F325495

General Info

Members Datasets Scaffolds Average Seq Length
214 162 428 161

Family's Representative Sequence

Representative Sequence 3300041507|Ga0451851_0400984|Ga0451851_0400984_104_625
Length 173
Sequence MDAGWHRLLRLSTRPSLHGMVGHVTKPDALEWGVDNCTIGRAMDILGEKWTMVVLREVFSGIRRFDDMRVRTRIPRQVLANRLVALVGHGVLRREPYREPGARVRHEYRLTEKGIDLYPTLVALMEWGDRYLGDVGGAMELHHRDCGAPVHLTLTCEDGHALSGAREVTAIPR

Samples

Sample ID Description Type Environment
1 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
142 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
143 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
144 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
145 2855683550 Micromonospora sp. RP3T Isolate Unclassified
146 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
147 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
148 2858882152 Micromonospora noduli MED15 Isolate Nodule
149 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
150 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
151 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
152 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
153 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
154 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
155 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
156 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
157 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
158 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
159 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
160 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
161 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
162 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.47
Isolates 10.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.22
Nodule 2.34
Rhizoplane 4.21
Rhizosphere 65.89
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451851_0400984 3300041507 Bacteria 738
2 rootL2_10281228 3300003322 Bacteria 1182
3 Ga0070658_10560637 3300005327 Bacteria 989
4 Ga0070683_100030351 3300005329 Bacteria 4906
5 Ga0070670_100158192 3300005331 Bacteria 1963
6 Ga0070680_100779626 3300005336 Bacteria 823
7 Ga0070682_100329979 3300005337 Bacteria 1130
8 Ga0068868_100026240 3300005338 Bacteria 4437
9 Ga0070660_100567708 3300005339 Bacteria 947
10 Ga0070687_100014617 3300005343 Bacteria 3530
11 Ga0070661_100159653 3300005344 Bacteria 1707
12 Ga0070692_10005362 3300005345 Bacteria 5459
13 Ga0070668_100163954 3300005347 Bacteria 1805
14 Ga0070668_100480034 3300005347 Bacteria 1073
15 Ga0070669_100064189 3300005353 Bacteria 2704
16 Ga0070675_100004790 3300005354 Bacteria 10318
17 Ga0070659_100026710 3300005366 Bacteria 4444
18 Ga0070700_100119867 3300005441 Bacteria 1761
19 Ga0070708_100074254 3300005445 Bacteria 3067
20 Ga0070708_100248666 3300005445 Unclassified 1670
21 Ga0070663_100013028 3300005455 Bacteria 5282
22 Ga0070663_100720706 3300005455 Bacteria 849
23 Ga0070663_101389258 3300005455 Bacteria 622
24 Ga0070678_100219643 3300005456 Bacteria 1579
25 Ga0070662_100012895 3300005457 Bacteria 5554
26 Ga0070706_100175606 3300005467 Unclassified 2000
27 Ga0070706_100406540 3300005467 Bacteria 1267
28 Ga0070707_100009868 3300005468 Bacteria 8884
29 Ga0070707_100112587 3300005468 Bacteria 2640
30 Ga0070707_100327145 3300005468 Unclassified 1489
31 Ga0070707_100329507 3300005468 Bacteria 1483
32 Ga0070707_100331872 3300005468 Bacteria 1477
33 Ga0070699_101358029 3300005518 Unclassified 652
34 Ga0070684_100102635 3300005535 Bacteria 2557
35 Ga0070697_100895999 3300005536 Bacteria 787
36 Ga0070672_100778776 3300005543 Bacteria 841
37 Ga0070664_100005439 3300005564 Bacteria 10223
38 Ga0068857_100023424 3300005577 Bacteria 5436
39 Ga0068854_100214028 3300005578 Bacteria 1521
40 Ga0068852_100025458 3300005616 Bacteria 4794
41 Ga0068852_100698757 3300005616 Bacteria 1024
42 Ga0068852_101130278 3300005616 Bacteria 804
43 Ga0068859_100082096 3300005617 Bacteria 3266
44 Ga0068861_100068421 3300005719 Bacteria 2744
45 Ga0068863_100136380 3300005841 Bacteria 2344
46 Ga0068860_100491495 3300005843 Bacteria 1224
47 Ga0068860_101503870 3300005843 Bacteria 695
48 Ga0068862_100011660 3300005844 Bacteria 7252
49 Ga0081455_10073171 3300005937 Bacteria 2834
50 Ga0081539_10026406 3300005985 Bacteria 3705
51 Ga0081539_10116650 3300005985 Unclassified 1333
52 Ga0070717_10213041 3300006028 Bacteria 1696
53 Ga0075365_10060885 3300006038 Bacteria 2519
54 Ga0075365_10214902 3300006038 Bacteria 1348
55 Ga0075365_10631916 3300006038 Bacteria 757
56 Ga0075365_10776083 3300006038 Bacteria 677
57 Ga0075365_11033204 3300006038 Bacteria 579
58 Ga0075368_10009866 3300006042 Bacteria 3442
59 Ga0075363_100031984 3300006048 Bacteria 2730
60 Ga0075363_100051379 3300006048 Bacteria 2198
61 Ga0075364_10023482 3300006051 Bacteria 3904
62 Ga0075364_10268281 3300006051 Bacteria 1161
63 Ga0075362_10042589 3300006177 Bacteria 2007
64 Ga0075362_10352288 3300006177 Bacteria 737
65 Ga0075367_10037899 3300006178 Bacteria 2803
66 Ga0075367_10172254 3300006178 Bacteria 1348
67 Ga0075367_10255413 3300006178 Bacteria 1099
68 Ga0075367_10387134 3300006178 Bacteria 884
69 Ga0075370_10057179 3300006353 Bacteria 2217
70 Ga0075370_10214571 3300006353 Bacteria 1137
71 Ga0075370_10297134 3300006353 Bacteria 960
72 Ga0075428_100002402 3300006844 Bacteria 20332
73 Ga0075430_100082822 3300006846 Bacteria 2688
74 Ga0075431_100051804 3300006847 Bacteria 4232
75 Ga0075429_100004599 3300006880 Bacteria 11863
76 Ga0068865_100312047 3300006881 Bacteria 1262
77 Ga0097620_100082098 3300006931 Bacteria 3266
78 Ga0099794_10059588 3300007265 Bacteria 1853
79 Ga0111539_10018226 3300009094 Bacteria 8694
80 Ga0114129_10074484 3300009147 Bacteria 4729
81 Ga0105243_10026971 3300009148 Bacteria 4399
82 Ga0105248_10169610 3300009177 Bacteria 2460
83 Ga0105238_11426490 3300009551 Bacteria 720
84 Ga0105249_10129109 3300009553 Bacteria 2411
85 Ga0105239_10062906 3300010375 Bacteria 4073
86 Ga0157371_10411559 3300013102 Bacteria 990
87 Ga0163162_10753584 3300013306 Bacteria 1093
88 Ga0157372_10154695 3300013307 Bacteria 2648
89 Ga0157375_10310347 3300013308 Bacteria 1741
90 Ga0157380_10448280 3300014326 Bacteria 1239
91 Ga0157377_10026899 3300014745 Bacteria 3083
92 Ga0157379_10535236 3300014968 Bacteria 1089
93 Ga0206354_11216441 3300020081 Bacteria 767
94 Ga0207656_10188733 3300025321 Bacteria 992
95 Ga0207688_10040114 3300025901 Bacteria 2601
96 Ga0207705_10147617 3300025909 Bacteria 1760
97 Ga0207684_10105576 3300025910 Bacteria 2409
98 Ga0207684_10722720 3300025910 Bacteria 845
99 Ga0207657_10135719 3300025919 Bacteria 2013
100 Ga0207657_10231894 3300025919 Bacteria 1476
101 Ga0207646_10091437 3300025922 Bacteria 2724
102 Ga0207646_10129857 3300025922 Bacteria 2267
103 Ga0207646_10463940 3300025922 Unclassified 1142
104 Ga0207681_10087101 3300025923 Bacteria 2221
105 Ga0207650_10673124 3300025925 Bacteria 873
106 Ga0207690_10107408 3300025932 Bacteria 2004
107 Ga0207690_10589441 3300025932 Bacteria 907
108 Ga0207706_10028320 3300025933 Bacteria 5004
109 Ga0207711_10045532 3300025941 Bacteria 3749
110 Ga0207661_10275477 3300025944 Bacteria 1502
111 Ga0207679_10025196 3300025945 Bacteria 4088
112 Ga0207668_10008490 3300025972 Bacteria 6126
113 Ga0207668_10772872 3300025972 Bacteria 849
114 Ga0207640_10110492 3300025981 Bacteria 1947
115 Ga0207677_10082516 3300026023 Bacteria 2310
116 Ga0207678_10006967 3300026067 Bacteria 10033
117 Ga0207708_10049588 3300026075 Bacteria 3197
118 Ga0207641_10501532 3300026088 Bacteria 1179
119 Ga0207676_10085827 3300026095 Bacteria 2570
120 Ga0207674_10011970 3300026116 Bacteria 9723
121 Ga0207675_100098855 3300026118 Bacteria 2749
122 Ga0207683_10473827 3300026121 Bacteria 1155
123 Ga0207698_10082211 3300026142 Bacteria 2603
124 Ga0207698_10635782 3300026142 Bacteria 1056
125 Ga0209813_10041382 3300027866 Bacteria 1404
126 Ga0268265_10018360 3300028380 Bacteria 4845
127 Ga0268265_10044021 3300028380 Bacteria 3322
128 Ga0268264_11361724 3300028381 Bacteria 720
129 Ga0307513_10655966 3300031456 Bacteria 756
130 Ga0307405_10008868 3300031731 Bacteria 5127
131 Ga0307405_10267493 3300031731 Bacteria 1280
132 Ga0307410_10179063 3300031852 Bacteria 1604
133 Ga0307406_11768440 3300031901 Bacteria 549
134 Ga0307406_11896464 3300031901 Bacteria 531
135 Ga0307412_10669109 3300031911 Bacteria 888
136 Ga0307409_100393618 3300031995 Bacteria 1321
137 Ga0307409_100726973 3300031995 Bacteria 994
138 Ga0307409_100804472 3300031995 Bacteria 948
139 Ga0307416_100452329 3300032002 Bacteria 1337
140 Ga0307411_10754445 3300032005 Bacteria 853
141 Ga0307415_100024509 3300032126 Bacteria 3768
142 Ga0307415_100118880 3300032126 Bacteria 1977
143 Ga0307415_100175143 3300032126 Bacteria 1677
144 Ga0373928_0155508 3300035084 Bacteria 636
145 Ga0373940_0000419 3300035088 Bacteria 6471
146 Ga0373942_0000970 3300035207 Bacteria 7808
147 Ga0373937_0925076 3300036401 Bacteria 821
148 Ga0395901_0746893 3300038443 Bacteria 972
149 Ga0451841_1459775 3300041498 Bacteria 821
150 Ga0451853_0463522 3300041512 Bacteria 2877
151 Ga0450907_005053 3300042146 Bacteria 2240
152 Ga0495608_0040494 3300046511 Bacteria 3121
153 Ga0495630_0370842 3300046517 Bacteria 1096
154 Ga0495587_0472583 3300046536 Bacteria 694
155 Ga0495613_0286813 3300046689 Bacteria 1142
156 Ga0496100_0829473 3300048903 Bacteria 725
157 Ga0496104_0191814 3300048907 Bacteria 1955
158 Ga0496108_0000227 3300048911 Bacteria 50319
159 Ga0496109_0132837 3300048912 Bacteria 2324
160 Ga0496109_0500748 3300048912 Bacteria 1147
161 Ga0496111_0070882 3300048914 Bacteria 2536
162 Ga0496114_0149854 3300048917 Bacteria 2023
163 Ga0496114_0811965 3300048917 Bacteria 814
164 Ga0496114_0942971 3300048917 Bacteria 745
165 Ga0501042_0710107 3300049578 Bacteria 731
166 Ga0501048_0895002 3300049582 Bacteria 638
167 Ga0501070_0561720 3300049586 Bacteria 913
168 Ga0501074_0246038 3300049590 Bacteria 1272
169 Ga0501080_1290480 3300049742 Bacteria 625
170 nmdc:mga03683_242506_c1 3300050489 Bacteria 835
171 nmdc:mga03n38_375030_c1 3300050490 Bacteria 778
172 nmdc:mga03n38_396761_c1 3300050490 Bacteria 759
173 nmdc:mga03n38_6219_c1 3300050490 Bacteria 4130
174 nmdc:mga00v17_23473_c1 3300050491 Bacteria 3568
175 nmdc:mga00v17_257053_c1 3300050491 Bacteria 1133
176 nmdc:mga00v17_291723_c1 3300050491 Bacteria 1059
177 nmdc:mga00v17_7716_c1 3300050491 Bacteria 5761
178 nmdc:mga0yw44_122707_c1 3300050492 Bacteria 1675
179 nmdc:mga0yw44_363413_c1 3300050492 Bacteria 976
180 nmdc:mga0yw44_397071_c1 3300050492 Bacteria 932
181 nmdc:mga0yw44_671673_c1 3300050492 Bacteria 704
182 nmdc:mga06z11_188436_c1 3300050494 Bacteria 1193
183 nmdc:mga06z11_227360_c1 3300050494 Bacteria 1092
184 nmdc:mga06z11_453894_c1 3300050494 Bacteria 775
185 nmdc:mga04h51_56392_c1 3300050495 Bacteria 1334
186 nmdc:mga05p37_198030_c1 3300050507 Bacteria 2435
187 nmdc:mga09592_97525_c1 3300050508 Bacteria 2516
188 nmdc:mga0qj67_24346_c1 3300050509 Bacteria 4666
189 nmdc:mga08y16_135071_c1 3300050511 Bacteria 2564
190 Ga0500644_0000050 3300053088 Bacteria 71907
191 Ga0500646_0301450 3300053090 Bacteria 575
192 Ga0500568_0274700 3300053139 Bacteria 612
193 2623587948 2622736626 Bacteria 7181580
194 2772643573 2772190715 Bacteria 6959372
195 2855675261 2855670206 Bacteria 7120389
196 2855680545 2855676851 Bacteria 7063653
197 2855687449 2855683550 Bacteria 7134265
198 2857295567 2857288857 Bacteria 7189066
199 2858851299 2858848962 Bacteria 6963058
200 2858883395 2858882152 Bacteria 7230291
201 2858890903 2858888857 Bacteria 7060307
202 2858899425 2858895516 Bacteria 7378898
203 2867319182 2867312974 Bacteria 7058875
204 2867320185 2867319477 Bacteria 7069771
205 2869054461 2869048445 Bacteria 6875584
206 2869062066 2869061728 Bacteria 7112407
207 2869074784 2869068681 Bacteria 7205615
208 2873315743 2873314349 Bacteria 8512634
209 2880492122 2880489317 Bacteria 7096270
210 2880500173 2880495981 Bacteria 7340502
211 2929228726 2929226422 Bacteria 7248583
212 8054707073 8054704163 Bacteria 7247792
213 8054728644 8054727385 Bacteria 7558670
214 8054739642 8054734606 Bacteria 6947278
215 Ga0451851_0400984
216 rootL2_10281228
217 Ga0070658_10560637
218 Ga0070683_100030351
219 Ga0070670_100158192
220 Ga0070680_100779626
221 Ga0070682_100329979
222 Ga0068868_100026240
223 Ga0070660_100567708
224 Ga0070687_100014617
225 Ga0070661_100159653
226 Ga0070692_10005362
227 Ga0070668_100163954
228 Ga0070668_100480034
229 Ga0070669_100064189
230 Ga0070675_100004790
231 Ga0070659_100026710
232 Ga0070700_100119867
233 Ga0070708_100074254
234 Ga0070708_100248666
235 Ga0070663_100013028
236 Ga0070663_100720706
237 Ga0070663_101389258
238 Ga0070678_100219643
239 Ga0070662_100012895
240 Ga0070706_100175606
241 Ga0070706_100406540
242 Ga0070707_100009868
243 Ga0070707_100112587
244 Ga0070707_100327145
245 Ga0070707_100329507
246 Ga0070707_100331872
247 Ga0070699_101358029
248 Ga0070684_100102635
249 Ga0070697_100895999
250 Ga0070672_100778776
251 Ga0070664_100005439
252 Ga0068857_100023424
253 Ga0068854_100214028
254 Ga0068852_100025458
255 Ga0068852_100698757
256 Ga0068852_101130278
257 Ga0068859_100082096
258 Ga0068861_100068421
259 Ga0068863_100136380
260 Ga0068860_100491495
261 Ga0068860_101503870
262 Ga0068862_100011660
263 Ga0081455_10073171
264 Ga0081539_10026406
265 Ga0081539_10116650
266 Ga0070717_10213041
267 Ga0075365_10060885
268 Ga0075365_10214902
269 Ga0075365_10631916
270 Ga0075365_10776083
271 Ga0075365_11033204
272 Ga0075368_10009866
273 Ga0075363_100031984
274 Ga0075363_100051379
275 Ga0075364_10023482
276 Ga0075364_10268281
277 Ga0075362_10042589
278 Ga0075362_10352288
279 Ga0075367_10037899
280 Ga0075367_10172254
281 Ga0075367_10255413
282 Ga0075367_10387134
283 Ga0075370_10057179
284 Ga0075370_10214571
285 Ga0075370_10297134
286 Ga0075428_100002402
287 Ga0075430_100082822
288 Ga0075431_100051804
289 Ga0075429_100004599
290 Ga0068865_100312047
291 Ga0097620_100082098
292 Ga0099794_10059588
293 Ga0111539_10018226
294 Ga0114129_10074484
295 Ga0105243_10026971
296 Ga0105248_10169610
297 Ga0105238_11426490
298 Ga0105249_10129109
299 Ga0105239_10062906
300 Ga0157371_10411559
301 Ga0163162_10753584
302 Ga0157372_10154695
303 Ga0157375_10310347
304 Ga0157380_10448280
305 Ga0157377_10026899
306 Ga0157379_10535236
307 Ga0206354_11216441
308 Ga0207656_10188733
309 Ga0207688_10040114
310 Ga0207705_10147617
311 Ga0207684_10105576
312 Ga0207684_10722720
313 Ga0207657_10135719
314 Ga0207657_10231894
315 Ga0207646_10091437
316 Ga0207646_10129857
317 Ga0207646_10463940
318 Ga0207681_10087101
319 Ga0207650_10673124
320 Ga0207690_10107408
321 Ga0207690_10589441
322 Ga0207706_10028320
323 Ga0207711_10045532
324 Ga0207661_10275477
325 Ga0207679_10025196
326 Ga0207668_10008490
327 Ga0207668_10772872
328 Ga0207640_10110492
329 Ga0207677_10082516
330 Ga0207678_10006967
331 Ga0207708_10049588
332 Ga0207641_10501532
333 Ga0207676_10085827
334 Ga0207674_10011970
335 Ga0207675_100098855
336 Ga0207683_10473827
337 Ga0207698_10082211
338 Ga0207698_10635782
339 Ga0209813_10041382
340 Ga0268265_10018360
341 Ga0268265_10044021
342 Ga0268264_11361724
343 Ga0307513_10655966
344 Ga0307405_10008868
345 Ga0307405_10267493
346 Ga0307410_10179063
347 Ga0307406_11768440
348 Ga0307406_11896464
349 Ga0307412_10669109
350 Ga0307409_100393618
351 Ga0307409_100726973
352 Ga0307409_100804472
353 Ga0307416_100452329
354 Ga0307411_10754445
355 Ga0307415_100024509
356 Ga0307415_100118880
357 Ga0307415_100175143
358 Ga0373928_0155508
359 Ga0373940_0000419
360 Ga0373942_0000970
361 Ga0373937_0925076
362 Ga0395901_0746893
363 Ga0451841_1459775
364 Ga0451853_0463522
365 Ga0450907_005053
366 Ga0495608_0040494
367 Ga0495630_0370842
368 Ga0495587_0472583
369 Ga0495613_0286813
370 Ga0496100_0829473
371 Ga0496104_0191814
372 Ga0496108_0000227
373 Ga0496109_0132837
374 Ga0496109_0500748
375 Ga0496111_0070882
376 Ga0496114_0149854
377 Ga0496114_0811965
378 Ga0496114_0942971
379 Ga0501042_0710107
380 Ga0501048_0895002
381 Ga0501070_0561720
382 Ga0501074_0246038
383 Ga0501080_1290480
384 nmdc:mga03683_242506_c1
385 nmdc:mga03n38_375030_c1
386 nmdc:mga03n38_396761_c1
387 nmdc:mga03n38_6219_c1
388 nmdc:mga00v17_23473_c1
389 nmdc:mga00v17_257053_c1
390 nmdc:mga00v17_291723_c1
391 nmdc:mga00v17_7716_c1
392 nmdc:mga0yw44_122707_c1
393 nmdc:mga0yw44_363413_c1
394 nmdc:mga0yw44_397071_c1
395 nmdc:mga0yw44_671673_c1
396 nmdc:mga06z11_188436_c1
397 nmdc:mga06z11_227360_c1
398 nmdc:mga06z11_453894_c1
399 nmdc:mga04h51_56392_c1
400 nmdc:mga05p37_198030_c1
401 nmdc:mga09592_97525_c1
402 nmdc:mga0qj67_24346_c1
403 nmdc:mga08y16_135071_c1
404 Ga0500644_0000050
405 Ga0500646_0301450
406 Ga0500568_0274700
407 2623587948
408 2772643573
409 2855675261
410 2855680545
411 2855687449
412 2857295567
413 2858851299
414 2858883395
415 2858890903
416 2858899425
417 2867319182
418 2867320185
419 2869054461
420 2869062066
421 2869074784
422 2873315743
423 2880492122
424 2880500173
425 2929228726
426 8054707073
427 8054728644
428 8054739642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

45

135

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8834 30 92
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.8829 18 115
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.877 18 111
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8713 35 91
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8693 30 92
ID Description Score Start End Superfamily
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9198 22 113 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9184 19 157 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8904 22 113 1.10.10.10
af_A0A0P0Y293_209_294_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8902 57 91 1.10.10.10
2hoeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8862 45 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A542S6Q6-F1-model_v4 HxlR family transcriptional regulator 0.9868 6 160 GO:0003677
AF-A0A2W2DPY8-F1-model_v4 Transcriptional regulator 0.9862 8 146 GO:0003677
AF-A0A6L7F0N4-F1-model_v4 Transcriptional regulator 0.9849 25 157 GO:0003677
AF-A0A1H4JNF7-F1-model_v4 DNA-binding transcriptional regulator, HxlR family 0.9803 8 160 GO:0003677
AF-A0A4Q2S9X7-F1-model_v4 Transcriptional regulator 0.9788 8 160 GO:0003677

Map