc:mga06r32_170387_c1 3300050510 Unclassified 2161
205 nmdc:mga08y16_21483_c1 3300050511 Bacteria 6816
206 nmdc:mga0n895_130488_c1 3300050512 Bacteria 2538
207 nmdc:mga0n895_373444_c1 3300050512 Bacteria 1443
208 nmdc:mga0n895_401866_c1 3300050512 Unclassified 1385
209 nmdc:mga0rr50_260191_c1 3300050513 Bacteria 1444
210 nmdc:mga08x19_262335_c1 3300050514 Unclassified 1194
211 Ga0495595_0144769 3300053084 Bacteria 1167
212 Ga0495595_0273562 3300053084 Unclassified 847
213 Ga0495619_0153029 3300053085 Unclassified 1591
214 Ga0495619_0401733 3300053085 Unclassified 946
215 Ga0501084_0898158 3300054114 Unclassified 745
216 Ga0075431_100045863
217 Ga0065715_10036508
218 Ga0065707_10730553
219 Ga0070658_10067325
220 Ga0070690_100635398
221 Ga0070690_100879795
222 Ga0068869_100300639
223 Ga0070661_100409502
224 Ga0070669_100879077
225 Ga0070703_10054558
226 Ga0070709_10013794
227 Ga0070714_100638619
228 Ga0070713_100295852
229 Ga0070713_100550696
230 Ga0070713_100934949
231 Ga0070710_10302893
232 Ga0070711_100413937
233 Ga0070711_101757876
234 Ga0070705_100134436
235 Ga0070694_100518321
236 Ga0070708_100068201
237 Ga0070708_100186310
238 Ga0070708_100599300
239 Ga0068867_101957226
240 Ga0070685_10163421
241 Ga0070706_100058535
242 Ga0070706_100341813
243 Ga0070706_101037984
244 Ga0070707_100172513
245 Ga0070707_100409363
246 Ga0070707_100681603
247 Ga0070707_100833618
248 Ga0070707_101252787
249 Ga0070698_100122176
250 Ga0070699_100481613
251 Ga0070699_100561072
252 Ga0070699_100849578
253 Ga0070697_100144235
254 Ga0070697_100304498
255 Ga0070697_101569648
256 Ga0068853_100013719
257 Ga0070686_100928867
258 Ga0070695_100335028
259 Ga0070696_100328039
260 Ga0070704_100330783
261 Ga0068855_100576262
262 Ga0070664_101393327
263 Ga0068856_100188345
264 Ga0070702_100714096
265 Ga0068852_100255152
266 Ga0068859_100777527
267 Ga0068858_100080596
268 Ga0068860_101546955
269 Ga0068862_100266343
270 Ga0081455_10013786
271 Ga0081455_10098471
272 Ga0081539_10001784
273 Ga0070717_10004367
274 Ga0070717_10662065
275 Ga0075365_10408958
276 Ga0075365_10489155
277 Ga0075368_10213957
278 Ga0075364_10016772
279 Ga0075364_10089315
280 Ga0075362_10162663
281 Ga0075367_10026393
282 Ga0075366_10008767
283 Ga0075370_10054562
284 Ga0075428_100134596
285 Ga0075430_100078371
286 Ga0075430_100176557
287 Ga0075431_100084788
288 Ga0075434_100094341
289 Ga0075434_100132424
290 Ga0075429_100095066
291 Ga0075436_101352924
292 Ga0097620_100777522
293 Ga0075435_100237972
294 Ga0111539_10130862
295 Ga0105245_10218992
296 Ga0105245_12446693
297 Ga0114129_10293989
298 Ga0114129_10387095
299 Ga0114129_11038540
300 Ga0114129_11389941
301 Ga0105243_10832008
302 Ga0105243_11182737
303 Ga0105242_10378634
304 Ga0105238_10565457
305 Ga0105249_10092335
306 Ga0105239_10082048
307 Ga0105246_10399082
308 Ga0157378_11782749
309 Ga0163163_10807661
310 Ga0213876_10000322
311 Ga0207699_10021299
312 Ga0207695_10336626
313 Ga0207663_10011814
314 Ga0207646_10131489
315 Ga0207646_10737584
316 Ga0207687_10398541
317 Ga0207700_10047652
318 Ga0207700_10147217
319 Ga0207700_10178980
320 Ga0207700_11397527
321 Ga0207644_10627348
322 Ga0207706_11002843
323 Ga0207709_10566123
324 Ga0207709_10673286
325 Ga0207689_10058583
326 Ga0207667_10472338
327 Ga0207712_10172779
328 Ga0207639_10001355
329 Ga0207708_10112739
330 Ga0207698_10121010
331 Ga0207428_10000128
332 Ga0265319_1149574
333 Ga0265334_10007504
334 Ga0265334_10216219
335 Ga0265323_10007360
336 Ga0265338_10056461
337 Ga0265338_10068927
338 Ga0265338_10573153
339 Ga0265329_10000730
340 Ga0265340_10129911
341 Ga0265316_10000530
342 Ga0265316_10015045
343 Ga0265316_10062790
344 Ga0265316_10084817
345 Ga0265316_10403624
346 Ga0265314_10114941
347 Ga0265342_10001020
348 Ga0265342_10026557
349 Ga0373953_0263008
350 Ga0373960_0356420
351 Ga0373943_0275390
352 Ga0373935_0319337
353 Ga0373933_0662634
354 Ga0373947_0085149
355 Ga0373937_0046786
356 Ga0373937_0237737
357 Ga0373925_0017270
358 Ga0373925_0668421
359 Ga0395900_0775898
360 Ga0395905_0605815
361 Ga0436364_0690574
362 Ga0436365_0173471
363 Ga0436365_1869278
364 Ga0451577_0021844
365 Ga0451577_0022028
366 Ga0453684_0000255
367 Ga0466970_0725203
368 Ga0451576_0129554
369 Ga0451576_0705071
370 Ga0451576_1840728
371 Ga0495592_0155547
372 Ga0495592_0226160
373 Ga0495653_0671132
374 Ga0495580_0072299
375 Ga0495580_0091661
376 Ga0495664_0074246
377 Ga0495608_0235987
378 Ga0495608_0249175
379 Ga0495618_0191906
380 Ga0495628_0781711
381 Ga0495630_0069414
382 Ga0495640_0054702
383 Ga0495587_0190250
384 Ga0495645_0119719
385 Ga0495645_0386925
386 Ga0495667_0177232
387 Ga0495634_0160859
388 Ga0495635_0239542
389 Ga0495599_0065999
390 Ga0495623_0059116
391 Ga0495669_0011170
392 Ga0495613_0674537
393 Ga0495670_0816335
394 Ga0495600_0482254
395 Ga0495581_0425734
396 Ga0495636_0036923
397 Ga0495674_0097993
398 Ga0495674_0240100
399 Ga0495674_0560879
400 Ga0495674_0599349
401 Ga0495675_0045453
402 Ga0495684_0040106
403 Ga0495684_0078414
404 Ga0495684_0275869
405 Ga0495602_0231913
406 Ga0496112_0217869
407 Ga0501071_0531218
408 Ga0501076_0639686
409 Ga0501076_1668772
410 Ga0501080_0102553
411 nmdc:mga03683_22816_c1
412 nmdc:mga00v17_56530_c1
413 nmdc:mga0yw44_439573_c1
414 nmdc:mga0yw44_69344_c1
415 nmdc:mga06z11_4072_c1
416 nmdc:mga05p37_1049140_c1
417 nmdc:mga09592_101218_c1
418 nmdc:mga06r32_111087_c1
419 nmdc:mga06r32_170387_c1
420 nmdc:mga08y16_21483_c1
421 nmdc:mga0n895_130488_c1
422 nmdc:mga0n895_373444_c1
423 nmdc:mga0n895_401866_c1
424 nmdc:mga0rr50_260191_c1
425 nmdc:mga08x19_262335_c1
426 Ga0495595_0144769
427 Ga0495595_0273562
428 Ga0495619_0153029
429 Ga0495619_0401733
430 Ga0501084_0898158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

126

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8921 2 127
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.8243 1 115
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.82 2 127
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.8012 1 125
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7682 1 125
ID Description Score Start End Superfamily
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8851 3 117 3.40.50.1010
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8094 1 115 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8078 3 117 3.40.50.1010
1w8iA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7545 1 122 3.40.50.1010
af_P9WF55_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7488 1 117 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V8GYG4-F1-model_v4 Pilus assembly protein 1.001 2 130
AF-A0A2W5ZR27-F1-model_v4 Pilus assembly protein 0.999 2 130
AF-A0A534VQ07-F1-model_v4 PIN domain-containing protein 0.9964 2 130
AF-A0A2V5PC03-F1-model_v4 Pilus assembly protein 0.9923 1 130
AF-A0A7W1SYP2-F1-model_v4 Pilus assembly protein 0.9879 14 130

Map