F325798

General Info

Members Datasets Scaffolds Average Seq Length
214 158 212 270

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_011544|Ga0500586_011544_251_1150
Length 299
Sequence MDAKLQRRIQRYGWDLAARDYEALWLNPLAPAQTRLLQCAALRPGEHVLDVASGTGLVAFTAAEHVGPSGRVLGVDLSGEMVAQARSHADAAVHANVTFERMDAEALSLPDASFDAVLCALGLMYVPEPEQALREMRRVLKPGGRVVLAVWGPRDRCGWADAFSIVDAEVQGDVCPLFFRLGLSQALARLCTDAGFTAVEEHLIATRLHYADGATACDAIFVGGPVALAWARFDAAARKRVRAAYLRSVARWRTPSGYAIPAEFVVVAAHAPALAPAAVDQMHELQVDRAARSDLTRQA

Samples

Sample ID Description Type Environment
1 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
2 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0.47
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.5
Nodule 0.93
Rhizoplane 5.14
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000170 3300002773 Bacteria 43894
2 JGI25150J39212_1000122 3300002774 Bacteria 43890
3 JGI25151J46595_10000411 3300003187 Bacteria 43894
4 JGI25153J46596_10000252 3300003215 Bacteria 43894
5 Ga0055524_1000022 3300003775 Bacteria 224103
6 Ga0070676_10301237 3300005328 Bacteria 1087
7 Ga0070676_10426723 3300005328 Bacteria 927
8 Ga0070670_100004390 3300005331 Bacteria 11810
9 Ga0070670_100022592 3300005331 Bacteria 5413
10 Ga0070677_10166464 3300005333 Bacteria 1038
11 Ga0068869_100034012 3300005334 Bacteria 3602
12 Ga0070666_10289067 3300005335 Bacteria 1166
13 Ga0070675_100028328 3300005354 Bacteria 4508
14 Ga0070675_100090613 3300005354 Bacteria 2561
15 Ga0070671_100084950 3300005355 Bacteria 2647
16 Ga0070671_100163973 3300005355 Bacteria 1879
17 Ga0070674_100027233 3300005356 Bacteria 3744
18 Ga0070673_100201507 3300005364 Bacteria 1714
19 Ga0070673_100234134 3300005364 Bacteria 1594
20 Ga0070667_100025256 3300005367 Bacteria 4938
21 Ga0070711_100061460 3300005439 Bacteria 2615
22 Ga0070711_100114847 3300005439 Bacteria 1982
23 Ga0070662_100153006 3300005457 Bacteria 1798
24 Ga0070681_10049836 3300005458 Bacteria 4180
25 Ga0068867_100155040 3300005459 Bacteria 1802
26 Ga0068867_100295274 3300005459 Bacteria 1334
27 Ga0070699_100070917 3300005518 Bacteria 3030
28 Ga0068853_100031378 3300005539 Bacteria 4495
29 Ga0070672_100049286 3300005543 Bacteria 3276
30 Ga0070695_100015702 3300005545 Bacteria 4574
31 Ga0070665_100019476 3300005548 Bacteria 6811
32 Ga0070665_100043780 3300005548 Bacteria 4497
33 Ga0070664_100185665 3300005564 Bacteria 1850
34 Ga0068857_100055146 3300005577 Bacteria 3527
35 Ga0068857_100155332 3300005577 Bacteria 2075
36 Ga0068854_100076433 3300005578 Bacteria 2461
37 Ga0068852_100333561 3300005616 Bacteria 1476
38 Ga0068852_100710452 3300005616 Bacteria 1016
39 Ga0068864_100000307 3300005618 Bacteria 43316
40 Ga0068864_100513001 3300005618 Bacteria 1155
41 Ga0068863_100009932 3300005841 Bacteria 9268
42 Ga0068863_100260941 3300005841 Bacteria 1675
43 Ga0068858_100007516 3300005842 Bacteria 10532
44 Ga0068860_100003760 3300005843 Bacteria 15601
45 Ga0068862_100001856 3300005844 Bacteria 19150
46 Ga0075363_100025238 3300006048 Bacteria 3029
47 Ga0070715_10009548 3300006163 Bacteria 3424
48 Ga0070712_100036760 3300006175 Bacteria 3334
49 Ga0070712_100085679 3300006175 Bacteria 2294
50 Ga0075362_10003187 3300006177 Bacteria 5678
51 Ga0075362_10003232 3300006177 Bacteria 5652
52 Ga0075362_10077278 3300006177 Bacteria 1529
53 Ga0075367_10009117 3300006178 Bacteria 5171
54 Ga0075367_10061317 3300006178 Bacteria 2244
55 Ga0075369_10119005 3300006186 Bacteria 1194
56 Ga0075366_10091013 3300006195 Bacteria 1827
57 Ga0075366_10095516 3300006195 Bacteria 1782
58 Ga0075366_10098230 3300006195 Bacteria 1756
59 Ga0075366_10119515 3300006195 Bacteria 1588
60 Ga0097621_100066546 3300006237 Bacteria 2968
61 Ga0097621_100138037 3300006237 Bacteria 2081
62 Ga0075370_10000283 3300006353 Bacteria 18293
63 Ga0075370_10000636 3300006353 Bacteria 13594
64 Ga0075370_10042160 3300006353 Bacteria 2578
65 Ga0068871_100090179 3300006358 Bacteria 2553
66 Ga0075428_100000201 3300006844 Bacteria 57082
67 Ga0075431_100000002 3300006847 Bacteria 153069
68 Ga0075429_100066465 3300006880 Bacteria 3139
69 Ga0099826_10000006 3300006948 Bacteria 432260
70 Ga0111539_10001191 3300009094 Bacteria 34561
71 Ga0105245_10015991 3300009098 Bacteria 6537
72 Ga0105247_10048310 3300009101 Bacteria 2613
73 Ga0114129_10570337 3300009147 Bacteria 1470
74 Ga0105241_10019825 3300009174 Bacteria 4964
75 Ga0105248_10101177 3300009177 Bacteria 3248
76 Ga0105237_10005013 3300009545 Bacteria 15074
77 Ga0105249_10197928 3300009553 Bacteria 1965
78 Ga0105239_10024530 3300010375 Bacteria 6644
79 Ga0105239_10065952 3300010375 Bacteria 3977
80 Ga0157374_10119777 3300013296 Bacteria 2539
81 Ga0157375_10011662 3300013308 Bacteria 7765
82 Ga0157379_10335412 3300014968 Bacteria 1382
83 Ga0157376_10025467 3300014969 Bacteria 4660
84 Ga0157376_10334280 3300014969 Unclassified 1444
85 Ga0207425_1000066 3300025245 Bacteria 125463
86 Ga0209129_1000135 3300025258 Bacteria 125520
87 Ga0209675_1025053 3300025291 Bacteria 1512
88 Ga0209676_1000086 3300025292 Bacteria 264155
89 Ga0209025_1000013 3300025294 Bacteria 871757
90 Ga0209564_1011393 3300025295 Bacteria 3989
91 Ga0209758_1000014 3300025297 Bacteria 871757
92 Ga0209256_1000035 3300025299 Bacteria 386754
93 Ga0207642_10039085 3300025899 Bacteria 2058
94 Ga0207699_10038433 3300025906 Bacteria 2743
95 Ga0207699_10096889 3300025906 Bacteria 1863
96 Ga0207699_10242087 3300025906 Bacteria 1240
97 Ga0207645_10234846 3300025907 Bacteria 1211
98 Ga0207645_10240383 3300025907 Bacteria 1196
99 Ga0207707_10042178 3300025912 Bacteria 3984
100 Ga0207671_10023005 3300025914 Bacteria 4704
101 Ga0207693_10000144 3300025915 Bacteria 65408
102 Ga0207650_10000966 3300025925 Bacteria 21613
103 Ga0207650_10021212 3300025925 Bacteria 4593
104 Ga0207659_10031389 3300025926 Bacteria 3636
105 Ga0207687_10070117 3300025927 Bacteria 2502
106 Ga0207700_10116358 3300025928 Bacteria 2160
107 Ga0207644_10079513 3300025931 Bacteria 2419
108 Ga0207690_10018529 3300025932 Bacteria 4270
109 Ga0207706_10007019 3300025933 Bacteria 10412
110 Ga0207669_10176650 3300025937 Bacteria 1526
111 Ga0207665_10016712 3300025939 Bacteria 4819
112 Ga0207691_10104074 3300025940 Bacteria 2530
113 Ga0207689_10065312 3300025942 Bacteria 2993
114 Ga0207689_10325904 3300025942 Bacteria 1275
115 Ga0207661_10144328 3300025944 Bacteria 2052
116 Ga0207679_10102682 3300025945 Bacteria 2239
117 Ga0207651_10022368 3300025960 Bacteria 3864
118 Ga0207651_10046693 3300025960 Bacteria 2915
119 Ga0207651_10153469 3300025960 Bacteria 1796
120 Ga0207677_10049413 3300026023 Bacteria 2838
121 Ga0207641_10013993 3300026088 Bacteria 6577
122 Ga0207641_10199692 3300026088 Bacteria 1843
123 Ga0207641_10219533 3300026088 Bacteria 1762
124 Ga0207648_10115310 3300026089 Bacteria 2360
125 Ga0207648_10154402 3300026089 Bacteria 2026
126 Ga0207648_10492612 3300026089 Bacteria 1121
127 Ga0207648_10690377 3300026089 Bacteria 945
128 Ga0207676_10156800 3300026095 Bacteria 1968
129 Ga0207674_10015299 3300026116 Bacteria 8435
130 Ga0207674_10290754 3300026116 Bacteria 1583
131 Ga0207683_10001689 3300026121 Bacteria 19754
132 Ga0207683_10026485 3300026121 Bacteria 5003
133 Ga0207683_10041991 3300026121 Bacteria 3994
134 Ga0207698_10247655 3300026142 Bacteria 1628
135 Ga0209282_1000003 3300027666 Bacteria 856377
136 Ga0207428_10016884 3300027907 Bacteria 6272
137 Ga0268266_10086663 3300028379 Bacteria 2738
138 Ga0268265_10041696 3300028380 Bacteria 3400
139 Ga0307515_10150948 3300028794 Bacteria 2429
140 Ga0307515_10152760 3300028794 Bacteria 2403
141 Ga0265762_1012876 3300030760 Bacteria 1503
142 Ga0265327_10053088 3300031251 Bacteria 2106
143 Ga0307513_10000543 3300031456 Bacteria 53868
144 Ga0307513_10091456 3300031456 Bacteria 3101
145 Ga0307508_10049346 3300031616 Bacteria 3749
146 Ga0307516_10014615 3300031730 Bacteria 8298
147 Ga0307516_10055251 3300031730 Bacteria 3877
148 Ga0307507_10179919 3300033179 Bacteria 1514
149 Ga0373946_0066382 3300035171 Bacteria 1547
150 Ga0373937_0333239 3300036401 Bacteria 1436
151 Ga0373925_0049259 3300037068 Bacteria 3140
152 Ga0395905_0193028 3300037471 Bacteria 1910
153 Ga0439465_0063343 3300041413 Bacteria 1228
154 Ga0451807_1391913 3300041486 Bacteria 1439
155 Ga0451841_1385297 3300041498 Unclassified 909
156 Ga0451853_2654672 3300041512 Bacteria 1335
157 Ga0439432_023609 3300042006 Bacteria 2025
158 Ga0439449_0003504 3300042007 Bacteria 6098
159 Ga0439449_0104554 3300042007 Bacteria 1047
160 Ga0439449_0105129 3300042007 Bacteria 1045
161 Ga0450893_0026669 3300042532 Bacteria 1016
162 Ga0451576_0051826 3300045051 Bacteria 4301
163 Ga0495580_0000023 3300046472 Bacteria 88848
164 Ga0495580_0250816 3300046472 Bacteria 1212
165 Ga0495583_0076735 3300046506 Bacteria 1459
166 Ga0495616_0135348 3300046513 Bacteria 1126
167 Ga0495631_0182375 3300046518 Bacteria 899
168 Ga0495632_0003134 3300046519 Bacteria 11957
169 Ga0495643_0068602 3300046522 Bacteria 1866
170 Ga0495665_0164310 3300046531 Bacteria 1157
171 Ga0495625_0187998 3300046660 Bacteria 1370
172 Ga0495658_0125193 3300046683 Bacteria 1559
173 Ga0495649_0032112 3300046694 Bacteria 2894
174 Ga0495687_000723 3300047443 Bacteria 36581
175 Ga0495687_009943 3300047443 Bacteria 5262
176 Ga0496102_0005654 3300048905 Bacteria 10610
177 Ga0496102_0079274 3300048905 Bacteria 3024
178 Ga0496105_0041441 3300048908 Bacteria 3795
179 Ga0496108_0034205 3300048911 Bacteria 4222
180 Ga0496109_0060214 3300048912 Bacteria 3469
181 Ga0496110_0158602 3300048913 Bacteria 2050
182 Ga0496111_0069894 3300048914 Bacteria 2553
183 Ga0496112_0010361 3300048915 Bacteria 8453
184 Ga0496114_0084165 3300048917 Bacteria 2693
185 Ga0496115_0010855 3300048918 Bacteria 6816
186 Ga0496119_0049583 3300048922 Bacteria 2594
187 Ga0496120_0031214 3300048923 Unclassified 3229
188 Ga0496121_0132959 3300048924 Unclassified 1858
189 Ga0496125_0025609 3300048928 Bacteria 5398
190 nmdc:mga03683_5095_c1 3300050489 Bacteria 4410
191 nmdc:mga0k408_1027_c2 3300050493 Bacteria 9914
192 nmdc:mga0k408_154054_c1 3300050493 Bacteria 1369
193 nmdc:mga0k408_168220_c1 3300050493 Bacteria 1307
194 nmdc:mga0k408_24629_c1 3300050493 Bacteria 3403
195 nmdc:mga0k408_35415_c1 3300050493 Bacteria 2036
196 nmdc:mga06z11_65031_c1 3300050494 Bacteria 1913
197 nmdc:mga04h51_51297_c1 3300050495 Bacteria 1385
198 nmdc:mga07m45_18988_c1 3300050496 Bacteria 3720
199 nmdc:mga07m45_25310_c1 3300050496 Bacteria 3255
200 nmdc:mga07m45_58_c1 3300050496 Bacteria 45340
201 nmdc:mga07m45_71446_c1 3300050496 Bacteria 1975
202 nmdc:mga07m45_726_c1 3300050496 Bacteria 14058
203 nmdc:mga05p37_434286_c1 3300050507 Bacteria 1525
204 nmdc:mga09592_304_c1 3300050508 Bacteria 35821
205 nmdc:mga06r32_175_c1 3300050510 Bacteria 49913
206 nmdc:mga08y16_1690_c1 3300050511 Bacteria 22400
207 Ga0500578_0340698 3300053086 Bacteria 879
208 Ga0500562_021020 3300053108 Bacteria 1695
209 Ga0500658_0076199 3300053134 Bacteria 1425
210 Ga0500586_011544 3300053145 Bacteria 2534
211 Ga0500616_0019847 3300053153 Bacteria 3785
212 Ga0500616_0263982 3300053153 Bacteria 730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0182375 Ga0495631_0182375_281_883 200
2 3300046660 Ga0495625_0187998 Ga0495625_0187998_32_634 200
3 3300053153 Ga0500616_0263982 Ga0500616_0263982_59_661 200
4 3300005355 Ga0070671_100163973 Ga0070671_1001639732 235
5 3300014969 Ga0157376_10334280 Ga0157376_103342801 235
6 3300042007 Ga0439449_0105129 Ga0439449_0105129_29_754 235
7 3300042532 Ga0450893_0026669 Ga0450893_0026669_13_738 235
8 3300046513 Ga0495616_0135348 Ga0495616_0135348_65_880 242
9 3300046519 Ga0495632_0003134 Ga0495632_0003134_838_1653 242
10 3300046694 Ga0495649_0032112 Ga0495649_0032112_1212_2027 242
11 3300047443 Ga0495687_009943 Ga0495687_009943_3093_3908 242
12 3300053086 Ga0500578_0340698 Ga0500578_0340698_37_852 242
13 3300053134 Ga0500658_0076199 Ga0500658_0076199_136_951 242
14 3300050493 nmdc:mga0k408_154054_c1 nmdc:mga0k408_154054_c1_395_1234 243
15 3300033179 Ga0307507_10179919 Ga0307507_101799192 244
16 3300028380 Ga0268265_10041696 Ga0268265_100416961 246
17 3300028794 Ga0307515_10150948 Ga0307515_101509483 247
18 3300005331 Ga0070670_100022592 Ga0070670_1000225922 251
19 3300025925 Ga0207650_10021212 Ga0207650_100212123 251
20 3300005364 Ga0070673_100201507 Ga0070673_1002015072 255
21 3300025960 Ga0207651_10153469 Ga0207651_101534692 255
22 3300005367 Ga0070667_100025256 Ga0070667_1000252562 256
23 3300005459 Ga0068867_100155040 Ga0068867_1001550402 256
24 3300005543 Ga0070672_100049286 Ga0070672_1000492863 256
25 3300005548 Ga0070665_100019476 Ga0070665_1000194768 256
26 3300006237 Ga0097621_100066546 Ga0097621_1000665462 256
27 3300006358 Ga0068871_100090179 Ga0068871_1000901793 256
28 3300014968 Ga0157379_10335412 Ga0157379_103354122 256
29 3300014969 Ga0157376_10025467 Ga0157376_100254672 256
30 3300025937 Ga0207669_10176650 Ga0207669_101766501 256
31 3300025940 Ga0207691_10104074 Ga0207691_101040743 256
32 3300026089 Ga0207648_10115310 Ga0207648_101153102 256
33 3300026121 Ga0207683_10001689 Ga0207683_1000168915 256
34 3300028379 Ga0268266_10086663 Ga0268266_100866632 256
35 3300042007 Ga0439449_0104554 Ga0439449_0104554_242_1027 256
36 3300005439 Ga0070711_100114847 Ga0070711_1001148472 257
37 3300025906 Ga0207699_10096889 Ga0207699_100968892 257
38 3300041486 Ga0451807_1391913 Ga0451807_1391913_321_1160 264
39 3300041512 Ga0451853_2654672 Ga0451853_2654672_455_1294 264
40 3300006844 Ga0075428_100000201 Ga0075428_10000020147 265
41 3300006847 Ga0075431_100000002 Ga0075431_100000002100 265
42 3300006880 Ga0075429_100066465 Ga0075429_1000664653 265
43 3300009094 Ga0111539_10001191 Ga0111539_1000119132 265
44 3300009147 Ga0114129_10570337 Ga0114129_105703372 265
45 3300027907 Ga0207428_10016884 Ga0207428_100168843 265
46 3300042006 Ga0439432_023609 Ga0439432_023609_792_1622 265
47 3300042007 Ga0439449_0003504 Ga0439449_0003504_4051_4881 265
48 3300050507 nmdc:mga05p37_434286_c1 nmdc:mga05p37_434286_c1_385_1206 265
49 3300050508 nmdc:mga09592_304_c1 nmdc:mga09592_304_c1_19290_20111 265
50 3300050510 nmdc:mga06r32_175_c1 nmdc:mga06r32_175_c1_9024_9845 265
51 3300050511 nmdc:mga08y16_1690_c1 nmdc:mga08y16_1690_c1_19549_20370 265
52 3300005844 Ga0068862_100001856 Ga0068862_10000185618 267
53 3300048905 Ga0496102_0079274 Ga0496102_0079274_1630_2454 267
54 3300048922 Ga0496119_0049583 Ga0496119_0049583_1027_1851 267
55 3300048923 Ga0496120_0031214 Ga0496120_0031214_184_1008 267
56 3300048924 Ga0496121_0132959 Ga0496121_0132959_213_1037 267
57 3300048928 Ga0496125_0025609 Ga0496125_0025609_3414_4238 267
58 3300005331 Ga0070670_100004390 Ga0070670_10000439015 268
59 3300005618 Ga0068864_100000307 Ga0068864_10000030728 268
60 3300005841 Ga0068863_100009932 Ga0068863_1000099323 268
61 3300025925 Ga0207650_10000966 Ga0207650_1000096619 268
62 3300026088 Ga0207641_10013993 Ga0207641_100139934 268
63 3300005458 Ga0070681_10049836 Ga0070681_100498365 269
64 3300005518 Ga0070699_100070917 Ga0070699_1000709172 269
65 3300005545 Ga0070695_100015702 Ga0070695_1000157024 269
66 3300025906 Ga0207699_10242087 Ga0207699_102420872 269
67 3300025912 Ga0207707_10042178 Ga0207707_100421782 269
68 3300048915 Ga0496112_0010361 Ga0496112_0010361_2652_3488 269
69 iso_pu_bacteria 2643221579 2643907937 269
70 iso_pu_bacteria 2885192300 2885194386 269
71 3300026089 Ga0207648_10690377 Ga0207648_106903771 270
72 3300003775 Ga0055524_1000022 Ga0055524_1000022184 271
73 3300005328 Ga0070676_10301237 Ga0070676_103012371 271
74 3300005333 Ga0070677_10166464 Ga0070677_101664641 271
75 3300005354 Ga0070675_100028328 Ga0070675_1000283283 271
76 3300005356 Ga0070674_100027233 Ga0070674_1000272334 271
77 3300005439 Ga0070711_100061460 Ga0070711_1000614601 271
78 3300005457 Ga0070662_100153006 Ga0070662_1001530062 271
79 3300005548 Ga0070665_100043780 Ga0070665_1000437803 271
80 3300005564 Ga0070664_100185665 Ga0070664_1001856652 271
81 3300005577 Ga0068857_100155332 Ga0068857_1001553322 271
82 3300005616 Ga0068852_100710452 Ga0068852_1007104521 271
83 3300005618 Ga0068864_100513001 Ga0068864_1005130012 271
84 3300005841 Ga0068863_100260941 Ga0068863_1002609412 271
85 3300005842 Ga0068858_100007516 Ga0068858_1000075169 271
86 3300005843 Ga0068860_100003760 Ga0068860_1000037605 271
87 3300006048 Ga0075363_100025238 Ga0075363_1000252383 271
88 3300006163 Ga0070715_10009548 Ga0070715_100095482 271
89 3300006175 Ga0070712_100036760 Ga0070712_1000367602 271
90 3300006177 Ga0075362_10003232 Ga0075362_100032323 271
91 3300006177 Ga0075362_10077278 Ga0075362_100772782 271
92 3300006178 Ga0075367_10009117 Ga0075367_100091172 271
93 3300006178 Ga0075367_10061317 Ga0075367_100613171 271
94 3300006186 Ga0075369_10119005 Ga0075369_101190052 271
95 3300006195 Ga0075366_10091013 Ga0075366_100910132 271
96 3300006195 Ga0075366_10119515 Ga0075366_101195153 271
97 3300006237 Ga0097621_100138037 Ga0097621_1001380372 271
98 3300006353 Ga0075370_10000283 Ga0075370_1000028316 271
99 3300006948 Ga0099826_10000006 Ga0099826_10000006224 271
100 3300009098 Ga0105245_10015991 Ga0105245_100159913 271
101 3300009101 Ga0105247_10048310 Ga0105247_100483101 271
102 3300009174 Ga0105241_10019825 Ga0105241_100198252 271
103 3300009545 Ga0105237_10005013 Ga0105237_100050135 271
104 3300010375 Ga0105239_10065952 Ga0105239_100659523 271
105 3300013296 Ga0157374_10119777 Ga0157374_101197773 271
106 3300013308 Ga0157375_10011662 Ga0157375_100116621 271
107 3300025291 Ga0209675_1025053 Ga0209675_10250532 271
108 3300025295 Ga0209564_1011393 Ga0209564_10113932 271
109 3300025299 Ga0209256_1000035 Ga0209256_1000035184 271
110 3300025899 Ga0207642_10039085 Ga0207642_100390851 271
111 3300025906 Ga0207699_10038433 Ga0207699_100384332 271
112 3300025907 Ga0207645_10234846 Ga0207645_102348462 271
113 3300025907 Ga0207645_10240383 Ga0207645_102403832 271
114 3300025914 Ga0207671_10023005 Ga0207671_100230052 271
115 3300025915 Ga0207693_10000144 Ga0207693_1000014429 271
116 3300025926 Ga0207659_10031389 Ga0207659_100313893 271
117 3300025927 Ga0207687_10070117 Ga0207687_100701172 271
118 3300025928 Ga0207700_10116358 Ga0207700_101163582 271
119 3300025931 Ga0207644_10079513 Ga0207644_100795132 271
120 3300025932 Ga0207690_10018529 Ga0207690_100185292 271
121 3300025939 Ga0207665_10016712 Ga0207665_100167123 271
122 3300025942 Ga0207689_10325904 Ga0207689_103259042 271
123 3300025944 Ga0207661_10144328 Ga0207661_101443282 271
124 3300025945 Ga0207679_10102682 Ga0207679_101026822 271
125 3300025960 Ga0207651_10022368 Ga0207651_100223681 271
126 3300025960 Ga0207651_10046693 Ga0207651_100466932 271
127 3300026023 Ga0207677_10049413 Ga0207677_100494134 271
128 3300026088 Ga0207641_10199692 Ga0207641_101996922 271
129 3300026088 Ga0207641_10219533 Ga0207641_102195332 271
130 3300026089 Ga0207648_10154402 Ga0207648_101544022 271
131 3300026089 Ga0207648_10492612 Ga0207648_104926122 271
132 3300026095 Ga0207676_10156800 Ga0207676_101568003 271
133 3300026116 Ga0207674_10290754 Ga0207674_102907542 271
134 3300026121 Ga0207683_10026485 Ga0207683_100264852 271
135 3300026121 Ga0207683_10041991 Ga0207683_100419914 271
136 3300027666 Ga0209282_1000003 Ga0209282_1000003151 271
137 3300028794 Ga0307515_10152760 Ga0307515_101527602 271
138 3300030760 Ga0265762_1012876 Ga0265762_10128761 271
139 3300031251 Ga0265327_10053088 Ga0265327_100530882 271
140 3300031456 Ga0307513_10000543 Ga0307513_1000054339 271
141 3300031456 Ga0307513_10091456 Ga0307513_100914562 271
142 3300031616 Ga0307508_10049346 Ga0307508_100493464 271
143 3300031730 Ga0307516_10014615 Ga0307516_100146155 271
144 3300031730 Ga0307516_10055251 Ga0307516_100552513 271
145 3300035171 Ga0373946_0066382 Ga0373946_0066382_325_1146 271
146 3300036401 Ga0373937_0333239 Ga0373937_0333239_340_1167 271
147 3300037068 Ga0373925_0049259 Ga0373925_0049259_790_1611 271
148 3300037471 Ga0395905_0193028 Ga0395905_0193028_106_936 271
149 3300045051 Ga0451576_0051826 Ga0451576_0051826_92_934 271
150 3300046472 Ga0495580_0000023 Ga0495580_0000023_69204_70025 271
151 3300046472 Ga0495580_0250816 Ga0495580_0250816_93_1001 271
152 3300046506 Ga0495583_0076735 Ga0495583_0076735_188_1003 271
153 3300046522 Ga0495643_0068602 Ga0495643_0068602_121_936 271
154 3300046531 Ga0495665_0164310 Ga0495665_0164310_86_907 271
155 3300046683 Ga0495658_0125193 Ga0495658_0125193_593_1414 271
156 3300047443 Ga0495687_000723 Ga0495687_000723_12803_13618 271
157 3300048905 Ga0496102_0005654 Ga0496102_0005654_3912_4733 271
158 3300048908 Ga0496105_0041441 Ga0496105_0041441_1852_2673 271
159 3300048911 Ga0496108_0034205 Ga0496108_0034205_2106_2951 271
160 3300048912 Ga0496109_0060214 Ga0496109_0060214_1745_2566 271
161 3300048913 Ga0496110_0158602 Ga0496110_0158602_242_1063 271
162 3300048914 Ga0496111_0069894 Ga0496111_0069894_960_1781 271
163 3300048917 Ga0496114_0084165 Ga0496114_0084165_286_1113 271
164 3300048918 Ga0496115_0010855 Ga0496115_0010855_508_1329 271
165 3300050489 nmdc:mga03683_5095_c1 nmdc:mga03683_5095_c1_808_1641 271
166 3300050493 nmdc:mga0k408_168220_c1 nmdc:mga0k408_168220_c1_242_1057 271
167 3300050493 nmdc:mga0k408_24629_c1 nmdc:mga0k408_24629_c1_492_1382 271
168 3300050494 nmdc:mga06z11_65031_c1 nmdc:mga06z11_65031_c1_279_1094 271
169 3300050496 nmdc:mga07m45_18988_c1 nmdc:mga07m45_18988_c1_2100_2915 271
170 3300050496 nmdc:mga07m45_71446_c1 nmdc:mga07m45_71446_c1_319_1134 271
171 3300050496 nmdc:mga07m45_726_c1 nmdc:mga07m45_726_c1_12186_13076 271
172 3300005334 Ga0068869_100034012 Ga0068869_1000340124 272
173 3300005335 Ga0070666_10289067 Ga0070666_102890671 272
174 3300005354 Ga0070675_100090613 Ga0070675_1000906132 272
175 3300005355 Ga0070671_100084950 Ga0070671_1000849501 272
176 3300005364 Ga0070673_100234134 Ga0070673_1002341342 272
177 3300005539 Ga0068853_100031378 Ga0068853_1000313785 272
178 3300005577 Ga0068857_100055146 Ga0068857_1000551463 272
179 3300005578 Ga0068854_100076433 Ga0068854_1000764334 272
180 3300005616 Ga0068852_100333561 Ga0068852_1003335613 272
181 3300006177 Ga0075362_10003187 Ga0075362_100031874 272
182 3300006195 Ga0075366_10095516 Ga0075366_100955163 272
183 3300006195 Ga0075366_10098230 Ga0075366_100982302 272
184 3300006353 Ga0075370_10000636 Ga0075370_100006369 272
185 3300006353 Ga0075370_10042160 Ga0075370_100421602 272
186 3300010375 Ga0105239_10024530 Ga0105239_100245305 272
187 3300025933 Ga0207706_10007019 Ga0207706_100070192 272
188 3300025942 Ga0207689_10065312 Ga0207689_100653124 272
189 3300026116 Ga0207674_10015299 Ga0207674_100152997 272
190 3300026142 Ga0207698_10247655 Ga0207698_102476552 272
191 3300050493 nmdc:mga0k408_1027_c2 nmdc:mga0k408_1027_c2_186_1004 272
192 3300050495 nmdc:mga04h51_51297_c1 nmdc:mga04h51_51297_c1_23_841 272
193 3300050496 nmdc:mga07m45_25310_c1 nmdc:mga07m45_25310_c1_2179_3006 272
194 3300050496 nmdc:mga07m45_58_c1 nmdc:mga07m45_58_c1_30323_31141 272
195 3300005328 Ga0070676_10426723 Ga0070676_104267231 273
196 3300005459 Ga0068867_100295274 Ga0068867_1002952741 273
197 3300006175 Ga0070712_100085679 Ga0070712_1000856792 273
198 3300009553 Ga0105249_10197928 Ga0105249_101979282 273
199 3300025292 Ga0209676_1000086 Ga0209676_100008629 273
200 3300041413 Ga0439465_0063343 Ga0439465_0063343_356_1186 273
201 3300041498 Ga0451841_1385297 Ga0451841_1385297_21_857 273
202 3300050493 nmdc:mga0k408_35415_c1 nmdc:mga0k408_35415_c1_851_1681 273
203 3300009177 Ga0105248_10101177 Ga0105248_101011772 276
204 3300053108 Ga0500562_021020 Ga0500562_021020_649_1533 281
205 3300053145 Ga0500586_011544 Ga0500586_011544_251_1150 281
206 3300053153 Ga0500616_0019847 Ga0500616_0019847_2373_3266 281
207 3300002773 JGI25152J39213_1000170 JGI25152J39213_100017029 283
208 3300002774 JGI25150J39212_1000122 JGI25150J39212_100012221 283
209 3300003187 JGI25151J46595_10000411 JGI25151J46595_1000041121 283
210 3300003215 JGI25153J46596_10000252 JGI25153J46596_1000025221 283
211 3300025245 Ga0207425_1000066 Ga0207425_100006629 283
212 3300025258 Ga0209129_1000135 Ga0209129_100013586 283
213 3300025294 Ga0209025_1000013 Ga0209025_1000013312 283
214 3300025297 Ga0209758_1000014 Ga0209758_1000014312 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

49

148

0.97

PF13847

Methyltransf_31

Methyltransferase domain

42

168

0.97

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

32

164

0.96

PF13649

Methyltransf_25

Methyltransferase domain

48

144

0.94

PF08242

Methyltransf_12

Methyltransferase domain

49

146

0.9

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

21

157

0.88

PF13489

Methyltransf_23

Methyltransferase domain

24

201

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.8592 35 151
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8528 34 152
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.8518 34 127
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8506 32 150
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.847 35 199
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9742 47 109 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.939 42 107 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9388 34 110 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9148 33 105 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9128 33 107 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Z4T6Q9-F1-model_v4 deleted 0.9759 40 150
AF-A0A223A4M9-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9655 52 141 GO:0008168
GO:0032259
AF-A0A1L4BMH0-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9634 41 146 GO:0008168
GO:0032259
AF-A0A832K672-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9626 38 150 GO:0008168
GO:0032259
AF-A0A536VRK7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9547 21 146 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map