F326156

General Info

Members Datasets Scaffolds Average Seq Length
215 137 430 256

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100005307|Ga0070708_1000053078
Length 269
Sequence VRREPSVMAETSEHVRRNRAVWDDWARKYAAHGERSWAREMPRWGVWGVPESEVGILPDDLAGKDAIELGCGTGYVSAWLARRGAHVVGIDNSAAQLATARRLQRRHGLEFPLVHGNAETVPCPDASFDFAISEYGACLWADPERWVPEAARLLRPGGRLVFLVNSFLLTLCVPAENGVAATDRLLRPAFGMYRVEWPEDPGVEFHLSHGDWIRLLRRSGFDIEDLLEIRPPADATTEYPYVTLEWARQWPGEEVWKARKAMVPSDPLR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 20.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100005307 3300005445 Bacteria 10213
2 Ga0065715_10029571 3300005293 Bacteria 1291
3 Ga0065707_10141428 3300005295 Bacteria 1767
4 Ga0070676_10239984 3300005328 Unclassified 1205
5 Ga0068869_100083987 3300005334 Unclassified 2383
6 Ga0070668_100207947 3300005347 Unclassified 1609
7 Ga0070668_100764349 3300005347 Archaea 856
8 Ga0070669_100024804 3300005353 Bacteria 4303
9 Ga0070671_100271023 3300005355 Bacteria 1443
10 Ga0070674_100011210 3300005356 Bacteria 5448
11 Ga0070688_100119101 3300005365 Unclassified 1766
12 Ga0070667_100098998 3300005367 Bacteria 2517
13 Ga0070703_10054253 3300005406 Bacteria 1291
14 Ga0070714_100225912 3300005435 Unclassified 1723
15 Ga0070701_10135220 3300005438 Bacteria 1404
16 Ga0070705_100000087 3300005440 Bacteria 51657
17 Ga0070694_100002924 3300005444 Bacteria 10153
18 Ga0070694_100004261 3300005444 Bacteria 8607
19 Ga0070694_100114016 3300005444 Bacteria 1929
20 Ga0070694_100132905 3300005444 Bacteria 1800
21 Ga0070708_100032356 3300005445 Bacteria 4536
22 Ga0070708_100407736 3300005445 Unclassified 1282
23 Ga0070678_100446671 3300005456 Bacteria 1132
24 Ga0068867_100063955 3300005459 Unclassified 2735
25 Ga0070706_100148238 3300005467 Bacteria 2190
26 Ga0070706_100263616 3300005467 Bacteria 1608
27 Ga0070707_100164289 3300005468 Bacteria 2163
28 Ga0070698_100005282 3300005471 Bacteria 14133
29 Ga0070698_100116669 3300005471 Bacteria 2632
30 Ga0070698_100201385 3300005471 Bacteria 1926
31 Ga0070699_100059679 3300005518 Unclassified 3304
32 Ga0070699_100102285 3300005518 Bacteria 2512
33 Ga0070697_100115289 3300005536 Unclassified 2243
34 Ga0070695_100000080 3300005545 Bacteria 39880
35 Ga0070696_100006676 3300005546 Bacteria 7708
36 Ga0070696_100009124 3300005546 Bacteria 6642
37 Ga0070696_100174973 3300005546 Unclassified 1589
38 Ga0070665_100010011 3300005548 Bacteria 9590
39 Ga0070704_100020554 3300005549 Bacteria 4260
40 Ga0070704_100029635 3300005549 Bacteria 3657
41 Ga0070704_100184234 3300005549 Bacteria 1673
42 Ga0070702_100021216 3300005615 Bacteria 3415
43 Ga0070702_100103902 3300005615 Bacteria 1748
44 Ga0068859_100037939 3300005617 Bacteria 4835
45 Ga0068859_100235137 3300005617 Bacteria 1921
46 Ga0068864_100001267 3300005618 Bacteria 20977
47 Ga0068866_10051775 3300005718 Bacteria 2092
48 Ga0068861_100154218 3300005719 Bacteria 1888
49 Ga0068870_10098223 3300005840 Bacteria 1649
50 Ga0068863_100002524 3300005841 Bacteria 18167
51 Ga0068863_100028297 3300005841 Bacteria 5351
52 Ga0068858_100004402 3300005842 Bacteria 13818
53 Ga0068858_100253812 3300005842 Bacteria 1671
54 Ga0068860_100059878 3300005843 Bacteria 3619
55 Ga0068860_100448568 3300005843 Bacteria 1282
56 Ga0068862_100097741 3300005844 Bacteria 2564
57 Ga0068862_100114478 3300005844 Bacteria 2371
58 Ga0081455_10007479 3300005937 Bacteria 11503
59 Ga0081538_10007338 3300005981 Bacteria 9548
60 Ga0081538_10030680 3300005981 Bacteria 3644
61 Ga0097621_100062277 3300006237 Bacteria 3063
62 Ga0068871_100133954 3300006358 Unclassified 2103
63 Ga0075428_100036172 3300006844 Bacteria 5440
64 Ga0075428_100046610 3300006844 Bacteria 4761
65 Ga0075428_100419557 3300006844 Bacteria 1434
66 Ga0075428_100570926 3300006844 Bacteria 1209
67 Ga0075430_100532837 3300006846 Unclassified 969
68 Ga0075431_100097711 3300006847 Bacteria 3032
69 Ga0075434_100554089 3300006871 Bacteria 1169
70 Ga0075429_100244233 3300006880 Unclassified 1572
71 Ga0097620_100037938 3300006931 Bacteria 4835
72 Ga0097620_100235124 3300006931 Bacteria 1921
73 Ga0075435_100116709 3300007076 Bacteria 2224
74 Ga0111539_10000340 3300009094 Bacteria 57536
75 Ga0111539_10008759 3300009094 Bacteria 12831
76 Ga0111539_10028804 3300009094 Bacteria 6773
77 Ga0111539_10460764 3300009094 Bacteria 1480
78 Ga0111539_10485930 3300009094 Bacteria 1438
79 Ga0105245_10674746 3300009098 Unclassified 1065
80 Ga0114129_10026803 3300009147 Bacteria 8161
81 Ga0114129_10899816 3300009147 Bacteria 1121
82 Ga0105243_10011178 3300009148 Bacteria 6790
83 Ga0105243_10086237 3300009148 Bacteria 2575
84 Ga0105243_10254192 3300009148 Bacteria 1570
85 Ga0105243_10799791 3300009148 Bacteria 929
86 Ga0105241_10055417 3300009174 Bacteria 3037
87 Ga0105242_10093097 3300009176 Unclassified 2540
88 Ga0105242_10203577 3300009176 Bacteria 1759
89 Ga0105242_10259024 3300009176 Bacteria 1570
90 Ga0105242_10453594 3300009176 Bacteria 1209
91 Ga0105248_10020124 3300009177 Bacteria 7394
92 Ga0105248_10537970 3300009177 Bacteria 1318
93 Ga0105249_10052926 3300009553 Bacteria 3709
94 Ga0105249_10079761 3300009553 Unclassified 3039
95 Ga0105249_10117748 3300009553 Unclassified 2520
96 Ga0105249_10790590 3300009553 Unclassified 1012
97 Ga0105239_10707128 3300010375 Unclassified 1152
98 Ga0157378_10348760 3300013297 Unclassified 1445
99 Ga0157378_10576032 3300013297 Unclassified 1134
100 Ga0163162_10050966 3300013306 Bacteria 4152
101 Ga0163162_10186403 3300013306 Unclassified 2202
102 Ga0163162_10371423 3300013306 Unclassified 1563
103 Ga0157375_10231421 3300013308 Bacteria 2007
104 Ga0157375_10582564 3300013308 Bacteria 1279
105 Ga0163163_10028456 3300014325 Bacteria 5367
106 Ga0163163_10034862 3300014325 Bacteria 4878
107 Ga0157380_10093737 3300014326 Unclassified 2484
108 Ga0157379_10067023 3300014968 Bacteria 3209
109 Ga0157379_10127296 3300014968 Bacteria 2292
110 Ga0157379_10192362 3300014968 Bacteria 1844
111 Ga0163161_10229499 3300017792 Bacteria 1440
112 Ga0213872_10021793 3300021361 Unclassified 2951
113 Ga0213876_10004774 3300021384 Bacteria 7528
114 Ga0213876_10145692 3300021384 Unclassified 1259
115 Ga0207653_10069684 3300025885 Bacteria 1200
116 Ga0207642_10009914 3300025899 Bacteria 3334
117 Ga0207680_10109365 3300025903 Bacteria 1790
118 Ga0207684_10067626 3300025910 Bacteria 3036
119 Ga0207654_10019727 3300025911 Bacteria 3564
120 Ga0207681_10058458 3300025923 Bacteria 2640
121 Ga0207681_10095629 3300025923 Unclassified 2131
122 Ga0207650_10001018 3300025925 Bacteria 21036
123 Ga0207664_10323674 3300025929 Unclassified 1361
124 Ga0207644_10088368 3300025931 Bacteria 2305
125 Ga0207706_10018755 3300025933 Bacteria 6223
126 Ga0207706_10200008 3300025933 Bacteria 1752
127 Ga0207709_10007170 3300025935 Bacteria 6221
128 Ga0207709_10053701 3300025935 Bacteria 2481
129 Ga0207709_10112348 3300025935 Bacteria 1824
130 Ga0207669_10032225 3300025937 Unclassified 2941
131 Ga0207669_10320149 3300025937 Unclassified 1187
132 Ga0207691_10195129 3300025940 Bacteria 1764
133 Ga0207711_10040488 3300025941 Bacteria 3965
134 Ga0207711_10257330 3300025941 Bacteria 1604
135 Ga0207689_10089133 3300025942 Bacteria 2534
136 Ga0207679_10494317 3300025945 Unclassified 1091
137 Ga0207712_10072887 3300025961 Bacteria 2475
138 Ga0207712_10259239 3300025961 Bacteria 1409
139 Ga0207712_10437407 3300025961 Bacteria 1107
140 Ga0207668_10040799 3300025972 Bacteria 3134
141 Ga0207658_10281940 3300025986 Bacteria 1425
142 Ga0207703_10003357 3300026035 Bacteria 13443
143 Ga0207703_10061933 3300026035 Bacteria 3065
144 Ga0207678_10534774 3300026067 Bacteria 1024
145 Ga0207641_10016498 3300026088 Bacteria 6048
146 Ga0207676_10003632 3300026095 Bacteria 10915
147 Ga0207676_10125991 3300026095 Bacteria 2169
148 Ga0207675_100041318 3300026118 Bacteria 4307
149 Ga0207675_100192369 3300026118 Bacteria 1957
150 Ga0207675_100345786 3300026118 Bacteria 1456
151 Ga0207428_10027009 3300027907 Bacteria 4783
152 Ga0268266_10007691 3300028379 Bacteria 9677
153 Ga0268265_10230048 3300028380 Bacteria 1629
154 Ga0268265_10253554 3300028380 Bacteria 1560
155 Ga0268264_10075585 3300028381 Bacteria 2864
156 Ga0265334_10029153 3300028573 Bacteria 2213
157 Ga0265332_10000371 3300031238 Bacteria 33199
158 Ga0265328_10026730 3300031239 Bacteria 2168
159 Ga0265320_10058022 3300031240 Bacteria 1854
160 Ga0265329_10049317 3300031242 Bacteria 1342
161 Ga0265331_10000566 3300031250 Bacteria 33228
162 Ga0265316_10000274 3300031344 Bacteria 58023
163 Ga0265314_10001013 3300031711 Bacteria 32862
164 Ga0265342_10015354 3300031712 Bacteria 5040
165 Ga0373927_0122153 3300035695 Unclassified 1700
166 Ga0373947_0069516 3300035725 Bacteria 2155
167 Ga0436364_0410849 3300037853 Bacteria 2337
168 Ga0436364_1328597 3300037853 Bacteria 802
169 Ga0436365_0522318 3300039437 Bacteria 7943
170 Ga0436365_0897621 3300039437 Bacteria 12597
171 Ga0436361_0126250 3300039447 Bacteria 3096
172 Ga0436361_0897750 3300039447 Bacteria 3639
173 Ga0436361_1036231 3300039447 Bacteria 1438
174 Ga0436361_1048505 3300039447 Bacteria 2951
175 Ga0436361_1141716 3300039447 Bacteria 1276
176 Ga0436361_1157401 3300039447 Bacteria 1955
177 Ga0436361_1158012 3300039447 Bacteria 7102
178 Ga0436362_0831535 3300039453 Unclassified 1674
179 Ga0453683_0045756 3300044673 Unclassified 2744
180 Ga0451576_0152994 3300045051 Bacteria 2406
181 Ga0451576_0752361 3300045051 Bacteria 1024
182 Ga0495639_0129492 3300046475 Bacteria 1207
183 Ga0495594_0049512 3300046499 Bacteria 2309
184 Ga0495656_0128165 3300046615 Bacteria 1205
185 Ga0495659_0055416 3300046664 Bacteria 1453
186 Ga0495588_0156736 3300046674 Unclassified 1204
187 Ga0495647_0052141 3300046681 Unclassified 1592
188 Ga0495669_0050971 3300046684 Bacteria 1857
189 Ga0495581_0144652 3300047315 Unclassified 1387
190 Ga0496114_0029331 3300048917 Bacteria 4521
191 Ga0501039_0352835 3300049575 Bacteria 1156
192 Ga0501040_0307835 3300049576 Bacteria 1133
193 Ga0501046_0309743 3300049580 Unclassified 1152
194 Ga0501076_0124937 3300049592 Bacteria 2085
195 Ga0501079_0234030 3300049741 Unclassified 1435
196 Ga0501080_0457478 3300049742 Unclassified 1144
197 Ga0501081_0167740 3300049743 Bacteria 1584
198 nmdc:mga05p37_20758_c1 3300050507 Bacteria 7949
199 nmdc:mga09592_10226_c1 3300050508 Bacteria 7635
200 nmdc:mga0qj67_175420_c1 3300050509 Bacteria 1740
201 nmdc:mga06r32_122389_c1 3300050510 Bacteria 2567
202 nmdc:mga06r32_924570_c1 3300050510 Unclassified 828
203 nmdc:mga08y16_1259_c1 3300050511 Bacteria 25154
204 nmdc:mga08y16_312517_c1 3300050511 Bacteria 1618
205 nmdc:mga08y16_519514_c1 3300050511 Bacteria 1208
206 nmdc:mga08y16_529253_c1 3300050511 Unclassified 1195
207 nmdc:mga08y16_5561_c1 3300050511 Bacteria 13196
208 nmdc:mga0n895_310482_c1 3300050512 Bacteria 1598
209 nmdc:mga0n895_48435_c1 3300050512 Bacteria 4160
210 nmdc:mga0n895_49793_c1 3300050512 Bacteria 4106
211 nmdc:mga0rr50_159747_c1 3300050513 Bacteria 1828
212 nmdc:mga0rr50_190225_c1 3300050513 Bacteria 1681
213 nmdc:mga0a205_116159_c1 3300050515 Unclassified 2574
214 Ga0501084_0109039 3300054114 Unclassified 2326
215 Ga0530510_0157431 3300061734 Bacteria 1679
216 Ga0070708_100005307
217 Ga0065715_10029571
218 Ga0065707_10141428
219 Ga0070676_10239984
220 Ga0068869_100083987
221 Ga0070668_100207947
222 Ga0070668_100764349
223 Ga0070669_100024804
224 Ga0070671_100271023
225 Ga0070674_100011210
226 Ga0070688_100119101
227 Ga0070667_100098998
228 Ga0070703_10054253
229 Ga0070714_100225912
230 Ga0070701_10135220
231 Ga0070705_100000087
232 Ga0070694_100002924
233 Ga0070694_100004261
234 Ga0070694_100114016
235 Ga0070694_100132905
236 Ga0070708_100032356
237 Ga0070708_100407736
238 Ga0070678_100446671
239 Ga0068867_100063955
240 Ga0070706_100148238
241 Ga0070706_100263616
242 Ga0070707_100164289
243 Ga0070698_100005282
244 Ga0070698_100116669
245 Ga0070698_100201385
246 Ga0070699_100059679
247 Ga0070699_100102285
248 Ga0070697_100115289
249 Ga0070695_100000080
250 Ga0070696_100006676
251 Ga0070696_100009124
252 Ga0070696_100174973
253 Ga0070665_100010011
254 Ga0070704_100020554
255 Ga0070704_100029635
256 Ga0070704_100184234
257 Ga0070702_100021216
258 Ga0070702_100103902
259 Ga0068859_100037939
260 Ga0068859_100235137
261 Ga0068864_100001267
262 Ga0068866_10051775
263 Ga0068861_100154218
264 Ga0068870_10098223
265 Ga0068863_100002524
266 Ga0068863_100028297
267 Ga0068858_100004402
268 Ga0068858_100253812
269 Ga0068860_100059878
270 Ga0068860_100448568
271 Ga0068862_100097741
272 Ga0068862_100114478
273 Ga0081455_10007479
274 Ga0081538_10007338
275 Ga0081538_10030680
276 Ga0097621_100062277
277 Ga0068871_100133954
278 Ga0075428_100036172
279 Ga0075428_100046610
280 Ga0075428_100419557
281 Ga0075428_100570926
282 Ga0075430_100532837
283 Ga0075431_100097711
284 Ga0075434_100554089
285 Ga0075429_100244233
286 Ga0097620_100037938
287 Ga0097620_100235124
288 Ga0075435_100116709
289 Ga0111539_10000340
290 Ga0111539_10008759
291 Ga0111539_10028804
292 Ga0111539_10460764
293 Ga0111539_10485930
294 Ga0105245_10674746
295 Ga0114129_10026803
296 Ga0114129_10899816
297 Ga0105243_10011178
298 Ga0105243_10086237
299 Ga0105243_10254192
300 Ga0105243_10799791
301 Ga0105241_10055417
302 Ga0105242_10093097
303 Ga0105242_10203577
304 Ga0105242_10259024
305 Ga0105242_10453594
306 Ga0105248_10020124
307 Ga0105248_10537970
308 Ga0105249_10052926
309 Ga0105249_10079761
310 Ga0105249_10117748
311 Ga0105249_10790590
312 Ga0105239_10707128
313 Ga0157378_10348760
314 Ga0157378_10576032
315 Ga0163162_10050966
316 Ga0163162_10186403
317 Ga0163162_10371423
318 Ga0157375_10231421
319 Ga0157375_10582564
320 Ga0163163_10028456
321 Ga0163163_10034862
322 Ga0157380_10093737
323 Ga0157379_10067023
324 Ga0157379_10127296
325 Ga0157379_10192362
326 Ga0163161_10229499
327 Ga0213872_10021793
328 Ga0213876_10004774
329 Ga0213876_10145692
330 Ga0207653_10069684
331 Ga0207642_10009914
332 Ga0207680_10109365
333 Ga0207684_10067626
334 Ga0207654_10019727
335 Ga0207681_10058458
336 Ga0207681_10095629
337 Ga0207650_10001018
338 Ga0207664_10323674
339 Ga0207644_10088368
340 Ga0207706_10018755
341 Ga0207706_10200008
342 Ga0207709_10007170
343 Ga0207709_10053701
344 Ga0207709_10112348
345 Ga0207669_10032225
346 Ga0207669_10320149
347 Ga0207691_10195129
348 Ga0207711_10040488
349 Ga0207711_10257330
350 Ga0207689_10089133
351 Ga0207679_10494317
352 Ga0207712_10072887
353 Ga0207712_10259239
354 Ga0207712_10437407
355 Ga0207668_10040799
356 Ga0207658_10281940
357 Ga0207703_10003357
358 Ga0207703_10061933
359 Ga0207678_10534774
360 Ga0207641_10016498
361 Ga0207676_10003632
362 Ga0207676_10125991
363 Ga0207675_100041318
364 Ga0207675_100192369
365 Ga0207675_100345786
366 Ga0207428_10027009
367 Ga0268266_10007691
368 Ga0268265_10230048
369 Ga0268265_10253554
370 Ga0268264_10075585
371 Ga0265334_10029153
372 Ga0265332_10000371
373 Ga0265328_10026730
374 Ga0265320_10058022
375 Ga0265329_10049317
376 Ga0265331_10000566
377 Ga0265316_10000274
378 Ga0265314_10001013
379 Ga0265342_10015354
380 Ga0373927_0122153
381 Ga0373947_0069516
382 Ga0436364_0410849
383 Ga0436364_1328597
384 Ga0436365_0522318
385 Ga0436365_0897621
386 Ga0436361_0126250
387 Ga0436361_0897750
388 Ga0436361_1036231
389 Ga0436361_1048505
390 Ga0436361_1141716
391 Ga0436361_1157401
392 Ga0436361_1158012
393 Ga0436362_0831535
394 Ga0453683_0045756
395 Ga0451576_0152994
396 Ga0451576_0752361
397 Ga0495639_0129492
398 Ga0495594_0049512
399 Ga0495656_0128165
400 Ga0495659_0055416
401 Ga0495588_0156736
402 Ga0495647_0052141
403 Ga0495669_0050971
404 Ga0495581_0144652
405 Ga0496114_0029331
406 Ga0501039_0352835
407 Ga0501040_0307835
408 Ga0501046_0309743
409 Ga0501076_0124937
410 Ga0501079_0234030
411 Ga0501080_0457478
412 Ga0501081_0167740
413 nmdc:mga05p37_20758_c1
414 nmdc:mga09592_10226_c1
415 nmdc:mga0qj67_175420_c1
416 nmdc:mga06r32_122389_c1
417 nmdc:mga06r32_924570_c1
418 nmdc:mga08y16_1259_c1
419 nmdc:mga08y16_312517_c1
420 nmdc:mga08y16_519514_c1
421 nmdc:mga08y16_529253_c1
422 nmdc:mga08y16_5561_c1
423 nmdc:mga0n895_310482_c1
424 nmdc:mga0n895_48435_c1
425 nmdc:mga0n895_49793_c1
426 nmdc:mga0rr50_159747_c1
427 nmdc:mga0rr50_190225_c1
428 nmdc:mga0a205_116159_c1
429 Ga0501084_0109039
430 Ga0530510_0157431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

67

162

0.98

PF08242

Methyltransf_12

Methyltransferase domain

67

160

0.95

PF13847

Methyltransf_31

Methyltransferase domain

60

172

0.95

PF13649

Methyltransf_25

Methyltransferase domain

66

158

0.93

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

52

174

0.89

PF05175

MTS

Methyltransferase small domain

54

173

0.86

PF13489

Methyltransf_23

Methyltransferase domain

29

226

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbq-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-homocysteine 0.8363 56 254
2zbr-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine 0.8347 56 254
7wm5-assembly1.cif.gz_A-2 crystal structure of apo trmm from mycoplasma capricolum 0.8283 57 256
3cjq-assembly2.cif.gz_D ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.824 57 254
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.822 56 254
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9224 54 113 3.40.50.150
af_Q54PP5_28_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8937 51 156 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.886 56 156 3.40.50.150
af_I1L8V0_149_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8536 115 256 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8534 57 154 3.40.50.150
ID Description Score Start End GO Terms
AF-I0H5Q0-F1-model_v4 Putative methyltransferase 0.9609 7 203 GO:0008757
GO:0032259
AF-A0A3D3Q6P4-F1-model_v4 Methyltransferase type 11 0.9319 117 255 GO:0008757
GO:0032259
AF-A0A559UNQ9-F1-model_v4 deleted 0.9236 1 254
AF-A0A3D3Q6P4-F1-model_v4 Methyltransferase type 11 0.9127 117 255 GO:0008757
GO:0032259
AF-A0A662QZT2-F1-model_v4 RNA methyltransferase 0.9077 56 127 GO:0003723
GO:0005737
GO:0016423
GO:0030488

Map