F325219

General Info

Members Datasets Scaffolds Average Seq Length
214 150 428 94

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10935339|Ga0157377_109353392
Length 112
Sequence VTFVVRSASFGFVVRRWGDAAMCLGVPGLVVEVDELTALVDFWGVRRRVRLDLVDEPVAIGDYVLNHVGFAIRRIPPGDVEGTLALYEQLLREAGPSDLMAADVRGEVAAAP

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
57 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
91 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.55
Nodule 0
Rhizoplane 1.4
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10935339 3300014745 Unclassified 651
2 JGI24751J29686_10076912 3300002459 Unclassified 690
3 Ga0065715_11131431 3300005293 Unclassified 513
4 Ga0070658_11448236 3300005327 Bacteria 596
5 Ga0070676_10530089 3300005328 Bacteria 840
6 Ga0070676_10765618 3300005328 Bacteria 710
7 Ga0070670_100064506 3300005331 Bacteria 3143
8 Ga0070677_10011356 3300005333 Bacteria 3070
9 Ga0068869_100194867 3300005334 Bacteria 1595
10 Ga0070666_10097688 3300005335 Bacteria 2022
11 Ga0070666_11283775 3300005335 Unclassified 546
12 Ga0070689_101530754 3300005340 Bacteria 604
13 Ga0070668_101578786 3300005347 Bacteria 601
14 Ga0070668_101656444 3300005347 Bacteria 587
15 Ga0070668_101830958 3300005347 Bacteria 558
16 Ga0070669_100055376 3300005353 Bacteria 2906
17 Ga0070669_101726392 3300005353 Bacteria 546
18 Ga0070675_100127429 3300005354 Bacteria 2167
19 Ga0070675_100291771 3300005354 Bacteria 1435
20 Ga0070671_100020235 3300005355 Bacteria 5425
21 Ga0070673_100034551 3300005364 Bacteria 3827
22 Ga0070673_100491392 3300005364 Bacteria 1109
23 Ga0070688_100134343 3300005365 Unclassified 1673
24 Ga0070667_100309411 3300005367 Bacteria 1424
25 Ga0070701_10951943 3300005438 Bacteria 596
26 Ga0070711_101649639 3300005439 Bacteria 561
27 Ga0070705_100372658 3300005440 Bacteria 1048
28 Ga0070705_100627501 3300005440 Bacteria 835
29 Ga0070700_100844800 3300005441 Bacteria 741
30 Ga0070708_100345409 3300005445 Bacteria 1402
31 Ga0068867_100140883 3300005459 Bacteria 1885
32 Ga0068867_100301841 3300005459 Bacteria 1320
33 Ga0068867_100576142 3300005459 Bacteria 978
34 Ga0068853_100893339 3300005539 Bacteria 853
35 Ga0070672_100205705 3300005543 Bacteria 1647
36 Ga0070672_100317074 3300005543 Bacteria 1325
37 Ga0070686_100203675 3300005544 Bacteria 1420
38 Ga0070686_100307834 3300005544 Bacteria 1177
39 Ga0070696_100161239 3300005546 Bacteria 1652
40 Ga0070664_100827836 3300005564 Bacteria 866
41 Ga0070664_101879839 3300005564 Bacteria 568
42 Ga0068854_100019334 3300005578 Bacteria 4589
43 Ga0068859_100286151 3300005617 Bacteria 1741
44 Ga0068859_101005725 3300005617 Bacteria 916
45 Ga0068861_102034811 3300005719 Unclassified 573
46 Ga0068861_102438111 3300005719 Bacteria 526
47 Ga0068863_100159384 3300005841 Bacteria 2161
48 Ga0068858_100277680 3300005842 Bacteria 1595
49 Ga0068858_101795485 3300005842 Bacteria 606
50 Ga0068860_100118457 3300005843 Bacteria 2535
51 Ga0068862_100073390 3300005844 Bacteria 2957
52 Ga0068862_101683391 3300005844 Bacteria 642
53 Ga0081455_10531581 3300005937 Bacteria 782
54 Ga0075365_11272533 3300006038 Bacteria 517
55 Ga0075368_10062484 3300006042 Bacteria 1493
56 Ga0075368_10346864 3300006042 Bacteria 646
57 Ga0075368_10353245 3300006042 Unclassified 640
58 Ga0075364_10001990 3300006051 Bacteria 11385
59 Ga0075364_10136085 3300006051 Bacteria 1650
60 Ga0075364_10305382 3300006051 Bacteria 1083
61 Ga0075362_10023691 3300006177 Bacteria 2599
62 Ga0075362_10614729 3300006177 Bacteria 562
63 Ga0075367_10003734 3300006178 Bacteria 7325
64 Ga0075367_10004021 3300006178 Bacteria 7109
65 Ga0075367_10411107 3300006178 Bacteria 856
66 Ga0075366_10008268 3300006195 Bacteria 5777
67 Ga0075366_10076059 3300006195 Bacteria 2003
68 Ga0075428_101146875 3300006844 Unclassified 820
69 Ga0075431_101806640 3300006847 Unclassified 567
70 Ga0075433_11299950 3300006852 Unclassified 630
71 Ga0075434_100158376 3300006871 Bacteria 2284
72 Ga0075434_100211564 3300006871 Bacteria 1959
73 Ga0075429_100113082 3300006880 Bacteria 2373
74 Ga0075429_100740712 3300006880 Bacteria 861
75 Ga0075429_101920858 3300006880 Unclassified 513
76 Ga0068865_102012793 3300006881 Bacteria 524
77 Ga0097620_100286156 3300006931 Bacteria 1741
78 Ga0097620_101005754 3300006931 Bacteria 916
79 Ga0075435_100252157 3300007076 Bacteria 1502
80 Ga0105244_10176797 3300009036 Unclassified 1014
81 Ga0111539_10253668 3300009094 Bacteria 2048
82 Ga0111539_12572415 3300009094 Bacteria 590
83 Ga0111539_13514391 3300009094 Bacteria 503
84 Ga0105242_10261699 3300009176 Bacteria 1563
85 Ga0105248_10348287 3300009177 Bacteria 1668
86 Ga0105248_10611445 3300009177 Bacteria 1230
87 Ga0105248_11994772 3300009177 Bacteria 659
88 Ga0105248_12319618 3300009177 Archaea 611
89 Ga0105249_11557982 3300009553 Bacteria 733
90 Ga0157325_1013970 3300012485 Bacteria 639
91 Ga0157313_1019951 3300012503 Bacteria 674
92 Ga0157378_10195148 3300013297 Bacteria 1912
93 Ga0157375_10000022 3300013308 Bacteria 239765
94 Ga0157375_10692577 3300013308 Bacteria 1173
95 Ga0157377_10679797 3300014745 Bacteria 745
96 Ga0207705_11221637 3300025909 Bacteria 576
97 Ga0207650_10132630 3300025925 Unclassified 1951
98 Ga0207659_10000002 3300025926 Bacteria 619441
99 Ga0207686_11271592 3300025934 Unclassified 604
100 Ga0207670_10371233 3300025936 Bacteria 1137
101 Ga0207670_11249879 3300025936 Bacteria 629
102 Ga0207691_10342225 3300025940 Bacteria 1280
103 Ga0207691_10773496 3300025940 Bacteria 808
104 Ga0207711_11050940 3300025941 Bacteria 754
105 Ga0207689_10877371 3300025942 Bacteria 757
106 Ga0207679_11775627 3300025945 Bacteria 564
107 Ga0207651_10091058 3300025960 Bacteria 2232
108 Ga0207712_10998359 3300025961 Bacteria 743
109 Ga0207712_11976053 3300025961 Bacteria 522
110 Ga0207668_10562111 3300025972 Bacteria 990
111 Ga0207668_11909345 3300025972 Bacteria 535
112 Ga0207640_10125597 3300025981 Bacteria 1846
113 Ga0207658_11871054 3300025986 Bacteria 547
114 Ga0207677_10339363 3300026023 Bacteria 1255
115 Ga0207639_10681090 3300026041 Bacteria 953
116 Ga0207641_11470969 3300026088 Bacteria 683
117 Ga0207675_101153377 3300026118 Bacteria 795
118 Ga0207698_11644864 3300026142 Bacteria 657
119 Ga0209813_10027760 3300027866 Bacteria 1646
120 Ga0268265_10096984 3300028380 Bacteria 2371
121 Ga0268265_10812964 3300028380 Bacteria 912
122 Ga0268264_10236946 3300028381 Bacteria 1688
123 Ga0265330_10012087 3300031235 Bacteria 4037
124 Ga0265330_10089187 3300031235 Unclassified 1325
125 Ga0265328_10051551 3300031239 Unclassified 1511
126 Ga0265316_10031231 3300031344 Bacteria 4358
127 Ga0265314_10172246 3300031711 Bacteria 1305
128 Ga0265342_10059093 3300031712 Bacteria 2265
129 Ga0316583_10224088 3300032133 Bacteria 652
130 Ga0373930_0002258 3300034816 Bacteria 2970
131 Ga0373958_0001874 3300034819 Bacteria 2884
132 Ga0373959_0037126 3300034820 Bacteria 1008
133 Ga0373938_0001180 3300034957 Bacteria 4216
134 Ga0373928_0005196 3300035084 Bacteria 2484
135 Ga0373929_0000910 3300035085 Bacteria 5759
136 Ga0373949_0006830 3300035090 Bacteria 2506
137 Ga0373951_0017367 3300035091 Bacteria 1628
138 Ga0373952_0133170 3300035092 Unclassified 684
139 Ga0373932_0006327 3300035112 Bacteria 2800
140 Ga0373932_0205558 3300035112 Bacteria 702
141 Ga0373939_0015043 3300035114 Bacteria 2017
142 Ga0373941_0001730 3300035115 Bacteria 4691
143 Ga0373957_0335861 3300035120 Bacteria 644
144 Ga0373960_0003422 3300035121 Bacteria 3591
145 Ga0373942_0004047 3300035207 Bacteria 3420
146 Ga0373961_0002313 3300035241 Bacteria 4977
147 Ga0373962_0016299 3300035242 Bacteria 1915
148 Ga0373931_0005902 3300035691 Bacteria 5693
149 Ga0373935_0745965 3300035692 Bacteria 721
150 Ga0373933_0293660 3300035724 Unclassified 1051
151 Ga0373947_0643035 3300035725 Bacteria 723
152 Ga0373937_0633108 3300036401 Bacteria 1015
153 Ga0451839_0888557 3300041496 Archaea 570
154 Ga0439448_0132520 3300042005 Unclassified 860
155 Ga0439444_0010537 3300042437 Bacteria 1478
156 Ga0439460_0122354 3300042461 Bacteria 852
157 Ga0451577_0203418 3300042876 Bacteria 1787
158 Ga0451577_1329244 3300042876 Bacteria 639
159 Ga0439440_0052631 3300042993 Bacteria 1021
160 Ga0453683_0005076 3300044673 Bacteria 9236
161 Ga0453684_0000207 3300044712 Bacteria 256144
162 Ga0453684_0284743 3300044712 Bacteria 1883
163 Ga0451576_0001176 3300045051 Bacteria 46924
164 Ga0451576_0128270 3300045051 Bacteria 2643
165 Ga0451576_2225890 3300045051 Bacteria 562
166 Ga0495629_0612460 3300046459 Bacteria 728
167 Ga0495580_0289227 3300046472 Bacteria 1117
168 Ga0495580_0758316 3300046472 Bacteria 632
169 Ga0495582_0033643 3300046473 Bacteria 2818
170 Ga0495582_0358322 3300046473 Bacteria 840
171 Ga0495586_0265355 3300046535 Bacteria 981
172 Ga0495621_0523559 3300046539 Archaea 513
173 Ga0495647_0023676 3300046681 Bacteria 2229
174 Ga0495658_0014855 3300046683 Bacteria 3986
175 Ga0495658_0389536 3300046683 Bacteria 888
176 Ga0495581_0108094 3300047315 Bacteria 1617
177 Ga0496109_0454517 3300048912 Bacteria 1210
178 Ga0496111_1184648 3300048914 Unclassified 542
179 Ga0496112_0497946 3300048915 Bacteria 1154
180 Ga0501036_1045297 3300049572 Bacteria 668
181 Ga0501040_0622754 3300049576 Bacteria 780
182 Ga0501040_0694351 3300049576 Bacteria 736
183 Ga0501068_0605823 3300049584 Unclassified 714
184 Ga0501069_0144842 3300049585 Unclassified 1364
185 Ga0501069_0670102 3300049585 Bacteria 625
186 Ga0501071_0852333 3300049587 Archaea 703
187 Ga0501071_1568853 3300049587 Unclassified 508
188 Ga0501076_0785048 3300049592 Bacteria 786
189 Ga0501081_1267064 3300049743 Bacteria 559
190 Ga0501045_0036944 3300049824 Bacteria 3549
191 nmdc:mga03683_41091_c1 3300050489 Bacteria 1899
192 nmdc:mga03683_549562_c1 3300050489 Bacteria 562
193 nmdc:mga00v17_19380_c1 3300050491 Bacteria 3883
194 nmdc:mga00v17_358038_c1 3300050491 Bacteria 949
195 nmdc:mga0yw44_897031_c1 3300050492 Bacteria 601
196 nmdc:mga0yw44_962935_c1 3300050492 Bacteria 578
197 nmdc:mga0k408_29672_c1 3300050493 Bacteria 3115
198 nmdc:mga0k408_31454_c1 3300050493 Bacteria 3030
199 nmdc:mga06z11_164279_c1 3300050494 Bacteria 1271
200 nmdc:mga06z11_480783_c1 3300050494 Bacteria 752
201 nmdc:mga06z11_567935_c1 3300050494 Bacteria 689
202 nmdc:mga04h51_173414_c1 3300050495 Bacteria 836
203 nmdc:mga04h51_32956_c1 3300050495 Bacteria 1646
204 nmdc:mga07m45_82229_c1 3300050496 Bacteria 1839
205 nmdc:mga09592_17520_c1 3300050508 Bacteria 5869
206 nmdc:mga09592_876689_c1 3300050508 Archaea 755
207 nmdc:mga06r32_835429_c1 3300050510 Archaea 880
208 nmdc:mga08y16_177892_c1 3300050511 Bacteria 2209
209 nmdc:mga08y16_304076_c1 3300050511 Bacteria 1643
210 nmdc:mga0n895_2244907_c1 3300050512 Unclassified 501
211 nmdc:mga0rr50_639877_c1 3300050513 Unclassified 907
212 nmdc:mga0rr50_79531_c1 3300050513 Bacteria 2525
213 nmdc:mga0rr50_916395_c1 3300050513 Bacteria 747
214 Ga0495595_0621012 3300053084 Bacteria 553
215 Ga0157377_10935339
216 JGI24751J29686_10076912
217 Ga0065715_11131431
218 Ga0070658_11448236
219 Ga0070676_10530089
220 Ga0070676_10765618
221 Ga0070670_100064506
222 Ga0070677_10011356
223 Ga0068869_100194867
224 Ga0070666_10097688
225 Ga0070666_11283775
226 Ga0070689_101530754
227 Ga0070668_101578786
228 Ga0070668_101656444
229 Ga0070668_101830958
230 Ga0070669_100055376
231 Ga0070669_101726392
232 Ga0070675_100127429
233 Ga0070675_100291771
234 Ga0070671_100020235
235 Ga0070673_100034551
236 Ga0070673_100491392
237 Ga0070688_100134343
238 Ga0070667_100309411
239 Ga0070701_10951943
240 Ga0070711_101649639
241 Ga0070705_100372658
242 Ga0070705_100627501
243 Ga0070700_100844800
244 Ga0070708_100345409
245 Ga0068867_100140883
246 Ga0068867_100301841
247 Ga0068867_100576142
248 Ga0068853_100893339
249 Ga0070672_100205705
250 Ga0070672_100317074
251 Ga0070686_100203675
252 Ga0070686_100307834
253 Ga0070696_100161239
254 Ga0070664_100827836
255 Ga0070664_101879839
256 Ga0068854_100019334
257 Ga0068859_100286151
258 Ga0068859_101005725
259 Ga0068861_102034811
260 Ga0068861_102438111
261 Ga0068863_100159384
262 Ga0068858_100277680
263 Ga0068858_101795485
264 Ga0068860_100118457
265 Ga0068862_100073390
266 Ga0068862_101683391
267 Ga0081455_10531581
268 Ga0075365_11272533
269 Ga0075368_10062484
270 Ga0075368_10346864
271 Ga0075368_10353245
272 Ga0075364_10001990
273 Ga0075364_10136085
274 Ga0075364_10305382
275 Ga0075362_10023691
276 Ga0075362_10614729
277 Ga0075367_10003734
278 Ga0075367_10004021
279 Ga0075367_10411107
280 Ga0075366_10008268
281 Ga0075366_10076059
282 Ga0075428_101146875
283 Ga0075431_101806640
284 Ga0075433_11299950
285 Ga0075434_100158376
286 Ga0075434_100211564
287 Ga0075429_100113082
288 Ga0075429_100740712
289 Ga0075429_101920858
290 Ga0068865_102012793
291 Ga0097620_100286156
292 Ga0097620_101005754
293 Ga0075435_100252157
294 Ga0105244_10176797
295 Ga0111539_10253668
296 Ga0111539_12572415
297 Ga0111539_13514391
298 Ga0105242_10261699
299 Ga0105248_10348287
300 Ga0105248_10611445
301 Ga0105248_11994772
302 Ga0105248_12319618
303 Ga0105249_11557982
304 Ga0157325_1013970
305 Ga0157313_1019951
306 Ga0157378_10195148
307 Ga0157375_10000022
308 Ga0157375_10692577
309 Ga0157377_10679797
310 Ga0207705_11221637
311 Ga0207650_10132630
312 Ga0207659_10000002
313 Ga0207686_11271592
314 Ga0207670_10371233
315 Ga0207670_11249879
316 Ga0207691_10342225
317 Ga0207691_10773496
318 Ga0207711_11050940
319 Ga0207689_10877371
320 Ga0207679_11775627
321 Ga0207651_10091058
322 Ga0207712_10998359
323 Ga0207712_11976053
324 Ga0207668_10562111
325 Ga0207668_11909345
326 Ga0207640_10125597
327 Ga0207658_11871054
328 Ga0207677_10339363
329 Ga0207639_10681090
330 Ga0207641_11470969
331 Ga0207675_101153377
332 Ga0207698_11644864
333 Ga0209813_10027760
334 Ga0268265_10096984
335 Ga0268265_10812964
336 Ga0268264_10236946
337 Ga0265330_10012087
338 Ga0265330_10089187
339 Ga0265328_10051551
340 Ga0265316_10031231
341 Ga0265314_10172246
342 Ga0265342_10059093
343 Ga0316583_10224088
344 Ga0373930_0002258
345 Ga0373958_0001874
346 Ga0373959_0037126
347 Ga0373938_0001180
348 Ga0373928_0005196
349 Ga0373929_0000910
350 Ga0373949_0006830
351 Ga0373951_0017367
352 Ga0373952_0133170
353 Ga0373932_0006327
354 Ga0373932_0205558
355 Ga0373939_0015043
356 Ga0373941_0001730
357 Ga0373957_0335861
358 Ga0373960_0003422
359 Ga0373942_0004047
360 Ga0373961_0002313
361 Ga0373962_0016299
362 Ga0373931_0005902
363 Ga0373935_0745965
364 Ga0373933_0293660
365 Ga0373947_0643035
366 Ga0373937_0633108
367 Ga0451839_0888557
368 Ga0439448_0132520
369 Ga0439444_0010537
370 Ga0439460_0122354
371 Ga0451577_0203418
372 Ga0451577_1329244
373 Ga0439440_0052631
374 Ga0453683_0005076
375 Ga0453684_0000207
376 Ga0453684_0284743
377 Ga0451576_0001176
378 Ga0451576_0128270
379 Ga0451576_2225890
380 Ga0495629_0612460
381 Ga0495580_0289227
382 Ga0495580_0758316
383 Ga0495582_0033643
384 Ga0495582_0358322
385 Ga0495586_0265355
386 Ga0495621_0523559
387 Ga0495647_0023676
388 Ga0495658_0014855
389 Ga0495658_0389536
390 Ga0495581_0108094
391 Ga0496109_0454517
392 Ga0496111_1184648
393 Ga0496112_0497946
394 Ga0501036_1045297
395 Ga0501040_0622754
396 Ga0501040_0694351
397 Ga0501068_0605823
398 Ga0501069_0144842
399 Ga0501069_0670102
400 Ga0501071_0852333
401 Ga0501071_1568853
402 Ga0501076_0785048
403 Ga0501081_1267064
404 Ga0501045_0036944
405 nmdc:mga03683_41091_c1
406 nmdc:mga03683_549562_c1
407 nmdc:mga00v17_19380_c1
408 nmdc:mga00v17_358038_c1
409 nmdc:mga0yw44_897031_c1
410 nmdc:mga0yw44_962935_c1
411 nmdc:mga0k408_29672_c1
412 nmdc:mga0k408_31454_c1
413 nmdc:mga06z11_164279_c1
414 nmdc:mga06z11_480783_c1
415 nmdc:mga06z11_567935_c1
416 nmdc:mga04h51_173414_c1
417 nmdc:mga04h51_32956_c1
418 nmdc:mga07m45_82229_c1
419 nmdc:mga09592_17520_c1
420 nmdc:mga09592_876689_c1
421 nmdc:mga06r32_835429_c1
422 nmdc:mga08y16_177892_c1
423 nmdc:mga08y16_304076_c1
424 nmdc:mga0n895_2244907_c1
425 nmdc:mga0rr50_639877_c1
426 nmdc:mga0rr50_79531_c1
427 nmdc:mga0rr50_916395_c1
428 Ga0495595_0621012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01455

HupF_HypC

HupF/HypC family

22

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.9283 3 55
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.9117 3 55
5xgg-assembly1.cif.gz_A crystal structure c-terminal sh3 domain of myosin ib from entamoeba histolytica 0.8752 7 29
1fvi-assembly1.cif.gz_A crystal structure of chlorella virus dna ligase-adenylate 0.8695 6 29
5xgg-assembly6.cif.gz_F crystal structure c-terminal sh3 domain of myosin ib from entamoeba histolytica 0.8686 7 29
ID Description Score Start End Superfamily
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.9283 3 55 2.30.30.140
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.9117 3 55 2.30.30.140
af_Q4DRB6_1_65_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9067 7 29 2.30.30.40
af_F1R3C5_1123_1199_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.878 7 29 2.30.30.140
af_Q9BXT8_1202_1289_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8722 7 29 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A3A6PUE3-F1-model_v4 HypC/HybG/HupF family hydrogenase formation chaperone 0.9853 1 69 GO:0005506
GO:0051604
GO:1902670
AF-A0A2K3ADN7-F1-model_v4 deleted 0.9752 1 70
AF-A0A2H5Y4V4-F1-model_v4 Hydrogenase isoenzymes formation protein HypC 0.9666 1 91 GO:0005506
GO:0051604
GO:1902670
AF-A0A2H5Y4V4-F1-model_v4 Hydrogenase isoenzymes formation protein HypC 0.9564 1 91 GO:0005506
GO:0051604
GO:1902670
AF-A0A6B0T6V6-F1-model_v4 HypC/HybG/HupF family hydrogenase formation chaperone 0.9545 1 81 GO:0005506
GO:0051604
GO:1902670

Map