F326224

General Info

Members Datasets Scaffolds Average Seq Length
215 99 215 342

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100218841|Ga0068855_1002188412
Length 316
Sequence VTYRQLIARFGTASAALAAVPDLARRGGGKAPALRSRDDADREIARVEKFGARFLALGQALYPRLLAELEDAPPLIIVKGDLGLLDRQAVAMVGARNASAAACRFARGLAHDLGQEGLVVVSGLARGIDSAAHDGALETGTIGVIAGGIDIFYPPENEVRQRALYERGLVLAEMTVVVEAAPRSGSLITARLAAEAGREVMAVPGSPLDPRAQGCNQLIRDGATLIQNAADVAEAIRPYQSTVKSRSVSYEPPDEMNGDDALGVVEALLGPSPVPVDEIIRLSGAPSGSVQMALLELDLAGRLDRHAGNKVSLRTA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
98 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
99 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 99.07
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019471 3300001989 Bacteria 2429
2 JGI24737J22298_10000941 3300001990 Bacteria 10318
3 JGI24735J21928_10015143 3300002067 Bacteria 2409
4 JGI24738J21930_10005989 3300002075 Bacteria 2884
5 Ga0070658_10000950 3300005327 Bacteria 24773
6 Ga0070658_10044113 3300005327 Bacteria 3603
7 Ga0070658_10171916 3300005327 Bacteria 1820
8 Ga0070658_10262477 3300005327 Bacteria 1467
9 Ga0070683_100038760 3300005329 Bacteria 4370
10 Ga0070683_100093835 3300005329 Bacteria 2820
11 Ga0070670_100072937 3300005331 Bacteria 2949
12 Ga0070666_10002265 3300005335 Bacteria 11628
13 Ga0070680_100083531 3300005336 Bacteria 2638
14 Ga0070680_100128885 3300005336 Bacteria 2115
15 Ga0070660_100000260 3300005339 Bacteria 34947
16 Ga0070660_100099941 3300005339 Bacteria 2297
17 Ga0070691_10018095 3300005341 Bacteria 3245
18 Ga0070661_100000246 3300005344 Bacteria 44536
19 Ga0070692_10022727 3300005345 Bacteria 3066
20 Ga0070671_100042788 3300005355 Bacteria 3766
21 Ga0070659_100000195 3300005366 Bacteria 46642
22 Ga0070659_100003071 3300005366 Bacteria 11854
23 Ga0070659_100054386 3300005366 Bacteria 3153
24 Ga0070667_100019749 3300005367 Bacteria 5591
25 Ga0070663_100031782 3300005455 Bacteria 3631
26 Ga0070663_100074230 3300005455 Bacteria 2483
27 Ga0070662_100000047 3300005457 Bacteria 66967
28 Ga0070662_100008338 3300005457 Bacteria 6751
29 Ga0070681_10117268 3300005458 Bacteria 2599
30 Ga0070684_100031142 3300005535 Bacteria 4539
31 Ga0070684_100093599 3300005535 Bacteria 2675
32 Ga0068853_100000033 3300005539 Bacteria 113700
33 Ga0068853_100006374 3300005539 Bacteria 9372
34 Ga0068853_100015708 3300005539 Bacteria 6220
35 Ga0070693_100005511 3300005547 Bacteria 6085
36 Ga0068855_100000531 3300005563 Bacteria 46681
37 Ga0068855_100125780 3300005563 Bacteria 2931
38 Ga0068855_100138162 3300005563 Bacteria 2779
39 Ga0068855_100218841 3300005563 Bacteria 2136
40 Ga0068855_100345111 3300005563 Bacteria 1641
41 Ga0070664_100000242 3300005564 Bacteria 39241
42 Ga0070664_100010345 3300005564 Bacteria 7568
43 Ga0070664_100022741 3300005564 Bacteria 5171
44 Ga0068857_100149494 3300005577 Bacteria 2115
45 Ga0068854_100017220 3300005578 Bacteria 4832
46 Ga0068856_100000162 3300005614 Bacteria 69640
47 Ga0068856_100160297 3300005614 Bacteria 2260
48 Ga0068856_100193303 3300005614 Bacteria 2049
49 Ga0068856_100212772 3300005614 Bacteria 1948
50 Ga0068852_100000471 3300005616 Bacteria 26414
51 Ga0068852_100000701 3300005616 Bacteria 21899
52 Ga0068852_100007800 3300005616 Bacteria 7838
53 Ga0068852_100020260 3300005616 Bacteria 5286
54 Ga0068852_100116024 3300005616 Bacteria 2442
55 Ga0105248_10000659 3300009177 Bacteria 39245
56 Ga0105248_10142074 3300009177 Bacteria 2708
57 Ga0105238_10087177 3300009551 Bacteria 3108
58 Ga0157373_10023815 3300013100 Bacteria 4436
59 Ga0157371_10014963 3300013102 Bacteria 5836
60 Ga0157371_10017942 3300013102 Bacteria 5245
61 Ga0157371_10090362 3300013102 Bacteria 2170
62 Ga0157370_10194441 3300013104 Bacteria 1883
63 Ga0157370_10213338 3300013104 Bacteria 1789
64 Ga0157369_10001888 3300013105 Bacteria 25272
65 Ga0157369_10047858 3300013105 Bacteria 4641
66 Ga0157369_10060052 3300013105 Bacteria 4100
67 Ga0157369_10157710 3300013105 Bacteria 2397
68 Ga0157374_10055249 3300013296 Bacteria 3705
69 Ga0163162_10070789 3300013306 Bacteria 3539
70 Ga0157372_10307762 3300013307 Bacteria 1844
71 Ga0163163_10000273 3300014325 Bacteria 51622
72 Ga0207656_10063773 3300025321 Bacteria 1622
73 Ga0207680_10001920 3300025903 Bacteria 9744
74 Ga0207647_10006724 3300025904 Bacteria 8348
75 Ga0207647_10018900 3300025904 Bacteria 4645
76 Ga0207647_10133730 3300025904 Bacteria 1456
77 Ga0207705_10000062 3300025909 Bacteria 149432
78 Ga0207705_10000626 3300025909 Bacteria 29530
79 Ga0207705_10101111 3300025909 Bacteria 2120
80 Ga0207705_10108647 3300025909 Bacteria 2047
81 Ga0207705_10126784 3300025909 Bacteria 1898
82 Ga0207705_10151095 3300025909 Bacteria 1740
83 Ga0207705_10279126 3300025909 Bacteria 1279
84 Ga0207707_10263678 3300025912 Bacteria 1494
85 Ga0207695_10223641 3300025913 Bacteria 1789
86 Ga0207660_10007595 3300025917 Bacteria 7016
87 Ga0207660_10028832 3300025917 Bacteria 3802
88 Ga0207657_10000403 3300025919 Bacteria 45863
89 Ga0207657_10014430 3300025919 Bacteria 7715
90 Ga0207657_10022407 3300025919 Bacteria 5911
91 Ga0207657_10055203 3300025919 Bacteria 3433
92 Ga0207657_10114554 3300025919 Bacteria 2223
93 Ga0207649_10000230 3300025920 Bacteria 45560
94 Ga0207652_10140443 3300025921 Bacteria 2159
95 Ga0207690_10000155 3300025932 Bacteria 53735
96 Ga0207690_10010300 3300025932 Bacteria 5550
97 Ga0207706_10000342 3300025933 Bacteria 50517
98 Ga0207706_10049113 3300025933 Bacteria 3730
99 Ga0207706_10117622 3300025933 Bacteria 2338
100 Ga0207711_10016073 3300025941 Bacteria 6210
101 Ga0207661_10000947 3300025944 Bacteria 19105
102 Ga0207661_10006807 3300025944 Bacteria 8097
103 Ga0207661_10256066 3300025944 Bacteria 1557
104 Ga0207679_10000213 3300025945 Bacteria 45916
105 Ga0207679_10010396 3300025945 Bacteria 5990
106 Ga0207679_10112544 3300025945 Bacteria 2151
107 Ga0207667_10001300 3300025949 Bacteria 31316
108 Ga0207667_10037751 3300025949 Bacteria 5163
109 Ga0207667_10133470 3300025949 Bacteria 2557
110 Ga0207667_10219932 3300025949 Bacteria 1946
111 Ga0207640_10034991 3300025981 Bacteria 3140
112 Ga0207640_10046341 3300025981 Bacteria 2797
113 Ga0207658_10020523 3300025986 Bacteria 4575
114 Ga0207639_10000347 3300026041 Bacteria 32007
115 Ga0207639_10138686 3300026041 Bacteria 2023
116 Ga0207678_10002613 3300026067 Bacteria 16423
117 Ga0207678_10051676 3300026067 Bacteria 3548
118 Ga0207678_10051832 3300026067 Bacteria 3541
119 Ga0207702_10000496 3300026078 Bacteria 44248
120 Ga0207702_10067821 3300026078 Bacteria 3063
121 Ga0207676_10117210 3300026095 Bacteria 2239
122 Ga0207674_10006327 3300026116 Bacteria 13948
123 Ga0207674_10085663 3300026116 Bacteria 3145
124 Ga0207698_10000427 3300026142 Bacteria 24235
125 Ga0207698_10008963 3300026142 Bacteria 6348
126 Ga0207698_10013813 3300026142 Bacteria 5344
127 Ga0207698_10282493 3300026142 Bacteria 1536
128 Ga0207698_10377750 3300026142 Bacteria 1347
129 Ga0207698_10395145 3300026142 Bacteria 1320
130 Ga0268266_10006680 3300028379 Bacteria 10523
131 Ga0307408_100076033 3300031548 Bacteria 2496
132 Ga0307408_100145154 3300031548 Bacteria 1867
133 Ga0307405_10006343 3300031731 Bacteria 5811
134 Ga0307410_10010422 3300031852 Bacteria 5262
135 Ga0307406_10013919 3300031901 Bacteria 4619
136 Ga0307406_10023815 3300031901 Bacteria 3648
137 Ga0307407_10027629 3300031903 Bacteria 3022
138 Ga0307412_10018175 3300031911 Bacteria 4224
139 Ga0307412_10019384 3300031911 Bacteria 4118
140 Ga0307412_10037712 3300031911 Bacteria 3107
141 Ga0307409_100058942 3300031995 Bacteria 2984
142 Ga0307409_100059170 3300031995 Bacteria 2980
143 Ga0307409_100135182 3300031995 Bacteria 2114
144 Ga0307416_100024164 3300032002 Bacteria 4429
145 Ga0307416_100041163 3300032002 Bacteria 3596
146 Ga0307416_100158526 3300032002 Bacteria 2087
147 Ga0307414_10028668 3300032004 Bacteria 3614
148 Ga0307414_10331331 3300032004 Bacteria 1299
149 Ga0307411_10011888 3300032005 Bacteria 4721
150 Ga0307411_10021889 3300032005 Bacteria 3752
151 Ga0307415_100120786 3300032126 Bacteria 1964
152 Ga0373943_0012531 3300035170 Bacteria 3820
153 Ga0373931_0019747 3300035691 Bacteria 3366
154 Ga0373935_0027193 3300035692 Bacteria 3536
155 Ga0395899_0014611 3300037312 Bacteria 5992
156 Ga0395899_0031904 3300037312 Bacteria 3958
157 Ga0395899_0071030 3300037312 Bacteria 2548
158 Ga0395899_0185585 3300037312 Bacteria 1457
159 Ga0395899_0188210 3300037312 Bacteria 1445
160 Ga0395900_0014988 3300037418 Bacteria 7900
161 Ga0395900_0017391 3300037418 Bacteria 7339
162 Ga0395900_0035404 3300037418 Bacteria 5142
163 Ga0395900_0171614 3300037418 Bacteria 2207
164 Ga0395900_0179630 3300037418 Bacteria 2151
165 Ga0395900_0305679 3300037418 Bacteria 1575
166 Ga0395898_0057949 3300037466 Bacteria 3772
167 Ga0395898_0111561 3300037466 Bacteria 2621
168 Ga0395898_0148008 3300037466 Bacteria 2247
169 Ga0395898_0279124 3300037466 Bacteria 1593
170 Ga0395905_0002909 3300037471 Bacteria 18690
171 Ga0395905_0010072 3300037471 Bacteria 9214
172 Ga0395905_0013915 3300037471 Bacteria 7695
173 Ga0395905_0018597 3300037471 Bacteria 6592
174 Ga0395905_0035021 3300037471 Bacteria 4713
175 Ga0395905_0035640 3300037471 Bacteria 4672
176 Ga0395905_0043810 3300037471 Bacteria 4198
177 Ga0395905_0087526 3300037471 Bacteria 2920
178 Ga0395905_0103423 3300037471 Bacteria 2674
179 Ga0395905_0162995 3300037471 Bacteria 2095
180 Ga0395905_0361465 3300037471 Bacteria 1344
181 Ga0395901_0001740 3300038443 Bacteria 22491
182 Ga0395901_0005828 3300038443 Bacteria 12469
183 Ga0395901_0069948 3300038443 Bacteria 3656
184 Ga0395901_0089465 3300038443 Bacteria 3222
185 Ga0395901_0273832 3300038443 Bacteria 1755
186 Ga0395901_0401005 3300038443 Bacteria 1409
187 Ga0395901_0491382 3300038443 Bacteria 1250
188 Ga0395901_0571475 3300038443 Bacteria 1143
189 Ga0439432_008188 3300042006 Bacteria 3677
190 Ga0466966_0010575 3300044684 Bacteria 6133
191 Ga0466966_0041191 3300044684 Bacteria 2968
192 Ga0466961_0028238 3300044693 Bacteria 3607
193 Ga0466963_0008078 3300044694 Bacteria 6300
194 Ga0466963_0055080 3300044694 Bacteria 2644
195 Ga0466963_0066768 3300044694 Bacteria 2413
196 Ga0466963_0162745 3300044694 Bacteria 1553
197 Ga0466971_0048243 3300044719 Bacteria 1914
198 Ga0466970_0037126 3300044765 Bacteria 2582
199 Ga0466957_0005221 3300044842 Bacteria 7268
200 Ga0466957_0009764 3300044842 Bacteria 5483
201 Ga0466959_0016658 3300045049 Bacteria 5374
202 Ga0466958_0003358 3300045836 Bacteria 8297
203 Ga0466958_0016190 3300045836 Bacteria 4290
204 Ga0466967_0010821 3300045976 Bacteria 6866
205 Ga0466967_0033047 3300045976 Bacteria 4376
206 Ga0466967_0051025 3300045976 Bacteria 3624
207 Ga0466967_0134421 3300045976 Bacteria 2299
208 Ga0496114_0000131 3300048917 Bacteria 54315
209 Ga0496124_0000414 3300048927 Bacteria 76734
210 Ga0501067_0016150 3300049583 Bacteria 4128
211 Ga0501202_008549 3300049652 Bacteria 1868
212 Ga0501270_005723 3300049767 Bacteria 1458
213 Ga0501273_003055 3300049770 Bacteria 1748
214 Ga0466962_0016337 3300061719 Bacteria 3579
215 Ga0466962_0049798 3300061719 Bacteria 2002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10044113 Ga0070658_100441132 283
2 3300005539 Ga0068853_100015708 Ga0068853_1000157084 283
3 3300005616 Ga0068852_100007800 Ga0068852_1000078008 283
4 3300009551 Ga0105238_10087177 Ga0105238_100871772 283
5 3300013104 Ga0157370_10213338 Ga0157370_102133382 283
6 3300013105 Ga0157369_10001888 Ga0157369_100018882 283
7 3300026142 Ga0207698_10013813 Ga0207698_100138133 283
8 3300049652 Ga0501202_008549 Ga0501202_008549_433_1359 294
9 3300005563 Ga0068855_100218841 Ga0068855_1002188412 316
10 3300025909 Ga0207705_10126784 Ga0207705_101267842 316
11 3300025949 Ga0207667_10219932 Ga0207667_102199322 316
12 3300025981 Ga0207640_10046341 Ga0207640_100463412 316
13 3300026041 Ga0207639_10138686 Ga0207639_101386862 316
14 3300005563 Ga0068855_100138162 Ga0068855_1001381622 322
15 3300037312 Ga0395899_0014611 Ga0395899_0014611_3921_4979 322
16 3300037418 Ga0395900_0179630 Ga0395900_0179630_314_1372 322
17 3300037466 Ga0395898_0057949 Ga0395898_0057949_1075_2133 322
18 3300037471 Ga0395905_0010072 Ga0395905_0010072_5499_6557 322
19 3300045836 Ga0466958_0016190 Ga0466958_0016190_542_1591 322
20 3300045976 Ga0466967_0033047 Ga0466967_0033047_602_1651 322
21 3300005329 Ga0070683_100038760 Ga0070683_1000387602 323
22 3300005345 Ga0070692_10022727 Ga0070692_100227273 323
23 3300005366 Ga0070659_100054386 Ga0070659_1000543864 323
24 3300005563 Ga0068855_100345111 Ga0068855_1003451112 323
25 3300013102 Ga0157371_10090362 Ga0157371_100903622 323
26 3300025909 Ga0207705_10108647 Ga0207705_101086473 323
27 3300025944 Ga0207661_10256066 Ga0207661_102560662 323
28 3300037418 Ga0395900_0305679 Ga0395900_0305679_487_1458 323
29 3300038443 Ga0395901_0401005 Ga0395901_0401005_168_1139 323
30 3300002067 JGI24735J21928_10015143 JGI24735J21928_100151432 324
31 3300005327 Ga0070658_10262477 Ga0070658_102624772 324
32 3300005339 Ga0070660_100099941 Ga0070660_1000999412 324
33 3300005366 Ga0070659_100003071 Ga0070659_1000030718 324
34 3300005564 Ga0070664_100010345 Ga0070664_1000103452 324
35 3300005614 Ga0068856_100212772 Ga0068856_1002127722 324
36 3300013104 Ga0157370_10194441 Ga0157370_101944412 324
37 3300013105 Ga0157369_10157710 Ga0157369_101577102 324
38 3300013307 Ga0157372_10307762 Ga0157372_103077622 324
39 3300025321 Ga0207656_10063773 Ga0207656_100637732 324
40 3300025912 Ga0207707_10263678 Ga0207707_102636782 324
41 3300025919 Ga0207657_10022407 Ga0207657_100224073 324
42 3300025919 Ga0207657_10114554 Ga0207657_101145542 324
43 3300025921 Ga0207652_10140443 Ga0207652_101404432 324
44 3300025932 Ga0207690_10010300 Ga0207690_100103002 324
45 3300025933 Ga0207706_10117622 Ga0207706_101176223 324
46 3300025944 Ga0207661_10006807 Ga0207661_100068079 324
47 3300026116 Ga0207674_10006327 Ga0207674_100063274 324
48 3300026116 Ga0207674_10085663 Ga0207674_100856632 324
49 3300031548 Ga0307408_100076033 Ga0307408_1000760332 324
50 3300031901 Ga0307406_10023815 Ga0307406_100238152 324
51 3300031903 Ga0307407_10027629 Ga0307407_100276294 324
52 3300031911 Ga0307412_10019384 Ga0307412_100193842 324
53 3300031995 Ga0307409_100058942 Ga0307409_1000589422 324
54 3300032002 Ga0307416_100024164 Ga0307416_1000241644 324
55 3300032002 Ga0307416_100158526 Ga0307416_1001585262 324
56 3300032004 Ga0307414_10331331 Ga0307414_103313311 324
57 3300032005 Ga0307411_10021889 Ga0307411_100218891 324
58 3300032126 Ga0307415_100120786 Ga0307415_1001207862 324
59 3300037312 Ga0395899_0071030 Ga0395899_0071030_724_1806 324
60 3300037418 Ga0395900_0035404 Ga0395900_0035404_329_1414 324
61 3300037418 Ga0395900_0171614 Ga0395900_0171614_416_1498 324
62 3300037466 Ga0395898_0111561 Ga0395898_0111561_612_1694 324
63 3300037471 Ga0395905_0002909 Ga0395905_0002909_16723_17808 324
64 3300037471 Ga0395905_0035021 Ga0395905_0035021_758_1840 324
65 3300037471 Ga0395905_0043810 Ga0395905_0043810_1046_2128 324
66 3300037471 Ga0395905_0103423 Ga0395905_0103423_1421_2503 324
67 3300037471 Ga0395905_0162995 Ga0395905_0162995_736_1824 324
68 3300038443 Ga0395901_0069948 Ga0395901_0069948_1578_2660 324
69 3300038443 Ga0395901_0273832 Ga0395901_0273832_653_1735 324
70 3300042006 Ga0439432_008188 Ga0439432_008188_2062_3150 324
71 3300044684 Ga0466966_0041191 Ga0466966_0041191_1019_2155 324
72 3300045049 Ga0466959_0016658 Ga0466959_0016658_3612_4748 324
73 3300049767 Ga0501270_005723 Ga0501270_005723_48_1136 324
74 3300049770 Ga0501273_003055 Ga0501273_003055_460_1548 324
75 3300037418 Ga0395900_0017391 Ga0395900_0017391_3567_4649 325
76 3300038443 Ga0395901_0005828 Ga0395901_0005828_1487_2569 325
77 3300049583 Ga0501067_0016150 Ga0501067_0016150_645_1721 326
78 3300031548 Ga0307408_100145154 Ga0307408_1001451542 330
79 3300031731 Ga0307405_10006343 Ga0307405_100063434 330
80 3300031911 Ga0307412_10037712 Ga0307412_100377122 330
81 3300032002 Ga0307416_100041163 Ga0307416_1000411632 330
82 3300031901 Ga0307406_10013919 Ga0307406_100139194 332
83 3300005329 Ga0070683_100093835 Ga0070683_1000938352 334
84 3300005336 Ga0070680_100128885 Ga0070680_1001288853 334
85 3300005341 Ga0070691_10018095 Ga0070691_100180952 334
86 3300005535 Ga0070684_100093599 Ga0070684_1000935993 334
87 3300005539 Ga0068853_100006374 Ga0068853_1000063749 334
88 3300005577 Ga0068857_100149494 Ga0068857_1001494943 334
89 3300025904 Ga0207647_10006724 Ga0207647_100067249 334
90 3300025913 Ga0207695_10223641 Ga0207695_102236412 334
91 3300025917 Ga0207660_10007595 Ga0207660_100075953 334
92 3300025949 Ga0207667_10133470 Ga0207667_101334702 334
93 3300038443 Ga0395901_0571475 Ga0395901_0571475_45_1049 334
94 3300048917 Ga0496114_0000131 Ga0496114_0000131_2123_3130 335
95 3300037418 Ga0395900_0014988 Ga0395900_0014988_4329_5339 336
96 3300038443 Ga0395901_0001740 Ga0395901_0001740_13952_14962 336
97 3300037466 Ga0395898_0279124 Ga0395898_0279124_14_1027 337
98 3300005331 Ga0070670_100072937 Ga0070670_1000729374 339
99 3300005564 Ga0070664_100022741 Ga0070664_1000227414 339
100 3300025945 Ga0207679_10010396 Ga0207679_100103963 339
101 3300013296 Ga0157374_10055249 Ga0157374_100552492 341
102 3300005336 Ga0070680_100083531 Ga0070680_1000835312 342
103 3300005563 Ga0068855_100125780 Ga0068855_1001257802 342
104 3300005614 Ga0068856_100160297 Ga0068856_1001602972 342
105 3300005616 Ga0068852_100000701 Ga0068852_10000070115 342
106 3300013102 Ga0157371_10017942 Ga0157371_100179423 342
107 3300013105 Ga0157369_10060052 Ga0157369_100600524 342
108 3300025904 Ga0207647_10133730 Ga0207647_101337302 342
109 3300025909 Ga0207705_10101111 Ga0207705_101011113 342
110 3300025917 Ga0207660_10028832 Ga0207660_100288322 342
111 3300025949 Ga0207667_10037751 Ga0207667_100377514 342
112 3300025981 Ga0207640_10034991 Ga0207640_100349912 342
113 3300026078 Ga0207702_10067821 Ga0207702_100678213 342
114 3300037312 Ga0395899_0031904 Ga0395899_0031904_1212_2243 342
115 3300044694 Ga0466963_0066768 Ga0466963_0066768_675_1703 342
116 3300044694 Ga0466963_0162745 Ga0466963_0162745_473_1501 342
117 3300045976 Ga0466967_0134421 Ga0466967_0134421_803_1831 342
118 3300031911 Ga0307412_10018175 Ga0307412_100181755 346
119 3300048927 Ga0496124_0000414 Ga0496124_0000414_58039_59118 346
120 3300025909 Ga0207705_10000626 Ga0207705_1000062633 347
121 3300025909 Ga0207705_10279126 Ga0207705_102791262 347
122 3300025919 Ga0207657_10014430 Ga0207657_100144308 347
123 3300025945 Ga0207679_10112544 Ga0207679_101125442 347
124 3300026067 Ga0207678_10051832 Ga0207678_100518322 347
125 3300026142 Ga0207698_10282493 Ga0207698_102824932 347
126 3300035170 Ga0373943_0012531 Ga0373943_0012531_559_1635 347
127 3300005458 Ga0070681_10117268 Ga0070681_101172681 348
128 3300005616 Ga0068852_100020260 Ga0068852_1000202606 348
129 3300013105 Ga0157369_10047858 Ga0157369_100478585 348
130 3300026142 Ga0207698_10008963 Ga0207698_100089632 348
131 3300031852 Ga0307410_10010422 Ga0307410_100104222 348
132 3300031995 Ga0307409_100059170 Ga0307409_1000591703 348
133 3300031995 Ga0307409_100135182 Ga0307409_1001351822 348
134 3300032004 Ga0307414_10028668 Ga0307414_100286684 348
135 3300032005 Ga0307411_10011888 Ga0307411_100118882 348
136 3300035692 Ga0373935_0027193 Ga0373935_0027193_585_1631 348
137 3300044684 Ga0466966_0010575 Ga0466966_0010575_3006_4085 348
138 3300044693 Ga0466961_0028238 Ga0466961_0028238_2241_3320 348
139 3300044694 Ga0466963_0055080 Ga0466963_0055080_1118_2197 348
140 3300044719 Ga0466971_0048243 Ga0466971_0048243_554_1633 348
141 3300005327 Ga0070658_10171916 Ga0070658_101719162 349
142 3300005455 Ga0070663_100031782 Ga0070663_1000317822 349
143 3300005457 Ga0070662_100008338 Ga0070662_1000083382 349
144 3300005614 Ga0068856_100193303 Ga0068856_1001933032 349
145 3300005616 Ga0068852_100116024 Ga0068852_1001160242 349
146 3300009177 Ga0105248_10142074 Ga0105248_101420742 349
147 3300013306 Ga0163162_10070789 Ga0163162_100707892 349
148 3300025909 Ga0207705_10151095 Ga0207705_101510952 349
149 3300025919 Ga0207657_10055203 Ga0207657_100552034 349
150 3300025933 Ga0207706_10049113 Ga0207706_100491134 349
151 3300026067 Ga0207678_10051676 Ga0207678_100516762 349
152 3300026142 Ga0207698_10377750 Ga0207698_103777501 349
153 3300026142 Ga0207698_10395145 Ga0207698_103951451 349
154 3300037312 Ga0395899_0185585 Ga0395899_0185585_135_1217 349
155 3300037466 Ga0395898_0148008 Ga0395898_0148008_1086_2222 349
156 3300037471 Ga0395905_0013915 Ga0395905_0013915_3518_4600 349
157 3300037471 Ga0395905_0018597 Ga0395905_0018597_5293_6375 349
158 3300037471 Ga0395905_0087526 Ga0395905_0087526_348_1430 349
159 3300037471 Ga0395905_0361465 Ga0395905_0361465_224_1273 349
160 3300038443 Ga0395901_0089465 Ga0395901_0089465_121_1170 349
161 3300038443 Ga0395901_0491382 Ga0395901_0491382_68_1204 349
162 3300044765 Ga0466970_0037126 Ga0466970_0037126_884_1966 349
163 3300045976 Ga0466967_0051025 Ga0466967_0051025_1955_3007 349
164 3300061719 Ga0466962_0016337 Ga0466962_0016337_754_1836 349
165 3300001989 JGI24739J22299_10019471 JGI24739J22299_100194712 350
166 3300001990 JGI24737J22298_10000941 JGI24737J22298_100009412 350
167 3300002075 JGI24738J21930_10005989 JGI24738J21930_100059892 350
168 3300005327 Ga0070658_10000950 Ga0070658_1000095010 350
169 3300005335 Ga0070666_10002265 Ga0070666_100022659 350
170 3300005339 Ga0070660_100000260 Ga0070660_10000026020 350
171 3300005344 Ga0070661_100000246 Ga0070661_10000024628 350
172 3300005355 Ga0070671_100042788 Ga0070671_1000427882 350
173 3300005366 Ga0070659_100000195 Ga0070659_10000019535 350
174 3300005367 Ga0070667_100019749 Ga0070667_1000197493 350
175 3300005455 Ga0070663_100074230 Ga0070663_1000742302 350
176 3300005457 Ga0070662_100000047 Ga0070662_10000004735 350
177 3300005535 Ga0070684_100031142 Ga0070684_1000311423 350
178 3300005539 Ga0068853_100000033 Ga0068853_10000003386 350
179 3300005547 Ga0070693_100005511 Ga0070693_1000055114 350
180 3300005563 Ga0068855_100000531 Ga0068855_10000053135 350
181 3300005564 Ga0070664_100000242 Ga0070664_10000024240 350
182 3300005578 Ga0068854_100017220 Ga0068854_1000172202 350
183 3300005614 Ga0068856_100000162 Ga0068856_10000016234 350
184 3300005616 Ga0068852_100000471 Ga0068852_10000047117 350
185 3300009177 Ga0105248_10000659 Ga0105248_1000065910 350
186 3300013100 Ga0157373_10023815 Ga0157373_100238152 350
187 3300013102 Ga0157371_10014963 Ga0157371_100149634 350
188 3300014325 Ga0163163_10000273 Ga0163163_1000027342 350
189 3300025903 Ga0207680_10001920 Ga0207680_100019204 350
190 3300025904 Ga0207647_10018900 Ga0207647_100189002 350
191 3300025909 Ga0207705_10000062 Ga0207705_10000062131 350
192 3300025919 Ga0207657_10000403 Ga0207657_1000040315 350
193 3300025920 Ga0207649_10000230 Ga0207649_1000023029 350
194 3300025932 Ga0207690_10000155 Ga0207690_1000015546 350
195 3300025933 Ga0207706_10000342 Ga0207706_1000034219 350
196 3300025941 Ga0207711_10016073 Ga0207711_100160732 350
197 3300025944 Ga0207661_10000947 Ga0207661_100009475 350
198 3300025945 Ga0207679_10000213 Ga0207679_1000021316 350
199 3300025949 Ga0207667_10001300 Ga0207667_1000130015 350
200 3300025986 Ga0207658_10020523 Ga0207658_100205232 350
201 3300026041 Ga0207639_10000347 Ga0207639_1000034725 350
202 3300026067 Ga0207678_10002613 Ga0207678_100026132 350
203 3300026078 Ga0207702_10000496 Ga0207702_1000049635 350
204 3300026095 Ga0207676_10117210 Ga0207676_101172101 350
205 3300026142 Ga0207698_10000427 Ga0207698_1000042717 350
206 3300028379 Ga0268266_10006680 Ga0268266_100066802 350
207 3300035691 Ga0373931_0019747 Ga0373931_0019747_628_1680 350
208 3300037312 Ga0395899_0188210 Ga0395899_0188210_45_1100 350
209 3300037471 Ga0395905_0035640 Ga0395905_0035640_2576_3667 350
210 3300044694 Ga0466963_0008078 Ga0466963_0008078_3710_4849 350
211 3300044842 Ga0466957_0005221 Ga0466957_0005221_2012_3151 350
212 3300044842 Ga0466957_0009764 Ga0466957_0009764_113_1165 350
213 3300045836 Ga0466958_0003358 Ga0466958_0003358_4576_5715 350
214 3300045976 Ga0466967_0010821 Ga0466967_0010821_2508_3647 350
215 3300061719 Ga0466962_0049798 Ga0466962_0049798_636_1775 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21102

DprA_N

DprA-like N-terminal HHH domain

1

45

0.98

PF02481

DNA_processg_A

DNA recombination-mediator protein A

169

228

0.97

PF02481

DNA_processg_A

DNA recombination-mediator protein A

46

175

0.96

PF17782

DprA_WH

DprA winged helix domain

250

309

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w1e-assembly1.cif.gz_A pobr in complex with phb 0.9237 306 349
4ljk-assembly1.cif.gz_H structural insights into the unique single-stranded dna binding mode of dna processing protein a from helicobacter pylori 0.9113 62 266
7bzh-assembly1.cif.gz_A solution structure of a dna binding protein from sulfolobus islandicus 0.8817 293 350
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8788 296 349
2heo-assembly1.cif.gz_D general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.8713 294 348
ID Description Score Start End Superfamily
3majA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9823 296 347 1.10.10.10
af_Q2FZ33_2_246_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9269 43 267 3.40.50.450
af_P37671_22_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9107 291 348 1.10.10.10
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9013 294 349 1.10.10.10
3g3zB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8925 307 348 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K1BZ86-F1-model_v4 DNA-protecting protein DprA 0.9822 114 272 GO:0009294
AF-B4YID1-F1-model_v4 DNA protecting protein 0.982 96 243 GO:0009294
AF-A0A6I3HCI9-F1-model_v4 deleted 0.9804 84 268
AF-A0A417AS90-F1-model_v4 deleted 0.9793 101 234
AF-A0A496UMQ8-F1-model_v4 DNA-protecting protein DprA 0.9788 63 220 GO:0009294

Feature Viewer

pLDDT pTM Quality
84.96 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map