F326259

General Info

Members Datasets Scaffolds Average Seq Length
215 148 430 286

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10031167|Ga0081455_100311675
Length 345
Sequence MSPRMRAIVPMSALVPQVLPEATGLGSQRQALVQRWPALGCAIEVALAPGVGEHAGVRYSINVPNFGDFADPRAVARVAAAAEQAGWDGVFVWDHVVHNKAARRGQPFGDPWMLLTAAALATSKIRLGPLVTPVARRRPEQVARQVATLDALSGGRVIFGAGLGGPIEDEFGSFGEPTDPIVLAERLDEGLELLARYWSGEQVSHQGRHYQVREVTLLPASTQRPRPPVWIGGYWPRRAPMRRAARWDGVVPLFSDARHGEVPAVDQVRDLVGYLRRHRREPAGRPFEIVLGGATPGDPAKAHARIAPLFEAGATWWDERQLQTTDDVHRIEPVLGRIEHGPPAD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
29 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
32 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
37 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
38 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
42 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
43 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
44 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
57 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
65 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
77 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
82 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
83 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
84 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
126 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
127 2558860280 Kutzneria sp. 744 Isolate Unclassified
128 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
129 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
130 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
131 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
132 2808606394 Promicromonospora sp. C35 Isolate Unclassified
133 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
134 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
135 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
136 2862574272 Streptomyces sp. AcE210 Isolate Nodule
137 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
138 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
139 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
140 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
141 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
142 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
143 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
144 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
145 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
146 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
147 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
148 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.37
Metatranscriptomes 0
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0.47
Rhizoplane 7.44
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10031167 3300005937 Bacteria 4830
2 JGI24740J21852_10023891 3300001979 Bacteria 2080
3 JGI24739J22299_10026250 3300001989 Bacteria 2045
4 Ga0070667_100093470 3300005367 Bacteria 2590
5 Ga0070667_100322476 3300005367 Bacteria 1394
6 Ga0070714_100068136 3300005435 Bacteria 3070
7 Ga0070713_100090395 3300005436 Bacteria 2632
8 Ga0068857_100125550 3300005577 Bacteria 2312
9 Ga0068864_100357556 3300005618 Bacteria 1379
10 Ga0081540_1090693 3300005983 Bacteria 1345
11 Ga0075365_10027569 3300006038 Bacteria 3615
12 Ga0070715_10011266 3300006163 Bacteria 3216
13 Ga0070712_100094095 3300006175 Bacteria 2201
14 Ga0075430_100030375 3300006846 Bacteria 4589
15 Ga0075431_100016765 3300006847 Bacteria 7440
16 Ga0075431_100032592 3300006847 Bacteria 5369
17 Ga0075433_10068116 3300006852 Bacteria 3124
18 Ga0075434_100112225 3300006871 Bacteria 2737
19 Ga0075429_100021787 3300006880 Bacteria 5556
20 Ga0075429_100043008 3300006880 Bacteria 3930
21 Ga0075436_100013532 3300006914 Bacteria 5588
22 Ga0111539_10024312 3300009094 Bacteria 7438
23 Ga0114129_10028864 3300009147 Bacteria 7860
24 Ga0114129_10038342 3300009147 Bacteria 6761
25 Ga0114129_10052037 3300009147 Bacteria 5748
26 Ga0114129_10148388 3300009147 Bacteria 3211
27 Ga0157374_10470524 3300013296 Bacteria 1259
28 Ga0209758_1011665 3300025297 Bacteria 5052
29 Ga0207426_1008866 3300025302 Bacteria 4023
30 Ga0207647_10019086 3300025904 Bacteria 4617
31 Ga0207693_10089042 3300025915 Bacteria 2419
32 Ga0207693_10212761 3300025915 Bacteria 1519
33 Ga0207664_10299941 3300025929 Bacteria 1413
34 Ga0207664_10391137 3300025929 Bacteria 1235
35 Ga0207702_10359275 3300026078 Bacteria 1396
36 Ga0207428_10006239 3300027907 Bacteria 11015
37 Ga0314311_1006246 3300030733 Bacteria 1251
38 Ga0307413_10000196 3300031824 Bacteria 17546
39 Ga0307518_10176597 3300031838 Bacteria 1449
40 Ga0307411_10021341 3300032005 Bacteria 3787
41 Ga0395899_0024795 3300037312 Bacteria 4532
42 Ga0395900_0007254 3300037418 Bacteria 11477
43 Ga0395900_0116006 3300037418 Bacteria 2748
44 Ga0395900_0129928 3300037418 Bacteria 2582
45 Ga0395900_0226885 3300037418 Bacteria 1880
46 Ga0395898_0002672 3300037466 Bacteria 20661
47 Ga0395898_0022289 3300037466 Bacteria 6415
48 Ga0395898_0050864 3300037466 Bacteria 4054
49 Ga0395905_0008215 3300037471 Bacteria 10308
50 Ga0395905_0102680 3300037471 Bacteria 2684
51 Ga0395905_0318866 3300037471 Bacteria 1444
52 Ga0395905_0616189 3300037471 Bacteria 987
53 Ga0395901_0095632 3300038443 Bacteria 3113
54 Ga0395901_0096026 3300038443 Bacteria 3106
55 Ga0395901_0147656 3300038443 Bacteria 2471
56 Ga0395901_0370481 3300038443 Bacteria 1475
57 Ga0439439_0000243 3300041406 Bacteria 8544
58 Ga0439457_000311 3300042014 Bacteria 13438
59 Ga0439457_029039 3300042014 Bacteria 1225
60 Ga0450894_000703 3300042131 Bacteria 5540
61 Ga0450899_000445 3300042135 Bacteria 4618
62 Ga0450906_003270 3300042145 Bacteria 3500
63 Ga0450908_010592 3300042184 Bacteria 1699
64 Ga0439460_0033696 3300042461 Bacteria 1472
65 Ga0466966_0025390 3300044684 Bacteria 3871
66 Ga0466966_0207782 3300044684 Bacteria 1184
67 Ga0466961_0030272 3300044693 Bacteria 3479
68 Ga0466961_0057959 3300044693 Bacteria 2464
69 Ga0466961_0060786 3300044693 Bacteria 2402
70 Ga0466961_0115916 3300044693 Bacteria 1684
71 Ga0466961_0177588 3300044693 Bacteria 1323
72 Ga0466963_0001804 3300044694 Bacteria 11656
73 Ga0466963_0291872 3300044694 Bacteria 1146
74 Ga0466964_0060488 3300044706 Bacteria 1575
75 Ga0466971_0005440 3300044719 Bacteria 5526
76 Ga0466971_0053148 3300044719 Bacteria 1825
77 Ga0466970_0022534 3300044765 Bacteria 3287
78 Ga0466970_0029774 3300044765 Bacteria 2877
79 Ga0466970_0064171 3300044765 Bacteria 1969
80 Ga0466970_0120111 3300044765 Bacteria 1439
81 Ga0466957_0005223 3300044842 Bacteria 7266
82 Ga0466957_0023328 3300044842 Bacteria 3658
83 Ga0466957_0191372 3300044842 Bacteria 1340
84 Ga0466957_0334105 3300044842 Bacteria 1025
85 Ga0466959_0020450 3300045049 Bacteria 4877
86 Ga0466959_0029163 3300045049 Bacteria 4089
87 Ga0466959_0053308 3300045049 Bacteria 2957
88 Ga0466959_0095692 3300045049 Bacteria 2130
89 Ga0466959_0221229 3300045049 Bacteria 1313
90 Ga0466958_0073161 3300045836 Bacteria 2099
91 Ga0466958_0233675 3300045836 Bacteria 1174
92 Ga0466967_0001172 3300045976 Bacteria 14721
93 Ga0466967_0001204 3300045976 Bacteria 14560
94 Ga0466967_0001350 3300045976 Bacteria 14087
95 Ga0466967_0130938 3300045976 Bacteria 2329
96 Ga0466967_0144750 3300045976 Bacteria 2216
97 Ga0466967_0417857 3300045976 Bacteria 1307
98 Ga0466967_0463553 3300045976 Bacteria 1240
99 Ga0466967_0701700 3300045976 Bacteria 1002
100 Ga0495603_0001122 3300046455 Bacteria 15580
101 Ga0495639_0004793 3300046475 Bacteria 5816
102 Ga0495662_0054124 3300046476 Bacteria 1938
103 Ga0495594_0001428 3300046499 Bacteria 12386
104 Ga0495594_0018034 3300046499 Bacteria 3737
105 Ga0495583_0005114 3300046506 Bacteria 9036
106 Ga0495583_0006346 3300046506 Bacteria 7752
107 Ga0495616_0093807 3300046513 Bacteria 1417
108 Ga0495620_0004176 3300046515 Bacteria 8178
109 Ga0495628_0044293 3300046516 Bacteria 3541
110 Ga0495643_0008528 3300046522 Bacteria 6477
111 Ga0495648_0035393 3300046524 Bacteria 3237
112 Ga0495666_0003978 3300046526 Bacteria 7474
113 Ga0495654_0102014 3300046530 Bacteria 1320
114 Ga0495668_0008821 3300046616 Bacteria 6249
115 Ga0495668_0032875 3300046616 Bacteria 2916
116 Ga0495634_0054735 3300046642 Bacteria 2669
117 Ga0495634_0144689 3300046642 Bacteria 1507
118 Ga0495611_0054461 3300046648 Bacteria 1808
119 Ga0495625_0060143 3300046660 Bacteria 2692
120 Ga0495588_0037650 3300046674 Bacteria 2458
121 Ga0495646_0131937 3300046680 Bacteria 1405
122 Ga0495613_0065789 3300046689 Bacteria 2648
123 Ga0495624_0016019 3300046690 Bacteria 5046
124 Ga0495649_0041078 3300046694 Bacteria 2530
125 Ga0495589_0033098 3300046794 Bacteria 2597
126 Ga0495589_0037038 3300046794 Bacteria 2444
127 Ga0495660_0037113 3300046810 Bacteria 2715
128 Ga0495581_0059534 3300047315 Bacteria 2207
129 Ga0495636_0103354 3300047318 Bacteria 1248
130 Ga0495676_0006702 3300047321 Bacteria 10607
131 Ga0495676_0030307 3300047321 Bacteria 4594
132 Ga0495676_0032421 3300047321 Bacteria 4409
133 Ga0495676_0094718 3300047321 Bacteria 2223
134 Ga0495683_0020525 3300047323 Bacteria 3407
135 Ga0495683_0106679 3300047323 Bacteria 1341
136 Ga0495687_006069 3300047443 Bacteria 7515
137 Ga0495687_007299 3300047443 Bacteria 6548
138 Ga0495687_041698 3300047443 Bacteria 2011
139 Ga0495677_0052022 3300047445 Bacteria 1509
140 Ga0495685_007517 3300047447 Bacteria 3600
141 Ga0495686_0120420 3300047472 Bacteria 1565
142 Ga0495593_0139243 3300047673 Bacteria 1229
143 Ga0495614_0036266 3300048089 Bacteria 2117
144 Ga0496102_0251914 3300048905 Bacteria 1665
145 Ga0496104_0028864 3300048907 Bacteria 5143
146 Ga0496105_0026884 3300048908 Bacteria 4696
147 Ga0496106_0192944 3300048909 Bacteria 1620
148 Ga0496107_0137728 3300048910 Bacteria 1804
149 Ga0496107_0199026 3300048910 Bacteria 1489
150 Ga0496108_0001978 3300048911 Bacteria 16407
151 Ga0496109_0000650 3300048912 Bacteria 28852
152 Ga0496109_0025343 3300048912 Bacteria 5284
153 Ga0496109_0359957 3300048912 Bacteria 1375
154 Ga0496110_0040067 3300048913 Bacteria 4082
155 Ga0496111_0078184 3300048914 Bacteria 2412
156 Ga0496112_0000799 3300048915 Bacteria 22235
157 Ga0496112_0589465 3300048915 Bacteria 1044
158 Ga0496113_0050356 3300048916 Bacteria 3105
159 Ga0496115_0078401 3300048918 Bacteria 2688
160 Ga0495678_068297 3300049459 Bacteria 1311
161 Ga0501031_0125687 3300049568 Bacteria 1676
162 Ga0501036_0086199 3300049572 Bacteria 2655
163 Ga0501038_0031364 3300049574 Bacteria 4697
164 Ga0501039_0045361 3300049575 Bacteria 3396
165 Ga0501040_0093112 3300049576 Bacteria 2096
166 Ga0501042_0065083 3300049578 Bacteria 2606
167 Ga0501043_0079207 3300049579 Bacteria 2582
168 Ga0501047_0060985 3300049581 Bacteria 3639
169 Ga0501075_0177478 3300049591 Bacteria 1625
170 Ga0501076_0083972 3300049592 Bacteria 2558
171 Ga0501045_0178998 3300049824 Bacteria 1580
172 Ga0501045_0395106 3300049824 Bacteria 1029
173 nmdc:mga0yw44_18536_c1 3300050492 Bacteria 3816
174 nmdc:mga05p37_304_c1 3300050507 Bacteria 51652
175 nmdc:mga05p37_3693_c1 3300050507 Bacteria 17901
176 nmdc:mga05p37_6701_c1 3300050507 Bacteria 13571
177 nmdc:mga09592_3328_c1 3300050508 Bacteria 13001
178 nmdc:mga0qj67_16573_c1 3300050509 Bacteria 5593
179 nmdc:mga0qj67_3591_c1 3300050509 Bacteria 11193
180 nmdc:mga06r32_31467_c1 3300050510 Bacteria 4984
181 nmdc:mga06r32_83_c1 3300050510 Bacteria 64174
182 nmdc:mga08y16_10912_c1 3300050511 Bacteria 9542
183 nmdc:mga0n895_112823_c1 3300050512 Bacteria 2735
184 nmdc:mga0rr50_37742_c1 3300050513 Bacteria 3491
185 nmdc:mga08x19_29249_c1 3300050514 Bacteria 3455
186 Ga0500568_0053300 3300053139 Bacteria 1586
187 Ga0501082_0178985 3300060353 Bacteria 1844
188 Ga0466962_0013746 3300061719 Bacteria 3897
189 Ga0530510_0016009 3300061734 Bacteria 5299
190 Ga0530510_0201739 3300061734 Bacteria 1477
191 2552107830 2551306166 Bacteria 9731570
192 2558910662 2558860112 Bacteria 9931328
193 2559431911 2558860280 Bacteria 11429938
194 2739324992 2738543027 Bacteria 6409078
195 2739605768 2739367654 Bacteria 6049412
196 2760624108 2758568621 Bacteria 5967089
197 2795786877 2795385470 Bacteria 8317180
198 2809029009 2808606394 Bacteria 6248540
199 2816425834 2816332119 Bacteria 8120218
200 2862178708 2862178590 Bacteria 8583590
201 2862291462 2862290372 Bacteria 7471434
202 2862574414 2862574272 Bacteria 10567477
203 2883822073 2883821847 Bacteria 5121194
204 2884698388 2884693830 Bacteria 11273186
205 2895450983 2895442618 Bacteria 11027144
206 2912728611 2912723979 Bacteria 8557534
207 2917736776 2917736166 Bacteria 9690793
208 2917743109 2917736166 Bacteria 9690793
209 2997455937 2997451912 Bacteria 8492419
210 2997608623 2997600082 Bacteria 9896405
211 3002998724 3002998708 Bacteria 11715108
212 8033689344 8033684223 Bacteria 6906479
213 8053953317 8053945823 Bacteria 8962862
214 8056584942 8056579771 Bacteria 5840325
215 8056830722 8056829672 Bacteria 9045328
216 Ga0081455_10031167
217 JGI24740J21852_10023891
218 JGI24739J22299_10026250
219 Ga0070667_100093470
220 Ga0070667_100322476
221 Ga0070714_100068136
222 Ga0070713_100090395
223 Ga0068857_100125550
224 Ga0068864_100357556
225 Ga0081540_1090693
226 Ga0075365_10027569
227 Ga0070715_10011266
228 Ga0070712_100094095
229 Ga0075430_100030375
230 Ga0075431_100016765
231 Ga0075431_100032592
232 Ga0075433_10068116
233 Ga0075434_100112225
234 Ga0075429_100021787
235 Ga0075429_100043008
236 Ga0075436_100013532
237 Ga0111539_10024312
238 Ga0114129_10028864
239 Ga0114129_10038342
240 Ga0114129_10052037
241 Ga0114129_10148388
242 Ga0157374_10470524
243 Ga0209758_1011665
244 Ga0207426_1008866
245 Ga0207647_10019086
246 Ga0207693_10089042
247 Ga0207693_10212761
248 Ga0207664_10299941
249 Ga0207664_10391137
250 Ga0207702_10359275
251 Ga0207428_10006239
252 Ga0314311_1006246
253 Ga0307413_10000196
254 Ga0307518_10176597
255 Ga0307411_10021341
256 Ga0395899_0024795
257 Ga0395900_0007254
258 Ga0395900_0116006
259 Ga0395900_0129928
260 Ga0395900_0226885
261 Ga0395898_0002672
262 Ga0395898_0022289
263 Ga0395898_0050864
264 Ga0395905_0008215
265 Ga0395905_0102680
266 Ga0395905_0318866
267 Ga0395905_0616189
268 Ga0395901_0095632
269 Ga0395901_0096026
270 Ga0395901_0147656
271 Ga0395901_0370481
272 Ga0439439_0000243
273 Ga0439457_000311
274 Ga0439457_029039
275 Ga0450894_000703
276 Ga0450899_000445
277 Ga0450906_003270
278 Ga0450908_010592
279 Ga0439460_0033696
280 Ga0466966_0025390
281 Ga0466966_0207782
282 Ga0466961_0030272
283 Ga0466961_0057959
284 Ga0466961_0060786
285 Ga0466961_0115916
286 Ga0466961_0177588
287 Ga0466963_0001804
288 Ga0466963_0291872
289 Ga0466964_0060488
290 Ga0466971_0005440
291 Ga0466971_0053148
292 Ga0466970_0022534
293 Ga0466970_0029774
294 Ga0466970_0064171
295 Ga0466970_0120111
296 Ga0466957_0005223
297 Ga0466957_0023328
298 Ga0466957_0191372
299 Ga0466957_0334105
300 Ga0466959_0020450
301 Ga0466959_0029163
302 Ga0466959_0053308
303 Ga0466959_0095692
304 Ga0466959_0221229
305 Ga0466958_0073161
306 Ga0466958_0233675
307 Ga0466967_0001172
308 Ga0466967_0001204
309 Ga0466967_0001350
310 Ga0466967_0130938
311 Ga0466967_0144750
312 Ga0466967_0417857
313 Ga0466967_0463553
314 Ga0466967_0701700
315 Ga0495603_0001122
316 Ga0495639_0004793
317 Ga0495662_0054124
318 Ga0495594_0001428
319 Ga0495594_0018034
320 Ga0495583_0005114
321 Ga0495583_0006346
322 Ga0495616_0093807
323 Ga0495620_0004176
324 Ga0495628_0044293
325 Ga0495643_0008528
326 Ga0495648_0035393
327 Ga0495666_0003978
328 Ga0495654_0102014
329 Ga0495668_0008821
330 Ga0495668_0032875
331 Ga0495634_0054735
332 Ga0495634_0144689
333 Ga0495611_0054461
334 Ga0495625_0060143
335 Ga0495588_0037650
336 Ga0495646_0131937
337 Ga0495613_0065789
338 Ga0495624_0016019
339 Ga0495649_0041078
340 Ga0495589_0033098
341 Ga0495589_0037038
342 Ga0495660_0037113
343 Ga0495581_0059534
344 Ga0495636_0103354
345 Ga0495676_0006702
346 Ga0495676_0030307
347 Ga0495676_0032421
348 Ga0495676_0094718
349 Ga0495683_0020525
350 Ga0495683_0106679
351 Ga0495687_006069
352 Ga0495687_007299
353 Ga0495687_041698
354 Ga0495677_0052022
355 Ga0495685_007517
356 Ga0495686_0120420
357 Ga0495593_0139243
358 Ga0495614_0036266
359 Ga0496102_0251914
360 Ga0496104_0028864
361 Ga0496105_0026884
362 Ga0496106_0192944
363 Ga0496107_0137728
364 Ga0496107_0199026
365 Ga0496108_0001978
366 Ga0496109_0000650
367 Ga0496109_0025343
368 Ga0496109_0359957
369 Ga0496110_0040067
370 Ga0496111_0078184
371 Ga0496112_0000799
372 Ga0496112_0589465
373 Ga0496113_0050356
374 Ga0496115_0078401
375 Ga0495678_068297
376 Ga0501031_0125687
377 Ga0501036_0086199
378 Ga0501038_0031364
379 Ga0501039_0045361
380 Ga0501040_0093112
381 Ga0501042_0065083
382 Ga0501043_0079207
383 Ga0501047_0060985
384 Ga0501075_0177478
385 Ga0501076_0083972
386 Ga0501045_0178998
387 Ga0501045_0395106
388 nmdc:mga0yw44_18536_c1
389 nmdc:mga05p37_304_c1
390 nmdc:mga05p37_3693_c1
391 nmdc:mga05p37_6701_c1
392 nmdc:mga09592_3328_c1
393 nmdc:mga0qj67_16573_c1
394 nmdc:mga0qj67_3591_c1
395 nmdc:mga06r32_31467_c1
396 nmdc:mga06r32_83_c1
397 nmdc:mga08y16_10912_c1
398 nmdc:mga0n895_112823_c1
399 nmdc:mga0rr50_37742_c1
400 nmdc:mga08x19_29249_c1
401 Ga0500568_0053300
402 Ga0501082_0178985
403 Ga0466962_0013746
404 Ga0530510_0016009
405 Ga0530510_0201739
406 2552107830
407 2558910662
408 2559431911
409 2739324992
410 2739605768
411 2760624108
412 2795786877
413 2809029009
414 2816425834
415 2862178708
416 2862291462
417 2862574414
418 2883822073
419 2884698388
420 2895450983
421 2912728611
422 2917736776
423 2917743109
424 2997455937
425 2997608623
426 3002998724
427 8033689344
428 8053953317
429 8056584942
430 8056830722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

48

295

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jv3-assembly1.cif.gz_B crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.8181 1 262
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8171 1 282
7jv3-assembly1.cif.gz_A crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.8124 1 262
1luc-assembly1.cif.gz_A bacterial luciferase 0.8111 1 283
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.809 1 288
ID Description Score Start End Superfamily
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8359 2 282 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8201 2 279 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8193 1 282 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8171 1 282 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8059 2 282 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A5N9DRF8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.965 1 287 GO:0008726
GO:0046306
AF-A0A1J4P147-F1-model_v4 Luciferase-like domain-containing protein 0.9586 1 287 GO:0008726
GO:0046306
AF-A0A5N9DRF8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9582 1 287 GO:0008726
GO:0046306
AF-A0A1F5DE47-F1-model_v4 Luciferase-like domain-containing protein 0.957 1 286 GO:0008726
GO:0046306
AF-A0A0K3B5R0-F1-model_v4 Luciferase 0.9558 1 289 GO:0008726
GO:0046306

Map