F326172

General Info

Members Datasets Scaffolds Average Seq Length
215 149 430 248

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100036088|Ga0068867_1000360882
Length 278
Sequence MVTTVRPALPWRNPVAWRLRPGVIPTYHDVVTGTLVILRHGESTWNQLNLFTGWHDVPLNDKGRAEGAAAGKTMADAGLRFDVAHTSVLNRAVVTCNLALEVMDQVWLPVQRHWRLNERHYGALQGLDKKETSERHGAEQTKLWRRSFDVPPPPVDVDSPEHPINDPRYRLLPPDVLPATECLKDVVARVLPYWHDVIAPQLLAGWNVLITAHGNSLRALVMHLENVSADDIAELNIPTGAPRRYEFDDRLQVASAEYLGDADAIAAAAAKVAAQATG

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
101 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 6.98
Rhizosphere 80.93
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100036088 3300005459 Bacteria 3586
2 JGI26128J50194_1000676 3300003347 Bacteria 1978
3 Ga0070683_100402436 3300005329 Bacteria 1305
4 Ga0070670_100634012 3300005331 Bacteria 958
5 Ga0070666_10000991 3300005335 Bacteria 17371
6 Ga0068868_100000090 3300005338 Bacteria 55967
7 Ga0070660_100010057 3300005339 Bacteria 6674
8 Ga0070689_100041069 3300005340 Bacteria 3549
9 Ga0070687_100061901 3300005343 Bacteria 1979
10 Ga0070675_100015865 3300005354 Bacteria 5965
11 Ga0070671_100017471 3300005355 Bacteria 5811
12 Ga0070673_100038537 3300005364 Bacteria 3651
13 Ga0070688_100022770 3300005365 Bacteria 3677
14 Ga0070688_100189993 3300005365 Bacteria 1430
15 Ga0070688_100376834 3300005365 Bacteria 1045
16 Ga0070659_100000017 3300005366 Bacteria 163966
17 Ga0070667_100014355 3300005367 Bacteria 6545
18 Ga0070678_100189537 3300005456 Bacteria 1690
19 Ga0068867_100293223 3300005459 Bacteria 1338
20 Ga0070672_100096506 3300005543 Bacteria 2392
21 Ga0070686_100000423 3300005544 Bacteria 26584
22 Ga0070686_100066068 3300005544 Bacteria 2351
23 Ga0070686_100083128 3300005544 Bacteria 2125
24 Ga0070665_100000207 3300005548 Bacteria 102416
25 Ga0070665_100043908 3300005548 Bacteria 4490
26 Ga0070665_100184169 3300005548 Bacteria 2089
27 Ga0068855_100127405 3300005563 Bacteria 2910
28 Ga0070664_100110806 3300005564 Bacteria 2395
29 Ga0070664_100259674 3300005564 Bacteria 1563
30 Ga0068852_100242857 3300005616 Bacteria 1722
31 Ga0068852_100323798 3300005616 Bacteria 1498
32 Ga0068859_100063447 3300005617 Bacteria 3725
33 Ga0068859_100633470 3300005617 Bacteria 1162
34 Ga0068864_100020147 3300005618 Bacteria 5579
35 Ga0068866_10017137 3300005718 Bacteria 3253
36 Ga0068861_100223565 3300005719 Bacteria 1592
37 Ga0068863_100013978 3300005841 Bacteria 7737
38 Ga0068863_100155847 3300005841 Bacteria 2187
39 Ga0068858_100022552 3300005842 Bacteria 5874
40 Ga0068860_100299474 3300005843 Bacteria 1575
41 Ga0075365_10005117 3300006038 Bacteria 7040
42 Ga0075365_10182366 3300006038 Bacteria 1468
43 Ga0075368_10096271 3300006042 Bacteria 1213
44 Ga0075364_10002997 3300006051 Bacteria 9541
45 Ga0075364_10010089 3300006051 Bacteria 5695
46 Ga0075364_10332282 3300006051 Bacteria 1035
47 Ga0070712_100403028 3300006175 Bacteria 1130
48 Ga0075367_10061136 3300006178 Bacteria 2247
49 Ga0075367_10109272 3300006178 Bacteria 1696
50 Ga0075369_10035115 3300006186 Bacteria 2130
51 Ga0097621_100089740 3300006237 Bacteria 2570
52 Ga0075370_10315514 3300006353 Bacteria 931
53 Ga0068871_100007491 3300006358 Bacteria 7808
54 Ga0068871_100281539 3300006358 Bacteria 1455
55 Ga0075428_100803386 3300006844 Bacteria 1000
56 Ga0075430_100012169 3300006846 Bacteria 7326
57 Ga0068865_100037578 3300006881 Bacteria 3270
58 Ga0097620_100063449 3300006931 Bacteria 3725
59 Ga0097620_100633476 3300006931 Bacteria 1162
60 Ga0105240_10000920 3300009093 Bacteria 52419
61 Ga0105240_10032978 3300009093 Bacteria 6696
62 Ga0111539_10000972 3300009094 Bacteria 37616
63 Ga0111539_10236050 3300009094 Bacteria 2129
64 Ga0111539_10382946 3300009094 Bacteria 1638
65 Ga0105245_10004685 3300009098 Bacteria 12090
66 Ga0105245_10014262 3300009098 Bacteria 6924
67 Ga0105245_10073453 3300009098 Bacteria 3110
68 Ga0105245_10251278 3300009098 Bacteria 1718
69 Ga0105247_10002245 3300009101 Bacteria 13296
70 Ga0105241_10670982 3300009174 Bacteria 943
71 Ga0105242_10004265 3300009176 Bacteria 11146
72 Ga0105242_10130256 3300009176 Bacteria 2170
73 Ga0105248_10124972 3300009177 Bacteria 2902
74 Ga0105248_10396646 3300009177 Bacteria 1554
75 Ga0105238_10039843 3300009551 Bacteria 4762
76 Ga0105239_10038624 3300010375 Bacteria 5232
77 Ga0157374_10004728 3300013296 Bacteria 11422
78 Ga0157378_10062744 3300013297 Bacteria 3319
79 Ga0163162_10007094 3300013306 Bacteria 10874
80 Ga0163162_10050230 3300013306 Bacteria 4182
81 Ga0157372_10541572 3300013307 Bacteria 1357
82 Ga0157375_10010446 3300013308 Bacteria 8168
83 Ga0157375_10027389 3300013308 Bacteria 5326
84 Ga0157375_10256707 3300013308 Bacteria 1909
85 Ga0163163_10009679 3300014325 Bacteria 8622
86 Ga0157380_10001559 3300014326 Bacteria 15075
87 Ga0157376_10193125 3300014969 Bacteria 1868
88 Ga0163161_10198812 3300017792 Bacteria 1544
89 Ga0213876_10003358 3300021384 Bacteria 9163
90 Ga0207645_10038447 3300025907 Bacteria 3069
91 Ga0207645_10039472 3300025907 Bacteria 3025
92 Ga0207654_10119395 3300025911 Bacteria 1653
93 Ga0207695_10000785 3300025913 Bacteria 59941
94 Ga0207657_10018170 3300025919 Bacteria 6726
95 Ga0207694_10386254 3300025924 Bacteria 1163
96 Ga0207659_10017853 3300025926 Bacteria 4643
97 Ga0207687_10009052 3300025927 Bacteria 6510
98 Ga0207687_10014972 3300025927 Bacteria 5080
99 Ga0207687_10223469 3300025927 Bacteria 1484
100 Ga0207690_10000035 3300025932 Bacteria 149201
101 Ga0207706_10063443 3300025933 Bacteria 3253
102 Ga0207686_10119184 3300025934 Bacteria 1793
103 Ga0207709_10073829 3300025935 Bacteria 2175
104 Ga0207670_10151063 3300025936 Bacteria 1723
105 Ga0207691_10134514 3300025940 Bacteria 2182
106 Ga0207691_10561059 3300025940 Bacteria 968
107 Ga0207711_10017756 3300025941 Bacteria 5910
108 Ga0207679_10007944 3300025945 Bacteria 6747
109 Ga0207712_10038226 3300025961 Bacteria 3281
110 Ga0207712_10109113 3300025961 Bacteria 2072
111 Ga0207677_10000224 3300026023 Bacteria 44846
112 Ga0207677_10065963 3300026023 Bacteria 2528
113 Ga0207708_10020998 3300026075 Bacteria 4927
114 Ga0207702_10201136 3300026078 Bacteria 1847
115 Ga0207641_10021292 3300026088 Bacteria 5330
116 Ga0207641_10222905 3300026088 Bacteria 1749
117 Ga0207648_10001017 3300026089 Bacteria 31573
118 Ga0207676_10009588 3300026095 Bacteria 6892
119 Ga0207676_10267822 3300026095 Bacteria 1546
120 Ga0207675_100022511 3300026118 Bacteria 5867
121 Ga0207675_100033449 3300026118 Bacteria 4789
122 Ga0207698_10082672 3300026142 Bacteria 2597
123 Ga0207698_10322159 3300026142 Bacteria 1448
124 Ga0207698_10844779 3300026142 Bacteria 920
125 Ga0209968_1000327 3300027526 Bacteria 7968
126 Ga0209966_1000008 3300027695 Bacteria 88938
127 Ga0207428_10004663 3300027907 Bacteria 12985
128 Ga0268266_10000171 3300028379 Bacteria 118317
129 Ga0268266_10053832 3300028379 Bacteria 3458
130 Ga0268264_10012063 3300028381 Bacteria 7115
131 Ga0268264_10178228 3300028381 Bacteria 1928
132 Ga0268264_10297020 3300028381 Bacteria 1519
133 Ga0307517_10181615 3300028786 Bacteria 1357
134 Ga0307513_10265120 3300031456 Bacteria 1505
135 Ga0316575_10000428 3300031665 Bacteria 11990
136 Ga0316575_10001334 3300031665 Bacteria 7899
137 Ga0316575_10005979 3300031665 Bacteria 4356
138 Ga0316575_10118511 3300031665 Bacteria 1082
139 Ga0316579_10000298 3300031691 Bacteria 15289
140 Ga0316579_10031629 3300031691 Bacteria 2424
141 Ga0316576_10004364 3300031727 Bacteria 8471
142 Ga0316576_10040659 3300031727 Bacteria 3343
143 Ga0316576_10190935 3300031727 Bacteria 1544
144 Ga0316578_10002982 3300031728 Bacteria 7620
145 Ga0316578_10016715 3300031728 Bacteria 3977
146 Ga0316577_10000762 3300031733 Bacteria 13828
147 Ga0316583_10004381 3300032133 Bacteria 5037
148 Ga0316585_10000015 3300032137 Bacteria 25122
149 Ga0316580_10000037 3300032139 Bacteria 21041
150 Ga0316588_1015783 3300033528 Unclassified 1667
151 Ga0316574_0000010 3300035398 Bacteria 45795
152 Ga0316574_0158243 3300035398 Bacteria 1459
153 Ga0373927_0001612 3300035695 Bacteria 16932
154 Ga0316582_0000009 3300036647 Bacteria 44099
155 Ga0316582_0046450 3300036647 Bacteria 2738
156 Ga0316584_0000467 3300036712 Bacteria 21121
157 Ga0316584_0011309 3300036712 Bacteria 6267
158 Ga0316584_0298575 3300036712 Bacteria 1167
159 Ga0373925_0004303 3300037068 Bacteria 10785
160 Ga0400483_020541 3300039062 Bacteria 6486
161 Ga0400483_254871 3300039062 Bacteria 6404
162 Ga0436365_0478409 3300039437 Bacteria 9475
163 Ga0451807_0981686 3300041486 Bacteria 1428
164 Ga0439443_012096 3300042003 Bacteria 1273
165 Ga0451577_0002191 3300042876 Bacteria 23809
166 Ga0466965_0068812 3300044683 Bacteria 1778
167 Ga0453684_0053572 3300044712 Bacteria 5265
168 Ga0451576_0142625 3300045051 Bacteria 2498
169 Ga0496101_0030501 3300048904 Bacteria 3781
170 Ga0496104_0023030 3300048907 Bacteria 5724
171 Ga0496104_0235805 3300048907 Bacteria 1741
172 Ga0496106_0032982 3300048909 Bacteria 3862
173 Ga0496107_0099946 3300048910 Bacteria 2126
174 Ga0496108_0029073 3300048911 Bacteria 4575
175 Ga0496109_0266496 3300048912 Bacteria 1614
176 Ga0496109_0346121 3300048912 Bacteria 1404
177 Ga0496110_0209373 3300048913 Bacteria 1772
178 Ga0496111_0012921 3300048914 Bacteria 5667
179 Ga0496112_0013684 3300048915 Bacteria 7498
180 Ga0496113_0032090 3300048916 Bacteria 3815
181 Ga0496114_0007066 3300048917 Bacteria 8858
182 Ga0496114_0289324 3300048917 Bacteria 1445
183 Ga0501034_0066626 3300049571 Bacteria 3614
184 Ga0501034_0140038 3300049571 Bacteria 2399
185 Ga0501038_0049908 3300049574 Bacteria 3617
186 Ga0501040_0040532 3300049576 Bacteria 3169
187 Ga0501041_0056254 3300049577 Bacteria 2403
188 Ga0501041_0058453 3300049577 Bacteria 2359
189 Ga0501069_0004483 3300049585 Bacteria 7214
190 Ga0501071_0055553 3300049587 Bacteria 2858
191 Ga0501071_0262782 3300049587 Bacteria 1304
192 Ga0501072_0025918 3300049588 Bacteria 4568
193 Ga0501072_0084965 3300049588 Bacteria 2510
194 Ga0501074_0020509 3300049590 Bacteria 4803
195 Ga0501075_0102570 3300049591 Bacteria 2173
196 Ga0501076_0009268 3300049592 Bacteria 7263
197 Ga0501076_0165463 3300049592 Bacteria 1803
198 Ga0501079_0033947 3300049741 Bacteria 3925
199 Ga0501080_0548062 3300049742 Bacteria 1030
200 Ga0501045_0084813 3300049824 Bacteria 2337
201 nmdc:mga03683_95410_c1 3300050489 Bacteria 1302
202 nmdc:mga00v17_17143_c1 3300050491 Bacteria 4093
203 nmdc:mga00v17_39609_c1 3300050491 Bacteria 2823
204 nmdc:mga06z11_54796_c1 3300050494 Bacteria 2057
205 nmdc:mga08y16_2036_c1 3300050511 Bacteria 20716
206 nmdc:mga0sz30_24627_c1 3300050516 Bacteria 2457
207 Ga0500641_0013095 3300053096 Bacteria 3044
208 Ga0500568_0001128 3300053139 Bacteria 17949
209 Ga0500604_0000055 3300053151 Bacteria 41071
210 Ga0500616_0000137 3300053153 Bacteria 124573
211 Ga0500616_0000658 3300053153 Bacteria 41388
212 Ga0501084_0002029 3300054114 Bacteria 16166
213 Ga0501082_0005768 3300060353 Bacteria 10745
214 Ga0501082_0122505 3300060353 Bacteria 2255
215 Ga0501082_0702247 3300060353 Bacteria 885
216 Ga0068867_100036088
217 JGI26128J50194_1000676
218 Ga0070683_100402436
219 Ga0070670_100634012
220 Ga0070666_10000991
221 Ga0068868_100000090
222 Ga0070660_100010057
223 Ga0070689_100041069
224 Ga0070687_100061901
225 Ga0070675_100015865
226 Ga0070671_100017471
227 Ga0070673_100038537
228 Ga0070688_100022770
229 Ga0070688_100189993
230 Ga0070688_100376834
231 Ga0070659_100000017
232 Ga0070667_100014355
233 Ga0070678_100189537
234 Ga0068867_100293223
235 Ga0070672_100096506
236 Ga0070686_100000423
237 Ga0070686_100066068
238 Ga0070686_100083128
239 Ga0070665_100000207
240 Ga0070665_100043908
241 Ga0070665_100184169
242 Ga0068855_100127405
243 Ga0070664_100110806
244 Ga0070664_100259674
245 Ga0068852_100242857
246 Ga0068852_100323798
247 Ga0068859_100063447
248 Ga0068859_100633470
249 Ga0068864_100020147
250 Ga0068866_10017137
251 Ga0068861_100223565
252 Ga0068863_100013978
253 Ga0068863_100155847
254 Ga0068858_100022552
255 Ga0068860_100299474
256 Ga0075365_10005117
257 Ga0075365_10182366
258 Ga0075368_10096271
259 Ga0075364_10002997
260 Ga0075364_10010089
261 Ga0075364_10332282
262 Ga0070712_100403028
263 Ga0075367_10061136
264 Ga0075367_10109272
265 Ga0075369_10035115
266 Ga0097621_100089740
267 Ga0075370_10315514
268 Ga0068871_100007491
269 Ga0068871_100281539
270 Ga0075428_100803386
271 Ga0075430_100012169
272 Ga0068865_100037578
273 Ga0097620_100063449
274 Ga0097620_100633476
275 Ga0105240_10000920
276 Ga0105240_10032978
277 Ga0111539_10000972
278 Ga0111539_10236050
279 Ga0111539_10382946
280 Ga0105245_10004685
281 Ga0105245_10014262
282 Ga0105245_10073453
283 Ga0105245_10251278
284 Ga0105247_10002245
285 Ga0105241_10670982
286 Ga0105242_10004265
287 Ga0105242_10130256
288 Ga0105248_10124972
289 Ga0105248_10396646
290 Ga0105238_10039843
291 Ga0105239_10038624
292 Ga0157374_10004728
293 Ga0157378_10062744
294 Ga0163162_10007094
295 Ga0163162_10050230
296 Ga0157372_10541572
297 Ga0157375_10010446
298 Ga0157375_10027389
299 Ga0157375_10256707
300 Ga0163163_10009679
301 Ga0157380_10001559
302 Ga0157376_10193125
303 Ga0163161_10198812
304 Ga0213876_10003358
305 Ga0207645_10038447
306 Ga0207645_10039472
307 Ga0207654_10119395
308 Ga0207695_10000785
309 Ga0207657_10018170
310 Ga0207694_10386254
311 Ga0207659_10017853
312 Ga0207687_10009052
313 Ga0207687_10014972
314 Ga0207687_10223469
315 Ga0207690_10000035
316 Ga0207706_10063443
317 Ga0207686_10119184
318 Ga0207709_10073829
319 Ga0207670_10151063
320 Ga0207691_10134514
321 Ga0207691_10561059
322 Ga0207711_10017756
323 Ga0207679_10007944
324 Ga0207712_10038226
325 Ga0207712_10109113
326 Ga0207677_10000224
327 Ga0207677_10065963
328 Ga0207708_10020998
329 Ga0207702_10201136
330 Ga0207641_10021292
331 Ga0207641_10222905
332 Ga0207648_10001017
333 Ga0207676_10009588
334 Ga0207676_10267822
335 Ga0207675_100022511
336 Ga0207675_100033449
337 Ga0207698_10082672
338 Ga0207698_10322159
339 Ga0207698_10844779
340 Ga0209968_1000327
341 Ga0209966_1000008
342 Ga0207428_10004663
343 Ga0268266_10000171
344 Ga0268266_10053832
345 Ga0268264_10012063
346 Ga0268264_10178228
347 Ga0268264_10297020
348 Ga0307517_10181615
349 Ga0307513_10265120
350 Ga0316575_10000428
351 Ga0316575_10001334
352 Ga0316575_10005979
353 Ga0316575_10118511
354 Ga0316579_10000298
355 Ga0316579_10031629
356 Ga0316576_10004364
357 Ga0316576_10040659
358 Ga0316576_10190935
359 Ga0316578_10002982
360 Ga0316578_10016715
361 Ga0316577_10000762
362 Ga0316583_10004381
363 Ga0316585_10000015
364 Ga0316580_10000037
365 Ga0316588_1015783
366 Ga0316574_0000010
367 Ga0316574_0158243
368 Ga0373927_0001612
369 Ga0316582_0000009
370 Ga0316582_0046450
371 Ga0316584_0000467
372 Ga0316584_0011309
373 Ga0316584_0298575
374 Ga0373925_0004303
375 Ga0400483_020541
376 Ga0400483_254871
377 Ga0436365_0478409
378 Ga0451807_0981686
379 Ga0439443_012096
380 Ga0451577_0002191
381 Ga0466965_0068812
382 Ga0453684_0053572
383 Ga0451576_0142625
384 Ga0496101_0030501
385 Ga0496104_0023030
386 Ga0496104_0235805
387 Ga0496106_0032982
388 Ga0496107_0099946
389 Ga0496108_0029073
390 Ga0496109_0266496
391 Ga0496109_0346121
392 Ga0496110_0209373
393 Ga0496111_0012921
394 Ga0496112_0013684
395 Ga0496113_0032090
396 Ga0496114_0007066
397 Ga0496114_0289324
398 Ga0501034_0066626
399 Ga0501034_0140038
400 Ga0501038_0049908
401 Ga0501040_0040532
402 Ga0501041_0056254
403 Ga0501041_0058453
404 Ga0501069_0004483
405 Ga0501071_0055553
406 Ga0501071_0262782
407 Ga0501072_0025918
408 Ga0501072_0084965
409 Ga0501074_0020509
410 Ga0501075_0102570
411 Ga0501076_0009268
412 Ga0501076_0165463
413 Ga0501079_0033947
414 Ga0501080_0548062
415 Ga0501045_0084813
416 nmdc:mga03683_95410_c1
417 nmdc:mga00v17_17143_c1
418 nmdc:mga00v17_39609_c1
419 nmdc:mga06z11_54796_c1
420 nmdc:mga08y16_2036_c1
421 nmdc:mga0sz30_24627_c1
422 Ga0500641_0013095
423 Ga0500568_0001128
424 Ga0500604_0000055
425 Ga0500616_0000137
426 Ga0500616_0000658
427 Ga0501084_0002029
428 Ga0501082_0005768
429 Ga0501082_0122505
430 Ga0501082_0702247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

35

165

0.94

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

158

256

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdz-assembly1.cif.gz_B crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid 0.989 6 233
1e58-assembly1.cif.gz_A-2 e.coli cofactor-dependent phosphoglycerate mutase 0.9875 4 233
3gp5-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate 0.9855 6 235
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.9854 6 234
1e59-assembly1.cif.gz_A-2 e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate 0.9836 6 233
ID Description Score Start End Superfamily
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9865 8 233 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9769 8 233 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.958 5 235 3.40.50.1240
af_Q8T8W6_17_267_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9557 4 235 3.40.50.1240
af_Q59VM6_2_260_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.951 5 233 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A496KN39-F1-model_v4 deleted 0.9942 11 95
AF-A0A7R9WT59-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9939 11 99 GO:0006096
GO:0016868
AF-A0A4Q6DXN7-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9929 6 230 GO:0006094
GO:0006096
GO:0046538
AF-L1NJ62-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) 0.9912 2 232 GO:0006094
GO:0006096
GO:0046538
AF-A0A2W6PP78-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.991 11 101 GO:0006094
GO:0006096
GO:0046538

Map