F326209

General Info

Members Datasets Scaffolds Average Seq Length
215 150 430 230

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100569503|Ga0068853_1005695031
Length 242
Sequence MMSSRAPLRMLVVDDEPAIRRFLRTSLAAQGHQVIEVEDGEPALEAMRRSPADVVILDLGLPGLDGFEVIRRLREKGSTVPIIVLSSRTDERGKVEALDLGADDYLTKPFGVDELHARVRAALRHRLQQQGERPVFRSGDLTVDLVRRLVLVRGEELRLSPREYDILRLLVAHAGKVLTHRFILREVWGGDTDVQYLRVYIRSLRQKIEADAERPRHILTETGVGYRLRAPDWDAATAQSSG

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
148 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
149 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
150 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 3.72
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100569503 3300005539 Bacteria 1074
2 JGI25153J46596_10044378 3300003215 Bacteria 1337
3 rootH1_10400978 3300003323 Bacteria 1752
4 Ga0070660_100046475 3300005339 Bacteria 3327
5 Ga0070671_100069639 3300005355 Bacteria 2934
6 Ga0070673_100117664 3300005364 Bacteria 2212
7 Ga0070659_100265928 3300005366 Bacteria 1424
8 Ga0070709_10021295 3300005434 Bacteria 3775
9 Ga0070714_100027521 3300005435 Bacteria 4709
10 Ga0070713_100048778 3300005436 Bacteria 3489
11 Ga0070711_100442370 3300005439 Bacteria 1063
12 Ga0070711_100624059 3300005439 Unclassified 901
13 Ga0070663_100027375 3300005455 Bacteria 3871
14 Ga0070681_10002344 3300005458 Bacteria 17303
15 Ga0070681_10160625 3300005458 Bacteria 2171
16 Ga0070681_10473704 3300005458 Bacteria 1165
17 Ga0070706_100075800 3300005467 Bacteria 3113
18 Ga0070699_100476036 3300005518 Bacteria 1133
19 Ga0070684_100640358 3300005535 Bacteria 989
20 Ga0068853_100007104 3300005539 Bacteria 8961
21 Ga0070686_100510906 3300005544 Bacteria 934
22 Ga0070695_100016231 3300005545 Bacteria 4506
23 Ga0068855_100560920 3300005563 Bacteria 1235
24 Ga0070664_100131586 3300005564 Bacteria 2198
25 Ga0068857_100004561 3300005577 Bacteria 11720
26 Ga0068854_100202512 3300005578 Bacteria 1561
27 Ga0068856_100000638 3300005614 Bacteria 38107
28 Ga0068856_100330515 3300005614 Bacteria 1542
29 Ga0068852_100480246 3300005616 Bacteria 1235
30 Ga0068864_100018713 3300005618 Bacteria 5789
31 Ga0068858_100650985 3300005842 Unclassified 1024
32 Ga0081455_10001945 3300005937 Bacteria 24827
33 Ga0081539_10010976 3300005985 Bacteria 7257
34 Ga0070716_100297732 3300006173 Bacteria 1121
35 Ga0070712_100000071 3300006175 Bacteria 52255
36 Ga0075362_10025392 3300006177 Bacteria 2522
37 Ga0075367_10185149 3300006178 Bacteria 1299
38 Ga0075369_10013101 3300006186 Bacteria 3284
39 Ga0075428_100749252 3300006844 Bacteria 1039
40 Ga0075434_100139883 3300006871 Bacteria 2440
41 Ga0075436_100006902 3300006914 Bacteria 7769
42 Ga0075435_100100463 3300007076 Bacteria 2396
43 Ga0105240_10010379 3300009093 Bacteria 13100
44 Ga0105241_10016907 3300009174 Bacteria 5354
45 Ga0105248_10434560 3300009177 Bacteria 1478
46 Ga0105237_10019728 3300009545 Bacteria 6961
47 Ga0105238_10004952 3300009551 Bacteria 13172
48 Ga0105238_10008947 3300009551 Bacteria 10021
49 Ga0105239_10151980 3300010375 Bacteria 2584
50 Ga0157373_10004003 3300013100 Bacteria 11113
51 Ga0157373_10350027 3300013100 Bacteria 1054
52 Ga0157370_10006061 3300013104 Bacteria 13416
53 Ga0157369_10205512 3300013105 Bacteria 2066
54 Ga0163162_10135819 3300013306 Bacteria 2570
55 Ga0157372_10045391 3300013307 Bacteria 4874
56 Ga0157372_10084096 3300013307 Bacteria 3605
57 Ga0157375_10040019 3300013308 Bacteria 4515
58 Ga0157379_10570625 3300014968 Bacteria 1054
59 Ga0213876_10000262 3300021384 Bacteria 48652
60 Ga0213875_10000407 3300021388 Bacteria 37829
61 Ga0213875_10001441 3300021388 Bacteria 15424
62 Ga0213875_10026385 3300021388 Bacteria 2763
63 Ga0213875_10031756 3300021388 Bacteria 2497
64 Ga0213871_10009996 3300021441 Bacteria 2141
65 Ga0207699_10006203 3300025906 Bacteria 5767
66 Ga0207684_10125460 3300025910 Bacteria 2203
67 Ga0207707_10009120 3300025912 Bacteria 8618
68 Ga0207707_10265422 3300025912 Bacteria 1489
69 Ga0207671_10043257 3300025914 Bacteria 3331
70 Ga0207693_10002831 3300025915 Bacteria 15023
71 Ga0207663_10230042 3300025916 Bacteria 1354
72 Ga0207657_10043073 3300025919 Bacteria 3979
73 Ga0207694_10034893 3300025924 Bacteria 3858
74 Ga0207694_10120339 3300025924 Bacteria 2096
75 Ga0207664_10011518 3300025929 Bacteria 6292
76 Ga0207665_10102909 3300025939 Bacteria 1997
77 Ga0207711_10222066 3300025941 Bacteria 1728
78 Ga0207711_10654551 3300025941 Bacteria 980
79 Ga0207679_10580792 3300025945 Bacteria 1008
80 Ga0207667_10073986 3300025949 Bacteria 3539
81 Ga0207667_10190938 3300025949 Bacteria 2102
82 Ga0207651_10168170 3300025960 Bacteria 1726
83 Ga0207703_10462580 3300026035 Bacteria 1187
84 Ga0207703_10519640 3300026035 Bacteria 1120
85 Ga0207639_10285877 3300026041 Bacteria 1452
86 Ga0207639_10498217 3300026041 Bacteria 1112
87 Ga0207678_10317031 3300026067 Bacteria 1341
88 Ga0207702_10004361 3300026078 Bacteria 12611
89 Ga0207648_10970532 3300026089 Bacteria 795
90 Ga0207676_10014852 3300026095 Bacteria 5610
91 Ga0207674_10005735 3300026116 Bacteria 14726
92 Ga0207698_10115659 3300026142 Bacteria 2259
93 Ga0265337_1024923 3300028556 Bacteria 1824
94 Ga0265318_10055128 3300028577 Bacteria 1489
95 Ga0265338_10010191 3300028800 Bacteria 11077
96 Ga0265338_10045965 3300028800 Bacteria 4007
97 Ga0265338_10071659 3300028800 Bacteria 2963
98 Ga0265330_10039385 3300031235 Bacteria 2099
99 Ga0265330_10135459 3300031235 Bacteria 1048
100 Ga0265332_10106244 3300031238 Bacteria 1184
101 Ga0265325_10000257 3300031241 Bacteria 37878
102 Ga0265325_10118067 3300031241 Bacteria 1282
103 Ga0265325_10275078 3300031241 Bacteria 756
104 Ga0265340_10000223 3300031247 Bacteria 28904
105 Ga0265339_10003491 3300031249 Bacteria 10992
106 Ga0265339_10058568 3300031249 Bacteria 2079
107 Ga0265331_10041885 3300031250 Bacteria 2223
108 Ga0265327_10001144 3300031251 Bacteria 36241
109 Ga0265316_10006488 3300031344 Bacteria 11167
110 Ga0265316_10184588 3300031344 Bacteria 1552
111 Ga0265313_10000253 3300031595 Bacteria 58381
112 Ga0265313_10012602 3300031595 Bacteria 5145
113 Ga0265314_10027247 3300031711 Bacteria 4281
114 Ga0265342_10010318 3300031712 Bacteria 6494
115 Ga0265342_10078447 3300031712 Bacteria 1911
116 Ga0265342_10165095 3300031712 Bacteria 1222
117 Ga0307414_10321254 3300032004 Bacteria 1318
118 Ga0307510_10151768 3300033180 Bacteria 1934
119 Ga0373936_0000446 3300035113 Bacteria 13812
120 Ga0373937_0036990 3300036401 Bacteria 4448
121 Ga0373937_0576387 3300036401 Bacteria 1069
122 Ga0436364_0488350 3300037853 Bacteria 37791
123 Ga0436364_0972483 3300037853 Bacteria 30030
124 Ga0436364_1023153 3300037853 Bacteria 6714
125 Ga0436364_1129314 3300037853 Bacteria 3431
126 Ga0436364_1274359 3300037853 Bacteria 9417
127 Ga0436365_0001640 3300039437 Bacteria 1254
128 Ga0436365_1120687 3300039437 Bacteria 61803
129 Ga0436365_1354493 3300039437 Bacteria 4627
130 Ga0436365_1481462 3300039437 Bacteria 2066
131 Ga0436360_0606156 3300039438 Bacteria 6947
132 Ga0436360_0822467 3300039438 Bacteria 4288
133 Ga0436363_0482966 3300039450 Bacteria 3836
134 Ga0436363_0788207 3300039450 Bacteria 980
135 Ga0436363_1531622 3300039450 Bacteria 17727
136 Ga0436363_1555364 3300039450 Bacteria 2757
137 Ga0453684_0446086 3300044712 Bacteria 1441
138 Ga0453684_0705093 3300044712 Bacteria 1096
139 Ga0451576_0008723 3300045051 Bacteria 11863
140 Ga0451576_0388422 3300045051 Bacteria 1463
141 Ga0466967_0577660 3300045976 Bacteria 1108
142 Ga0466967_0816761 3300045976 Bacteria 926
143 Ga0495664_0066190 3300046477 Bacteria 2155
144 Ga0495645_0134554 3300046543 Bacteria 1730
145 Ga0495668_0284614 3300046616 Bacteria 906
146 Ga0495599_0074000 3300046678 Bacteria 2127
147 Ga0495669_0000399 3300046684 Bacteria 21294
148 Ga0495669_0177443 3300046684 Bacteria 1015
149 Ga0495677_0058639 3300047445 Bacteria 1424
150 Ga0496102_0109772 3300048905 Bacteria 2571
151 Ga0496104_0315368 3300048907 Bacteria 1477
152 Ga0496108_0680114 3300048911 Bacteria 893
153 Ga0496110_0381844 3300048913 Bacteria 1284
154 Ga0496110_0454078 3300048913 Bacteria 1168
155 Ga0496112_0501364 3300048915 Bacteria 1149
156 Ga0496112_0634619 3300048915 Bacteria 999
157 Ga0496113_0177439 3300048916 Bacteria 1688
158 Ga0501031_0012439 3300049568 Bacteria 5552
159 Ga0501032_0010543 3300049569 Bacteria 6664
160 Ga0501033_0003130 3300049570 Bacteria 13749
161 Ga0501033_0012002 3300049570 Bacteria 6617
162 Ga0501033_0564519 3300049570 Bacteria 783
163 Ga0501034_0121544 3300049571 Bacteria 2598
164 Ga0501037_0001481 3300049573 Bacteria 17182
165 Ga0501038_0057212 3300049574 Bacteria 3348
166 Ga0501038_0235194 3300049574 Bacteria 1456
167 Ga0501043_0000005 3300049579 Bacteria 254466
168 Ga0501043_0235006 3300049579 Bacteria 1415
169 Ga0501043_0460067 3300049579 Bacteria 955
170 Ga0501046_0183785 3300049580 Bacteria 1562
171 Ga0501047_0012851 3300049581 Bacteria 7933
172 Ga0501047_0141746 3300049581 Bacteria 2282
173 Ga0501047_0263817 3300049581 Bacteria 1569
174 Ga0501047_0285925 3300049581 Bacteria 1493
175 Ga0501047_0376059 3300049581 Bacteria 1255
176 Ga0501069_0000011 3300049585 Bacteria 153214
177 Ga0501070_0001424 3300049586 Bacteria 21419
178 Ga0501070_0014425 3300049586 Bacteria 6649
179 Ga0501070_0358519 3300049586 Bacteria 1183
180 Ga0501071_0015683 3300049587 Bacteria 5203
181 Ga0501072_0020878 3300049588 Bacteria 5076
182 Ga0501073_0005681 3300049589 Bacteria 9331
183 Ga0501074_0000336 3300049590 Bacteria 27389
184 Ga0501074_0073857 3300049590 Bacteria 2449
185 Ga0501079_0105642 3300049741 Bacteria 2185
186 Ga0501080_0001369 3300049742 Bacteria 20402
187 Ga0501080_0036344 3300049742 Bacteria 4598
188 Ga0501080_0070957 3300049742 Bacteria 3239
189 Ga0501083_0000805 3300049744 Bacteria 20562
190 Ga0501035_0000107 3300049822 Bacteria 103130
191 Ga0501035_0001347 3300049822 Bacteria 25303
192 Ga0501035_0029411 3300049822 Bacteria 5010
193 Ga0501035_0819443 3300049822 Bacteria 742
194 Ga0501044_0000154 3300049823 Bacteria 85407
195 Ga0501044_0005778 3300049823 Bacteria 13696
196 Ga0501044_0006090 3300049823 Bacteria 13308
197 Ga0501044_0217887 3300049823 Bacteria 1860
198 nmdc:mga03683_957_c1 3300050489 Bacteria 5872
199 nmdc:mga07m45_366657_c1 3300050496 Bacteria 837
200 nmdc:mga0n895_537855_c1 3300050512 Bacteria 1175
201 nmdc:mga0rr50_355166_c1 3300050513 Bacteria 1233
202 nmdc:mga08x19_3284_c1 3300050514 Bacteria 9669
203 nmdc:mga0sz30_241_c1 3300050516 Bacteria 20970
204 Ga0495619_0089406 3300053085 Bacteria 2084
205 Ga0500641_0045073 3300053096 Bacteria 1795
206 Ga0500562_005149 3300053108 Bacteria 3286
207 Ga0500573_0243995 3300053140 Bacteria 930
208 Ga0500637_0009748 3300053178 Bacteria 4902
209 Ga0500625_034486 3300053729 Bacteria 2399
210 Ga0501084_0027650 3300054114 Bacteria 4740
211 Ga0501082_0015310 3300060353 Bacteria 6603
212 2644002235 2643221598 Bacteria 4578346
213 2644085596 2643221614 Bacteria 4260023
214 2644343147 2643221661 Bacteria 4267604
215 2644366447 2643221666 Bacteria 4265935
216 Ga0068853_100569503
217 JGI25153J46596_10044378
218 rootH1_10400978
219 Ga0070660_100046475
220 Ga0070671_100069639
221 Ga0070673_100117664
222 Ga0070659_100265928
223 Ga0070709_10021295
224 Ga0070714_100027521
225 Ga0070713_100048778
226 Ga0070711_100442370
227 Ga0070711_100624059
228 Ga0070663_100027375
229 Ga0070681_10002344
230 Ga0070681_10160625
231 Ga0070681_10473704
232 Ga0070706_100075800
233 Ga0070699_100476036
234 Ga0070684_100640358
235 Ga0068853_100007104
236 Ga0070686_100510906
237 Ga0070695_100016231
238 Ga0068855_100560920
239 Ga0070664_100131586
240 Ga0068857_100004561
241 Ga0068854_100202512
242 Ga0068856_100000638
243 Ga0068856_100330515
244 Ga0068852_100480246
245 Ga0068864_100018713
246 Ga0068858_100650985
247 Ga0081455_10001945
248 Ga0081539_10010976
249 Ga0070716_100297732
250 Ga0070712_100000071
251 Ga0075362_10025392
252 Ga0075367_10185149
253 Ga0075369_10013101
254 Ga0075428_100749252
255 Ga0075434_100139883
256 Ga0075436_100006902
257 Ga0075435_100100463
258 Ga0105240_10010379
259 Ga0105241_10016907
260 Ga0105248_10434560
261 Ga0105237_10019728
262 Ga0105238_10004952
263 Ga0105238_10008947
264 Ga0105239_10151980
265 Ga0157373_10004003
266 Ga0157373_10350027
267 Ga0157370_10006061
268 Ga0157369_10205512
269 Ga0163162_10135819
270 Ga0157372_10045391
271 Ga0157372_10084096
272 Ga0157375_10040019
273 Ga0157379_10570625
274 Ga0213876_10000262
275 Ga0213875_10000407
276 Ga0213875_10001441
277 Ga0213875_10026385
278 Ga0213875_10031756
279 Ga0213871_10009996
280 Ga0207699_10006203
281 Ga0207684_10125460
282 Ga0207707_10009120
283 Ga0207707_10265422
284 Ga0207671_10043257
285 Ga0207693_10002831
286 Ga0207663_10230042
287 Ga0207657_10043073
288 Ga0207694_10034893
289 Ga0207694_10120339
290 Ga0207664_10011518
291 Ga0207665_10102909
292 Ga0207711_10222066
293 Ga0207711_10654551
294 Ga0207679_10580792
295 Ga0207667_10073986
296 Ga0207667_10190938
297 Ga0207651_10168170
298 Ga0207703_10462580
299 Ga0207703_10519640
300 Ga0207639_10285877
301 Ga0207639_10498217
302 Ga0207678_10317031
303 Ga0207702_10004361
304 Ga0207648_10970532
305 Ga0207676_10014852
306 Ga0207674_10005735
307 Ga0207698_10115659
308 Ga0265337_1024923
309 Ga0265318_10055128
310 Ga0265338_10010191
311 Ga0265338_10045965
312 Ga0265338_10071659
313 Ga0265330_10039385
314 Ga0265330_10135459
315 Ga0265332_10106244
316 Ga0265325_10000257
317 Ga0265325_10118067
318 Ga0265325_10275078
319 Ga0265340_10000223
320 Ga0265339_10003491
321 Ga0265339_10058568
322 Ga0265331_10041885
323 Ga0265327_10001144
324 Ga0265316_10006488
325 Ga0265316_10184588
326 Ga0265313_10000253
327 Ga0265313_10012602
328 Ga0265314_10027247
329 Ga0265342_10010318
330 Ga0265342_10078447
331 Ga0265342_10165095
332 Ga0307414_10321254
333 Ga0307510_10151768
334 Ga0373936_0000446
335 Ga0373937_0036990
336 Ga0373937_0576387
337 Ga0436364_0488350
338 Ga0436364_0972483
339 Ga0436364_1023153
340 Ga0436364_1129314
341 Ga0436364_1274359
342 Ga0436365_0001640
343 Ga0436365_1120687
344 Ga0436365_1354493
345 Ga0436365_1481462
346 Ga0436360_0606156
347 Ga0436360_0822467
348 Ga0436363_0482966
349 Ga0436363_0788207
350 Ga0436363_1531622
351 Ga0436363_1555364
352 Ga0453684_0446086
353 Ga0453684_0705093
354 Ga0451576_0008723
355 Ga0451576_0388422
356 Ga0466967_0577660
357 Ga0466967_0816761
358 Ga0495664_0066190
359 Ga0495645_0134554
360 Ga0495668_0284614
361 Ga0495599_0074000
362 Ga0495669_0000399
363 Ga0495669_0177443
364 Ga0495677_0058639
365 Ga0496102_0109772
366 Ga0496104_0315368
367 Ga0496108_0680114
368 Ga0496110_0381844
369 Ga0496110_0454078
370 Ga0496112_0501364
371 Ga0496112_0634619
372 Ga0496113_0177439
373 Ga0501031_0012439
374 Ga0501032_0010543
375 Ga0501033_0003130
376 Ga0501033_0012002
377 Ga0501033_0564519
378 Ga0501034_0121544
379 Ga0501037_0001481
380 Ga0501038_0057212
381 Ga0501038_0235194
382 Ga0501043_0000005
383 Ga0501043_0235006
384 Ga0501043_0460067
385 Ga0501046_0183785
386 Ga0501047_0012851
387 Ga0501047_0141746
388 Ga0501047_0263817
389 Ga0501047_0285925
390 Ga0501047_0376059
391 Ga0501069_0000011
392 Ga0501070_0001424
393 Ga0501070_0014425
394 Ga0501070_0358519
395 Ga0501071_0015683
396 Ga0501072_0020878
397 Ga0501073_0005681
398 Ga0501074_0000336
399 Ga0501074_0073857
400 Ga0501079_0105642
401 Ga0501080_0001369
402 Ga0501080_0036344
403 Ga0501080_0070957
404 Ga0501083_0000805
405 Ga0501035_0000107
406 Ga0501035_0001347
407 Ga0501035_0029411
408 Ga0501035_0819443
409 Ga0501044_0000154
410 Ga0501044_0005778
411 Ga0501044_0006090
412 Ga0501044_0217887
413 nmdc:mga03683_957_c1
414 nmdc:mga07m45_366657_c1
415 nmdc:mga0n895_537855_c1
416 nmdc:mga0rr50_355166_c1
417 nmdc:mga08x19_3284_c1
418 nmdc:mga0sz30_241_c1
419 Ga0495619_0089406
420 Ga0500641_0045073
421 Ga0500562_005149
422 Ga0500573_0243995
423 Ga0500637_0009748
424 Ga0500625_034486
425 Ga0501084_0027650
426 Ga0501082_0015310
427 2644002235
428 2644085596
429 2644343147
430 2644366447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

10

120

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

154

228

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9734 6 123
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9725 6 121
3dzd-assembly1.cif.gz_B crystal structure of sigma54 activator ntrc4 in the inactive state 0.97 7 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9687 6 123
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9687 6 123
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9888 7 81 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9824 6 81 3.40.50.2300
af_P9WGN1_116_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9783 130 228 1.10.10.10
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9748 7 88 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9723 7 88 3.40.50.2300
ID Description Score Start End GO Terms
AF-C1CYA5-F1-model_v4 Putative response regulator, CheY, Guanylate cyclase, GGDEF domain with PAS/PAC sensor and Response Regulator Receiver modulation 0.9626 4 126 GO:0000160
AF-A0A2D7EBU1-F1-model_v4 deleted 0.9255 1 128
AF-A0A7J0CSU7-F1-model_v4 Response regulatory domain-containing protein 0.9119 5 136 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1V1PUA3-F1-model_v4 DNA-binding response regulator KdpE 0.9079 2 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A651FK24-F1-model_v4 DNA-binding response regulator 0.8966 1 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map