F325194

General Info

Members Datasets Scaffolds Average Seq Length
214 150 160 254

Family's Representative Sequence

Representative Sequence 3300013250|Ga0171462_1002|Ga0171462_1002427
Length 295
Sequence MPSSNTAQQQVGSVDAASPPRSVWWNAVSRSVEPDTKFEGERMELTDASALVTGGASGLGLATARRLAAAGAVVTVVDLATSAGVDVAAELGGSFAPADVTDPQQVADAVAAAAASRPLRVVVNCAGIAPPAKVLDREGNPSPLDAFERIIRVNLIGTYNVISQASAVIAKTEPTSAGDRGVIVNTASVAAFDGQIGQPAYSASKGGVHAMTLPIARELARYGIRVVTIAPGIMETPMLAGLPEAAQESLGQQVPYPQRLGKPDEYARLVMSIVDNGYLNGETIRLDGAIRMAPK

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221597 Microbacterium sp. Root180 Isolate Unclassified
7 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
8 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
9 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
10 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
11 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
12 2773857759 Microbacterium sp. 1294 Isolate Unclassified
13 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
14 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
15 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
16 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
17 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
18 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
19 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
20 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
21 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
22 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
23 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
24 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
25 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
26 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
27 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
28 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
29 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
30 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
31 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
32 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
33 2919069694 Microbacterium sp. 1154 Isolate Unclassified
34 2919395869 Microbacterium resistens 2980 Isolate Unclassified
35 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
36 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
37 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
38 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
39 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
40 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
41 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
42 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
43 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
44 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
45 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
46 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
47 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
48 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
148 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
149 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
150 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.83
Metatranscriptomes 0.93
Isolates 25.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 10.75
Rhizosphere 54.21
Stem 0
Stem Tuber 0
Unclassified 29.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002926 3300001979 Bacteria 7600
2 Ga0006562J51391_1074255 3300003578 Bacteria 8247
3 Ga0006562J51391_1074256 3300003578 Bacteria 8760
4 Ga0070660_100002855 3300005339 Bacteria 11894
5 Ga0070660_100044673 3300005339 Bacteria 3390
6 Ga0070661_100007165 3300005344 Bacteria 7686
7 Ga0070659_100010981 3300005366 Bacteria 6687
8 Ga0070663_100006071 3300005455 Bacteria 7227
9 Ga0070662_100038818 3300005457 Bacteria 3384
10 Ga0070665_100515750 3300005548 Bacteria 1207
11 Ga0070664_100016778 3300005564 Bacteria 6009
12 Ga0068857_100336925 3300005577 Bacteria 1395
13 Ga0075365_10010112 3300006038 Bacteria 5474
14 Ga0075365_10022564 3300006038 Bacteria 3946
15 Ga0075364_10007853 3300006051 Bacteria 6350
16 Ga0075364_10046152 3300006051 Bacteria 2836
17 Ga0075367_10081792 3300006178 Bacteria 1955
18 Ga0075369_10065872 3300006186 Bacteria 1588
19 Ga0105243_10010459 3300009148 Bacteria 7046
20 Ga0105243_10047190 3300009148 Bacteria 3390
21 Ga0105239_10016375 3300010375 Bacteria 8200
22 Ga0157369_10031191 3300013105 Bacteria 5873
23 Ga0157369_10770114 3300013105 Bacteria 989
24 Ga0171462_1002 3300013250 Bacteria 1052134
25 Ga0163162_10027329 3300013306 Bacteria 5642
26 Ga0157372_10059578 3300013307 Bacteria 4270
27 Ga0157372_10290052 3300013307 Bacteria 1903
28 Ga0209646_1000014 3300025246 Bacteria 550484
29 Ga0207647_10097199 3300025904 Bacteria 1751
30 Ga0207657_10033484 3300025919 Bacteria 4632
31 Ga0207649_10165803 3300025920 Bacteria 1535
32 Ga0207690_10004954 3300025932 Bacteria 7859
33 Ga0207690_10335271 3300025932 Bacteria 1192
34 Ga0207706_10011939 3300025933 Bacteria 7907
35 Ga0207709_10013866 3300025935 Bacteria 4449
36 Ga0207679_10136898 3300025945 Bacteria 1973
37 Ga0207678_10001805 3300026067 Bacteria 19601
38 Ga0207683_10587115 3300026121 Bacteria 1031
39 Ga0268266_10094391 3300028379 Bacteria 2626
40 Ga0316576_10011737 3300031727 Bacteria 5759
41 Ga0307405_10018290 3300031731 Bacteria 3863
42 Ga0307406_10000040 3300031901 Bacteria 76020
43 Ga0307406_10084348 3300031901 Bacteria 2121
44 Ga0307406_10568876 3300031901 Bacteria 930
45 Ga0307412_10669516 3300031911 Bacteria 887
46 Ga0307409_100195310 3300031995 Bacteria 1805
47 Ga0307409_100701584 3300031995 Bacteria 1011
48 Ga0307416_100285050 3300032002 Bacteria 1631
49 Ga0307416_100616147 3300032002 Bacteria 1167
50 Ga0307414_10165883 3300032004 Bacteria 1760
51 Ga0307415_100112504 3300032126 Bacteria 2023
52 Ga0316574_0005220 3300035398 Bacteria 6906
53 Ga0451791_0762630 3300041451 Bacteria 1197
54 Ga0451791_0874406 3300041451 Bacteria 1390
55 Ga0439464_0011886 3300042439 Bacteria 2312
56 Ga0466972_0024400 3300044658 Bacteria 3001
57 Ga0466970_0000279 3300044765 Bacteria 24873
58 Ga0466970_0018756 3300044765 Bacteria 3585
59 Ga0466958_0014376 3300045836 Bacteria 4521
60 Ga0495638_0148938 3300046460 Bacteria 1359
61 Ga0495620_0048322 3300046515 Bacteria 1827
62 Ga0495649_0065653 3300046694 Bacteria 1948
63 Ga0495686_0133347 3300047472 Bacteria 1471
64 Ga0496100_0229434 3300048903 Bacteria 1365
65 Ga0496101_0004461 3300048904 Bacteria 8821
66 Ga0496102_0136804 3300048905 Bacteria 2296
67 Ga0496104_0076151 3300048907 Bacteria 3195
68 Ga0496105_0032698 3300048908 Bacteria 4270
69 Ga0496105_0298006 3300048908 Bacteria 1297
70 Ga0496107_0010390 3300048910 Bacteria 6466
71 Ga0496108_0034952 3300048911 Bacteria 4176
72 Ga0496109_0064063 3300048912 Bacteria 3363
73 Ga0496110_0011699 3300048913 Bacteria 7197
74 Ga0496110_0126612 3300048913 Bacteria 2305
75 Ga0496111_0052889 3300048914 Bacteria 2933
76 Ga0496112_0570631 3300048915 Bacteria 1064
77 Ga0496114_0025381 3300048917 Bacteria 4843
78 Ga0496114_0072260 3300048917 Bacteria 2901
79 Ga0496114_0098244 3300048917 Bacteria 2496
80 Ga0496114_0107931 3300048917 Bacteria 2382
81 Ga0496114_0504004 3300048917 Bacteria 1071
82 Ga0496114_0523772 3300048917 Bacteria 1048
83 Ga0496114_0584074 3300048917 Bacteria 986
84 Ga0496115_0054251 3300048918 Bacteria 3218
85 Ga0496116_0015389 3300048919 Bacteria 6047
86 Ga0496117_0000014 3300048920 Bacteria 584427
87 Ga0496117_0099786 3300048920 Bacteria 1841
88 Ga0496118_0007937 3300048921 Bacteria 11103
89 Ga0496119_0000665 3300048922 Bacteria 46063
90 Ga0496119_0001350 3300048922 Bacteria 29989
91 Ga0496119_0003047 3300048922 Bacteria 17731
92 Ga0496119_0010900 3300048922 Bacteria 7594
93 Ga0496119_0052472 3300048922 Bacteria 2497
94 Ga0496120_0001067 3300048923 Bacteria 36237
95 Ga0496120_0001471 3300048923 Bacteria 28074
96 Ga0496120_0041161 3300048923 Bacteria 2709
97 Ga0496120_0132176 3300048923 Bacteria 1277
98 Ga0496122_0000358 3300048925 Bacteria 98103
99 Ga0496122_0068103 3300048925 Bacteria 2558
100 Ga0496123_0000280 3300048926 Bacteria 100544
101 Ga0496123_0002519 3300048926 Bacteria 22507
102 Ga0496124_0003514 3300048927 Bacteria 19087
103 Ga0496124_0004718 3300048927 Bacteria 15733
104 Ga0496124_0028302 3300048927 Bacteria 5016
105 Ga0496125_0000444 3300048928 Bacteria 75459
106 Ga0496125_0002789 3300048928 Bacteria 22086
107 Ga0496125_0043443 3300048928 Bacteria 3814
108 Ga0496126_0039447 3300048929 Bacteria 4381
109 Ga0496126_0049986 3300048929 Bacteria 3814
110 Ga0501031_0075977 3300049568 Bacteria 2187
111 Ga0501031_0175836 3300049568 Bacteria 1398
112 Ga0501032_0007783 3300049569 Bacteria 7814
113 Ga0501033_0001035 3300049570 Bacteria 25320
114 Ga0501033_0009990 3300049570 Bacteria 7287
115 Ga0501033_0030619 3300049570 Bacteria 4043
116 Ga0501034_0020040 3300049571 Bacteria 6831
117 Ga0501034_0081856 3300049571 Bacteria 3230
118 Ga0501034_0236358 3300049571 Bacteria 1775
119 Ga0501034_0310211 3300049571 Bacteria 1512
120 Ga0501036_0002127 3300049572 Bacteria 15452
121 Ga0501036_0075748 3300049572 Bacteria 2845
122 Ga0501037_0050461 3300049573 Bacteria 3044
123 Ga0501037_0272790 3300049573 Bacteria 1180
124 Ga0501037_0314559 3300049573 Bacteria 1085
125 Ga0501037_0500299 3300049573 Bacteria 824
126 Ga0501038_0008240 3300049574 Bacteria 9592
127 Ga0501038_0025252 3300049574 Bacteria 5297
128 Ga0501038_0086343 3300049574 Bacteria 2636
129 Ga0501039_0019444 3300049575 Bacteria 5207
130 Ga0501039_0023793 3300049575 Bacteria 4702
131 Ga0501043_0002323 3300049579 Bacteria 16101
132 Ga0501043_0178587 3300049579 Bacteria 1655
133 Ga0501046_0021263 3300049580 Bacteria 5356
134 Ga0501046_0117034 3300049580 Bacteria 2030
135 Ga0501047_0049608 3300049581 Bacteria 4053
136 Ga0501047_0241611 3300049581 Bacteria 1656
137 Ga0501047_0336082 3300049581 Bacteria 1348
138 Ga0501048_0017691 3300049582 Bacteria 5246
139 Ga0501068_0034417 3300049584 Bacteria 3021
140 Ga0501069_0063852 3300049585 Bacteria 2057
141 Ga0501070_0001598 3300049586 Bacteria 20102
142 Ga0501070_0017792 3300049586 Bacteria 5968
143 Ga0501070_0165872 3300049586 Bacteria 1820
144 Ga0501071_0151891 3300049587 Bacteria 1728
145 Ga0501073_0006081 3300049589 Bacteria 9005
146 Ga0501074_0011974 3300049590 Bacteria 6306
147 Ga0501080_0226759 3300049742 Bacteria 1708
148 Ga0501080_0522919 3300049742 Bacteria 1058
149 Ga0501035_0063577 3300049822 Bacteria 3282
150 Ga0501035_0199178 3300049822 Bacteria 1718
151 Ga0501044_0007531 3300049823 Bacteria 11973
152 Ga0501044_0037588 3300049823 Bacteria 5059
153 Ga0501044_0041712 3300049823 Bacteria 4777
154 Ga0501045_0311962 3300049824 Bacteria 1170
155 nmdc:mga00v17_26750_c1 3300050491 Bacteria 3364
156 nmdc:mga00v17_31662_c1 3300050491 Bacteria 3120
157 nmdc:mga00v17_49114_c1 3300050491 Bacteria 2559
158 nmdc:mga0yw44_13555_c1 3300050492 Bacteria 4297
159 nmdc:mga06z11_9626_c1 3300050494 Bacteria 4079
160 Ga0501084_0050227 3300054114 Bacteria 3491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0500299 Ga0501037_0500299_117_809 214
2 3300048927 Ga0496124_0028302 Ga0496124_0028302_882_1643 237
3 3300005339 Ga0070660_100002855 Ga0070660_10000285510 239
4 3300005344 Ga0070661_100007165 Ga0070661_1000071653 239
5 3300005366 Ga0070659_100010981 Ga0070659_1000109812 239
6 3300005455 Ga0070663_100006071 Ga0070663_1000060716 239
7 3300005457 Ga0070662_100038818 Ga0070662_1000388183 239
8 3300005564 Ga0070664_100016778 Ga0070664_1000167785 239
9 3300010375 Ga0105239_10016375 Ga0105239_100163754 239
10 3300025904 Ga0207647_10097199 Ga0207647_100971992 239
11 3300025919 Ga0207657_10033484 Ga0207657_100334845 239
12 3300025920 Ga0207649_10165803 Ga0207649_101658032 239
13 3300025932 Ga0207690_10004954 Ga0207690_100049543 239
14 3300025933 Ga0207706_10011939 Ga0207706_100119392 239
15 3300025945 Ga0207679_10136898 Ga0207679_101368982 239
16 3300026067 Ga0207678_10001805 Ga0207678_100018054 239
17 3300042439 Ga0439464_0011886 Ga0439464_0011886_1359_2123 239
18 iso_pu_bacteria 2857479173 2857479989 239
19 iso_pu_bacteria 2857632687 2857632911 239
20 iso_pu_bacteria 2870801768 2870803470 239
21 iso_pu_bacteria 2870804320 2870805468 239
22 3300005339 Ga0070660_100044673 Ga0070660_1000446732 240
23 3300005577 Ga0068857_100336925 Ga0068857_1003369252 240
24 3300025932 Ga0207690_10335271 Ga0207690_103352712 240
25 3300031995 Ga0307409_100195310 Ga0307409_1001953102 240
26 3300032002 Ga0307416_100285050 Ga0307416_1002850502 240
27 3300032126 Ga0307415_100112504 Ga0307415_1001125042 240
28 iso_pu_bacteria 2870628048 2870629147 240
29 iso_pu_bacteria 8004212874 8004213039 240
30 3300049571 Ga0501034_0236358 Ga0501034_0236358_24_782 241
31 iso_pu_bacteria 2643221542 2643732899 241
32 iso_pu_bacteria 2837651117 2837654671 241
33 iso_pu_bacteria 2857729791 2857731549 241
34 iso_pu_bacteria 2928121344 2928124553 241
35 iso_pu_bacteria 2939660829 2939661854 241
36 iso_pu_bacteria 8004182704 8004184108 241
37 3300013105 Ga0157369_10031191 Ga0157369_100311914 242
38 3300013307 Ga0157372_10290052 Ga0157372_102900523 242
39 3300032004 Ga0307414_10165883 Ga0307414_101658831 242
40 3300048917 Ga0496114_0072260 Ga0496114_0072260_1424_2185 242
41 iso_pu_bacteria 2585428157 2588107251 242
42 iso_pu_bacteria 2643221553 2643784771 242
43 iso_pu_bacteria 2643221566 2643846843 242
44 iso_pu_bacteria 2643221566 2643847110 242
45 iso_pu_bacteria 2643221575 2643887976 242
46 iso_pu_bacteria 2643221597 2643997059 242
47 iso_pu_bacteria 2643221724 2644681547 242
48 iso_pu_bacteria 2728369380 2730231049 242
49 iso_pu_bacteria 2747842429 2747955422 242
50 iso_pu_bacteria 2757320536 2758225632 242
51 iso_pu_bacteria 2773857758 2774379724 242
52 iso_pu_bacteria 2773857759 2774382095 242
53 iso_pu_bacteria 2773857763 2774397807 242
54 iso_pu_bacteria 2784132109 2784473053 242
55 iso_pu_bacteria 2808606306 2808629210 242
56 iso_pu_bacteria 2808606368 2808884019 242
57 iso_pu_bacteria 2808606447 2809228723 242
58 iso_pu_bacteria 2811994872 2812324872 242
59 iso_pu_bacteria 2821268502 2821271415 242
60 iso_pu_bacteria 2833709550 2833712637 242
61 iso_pu_bacteria 2852632344 2852633926 242
62 iso_pu_bacteria 2852646457 2852647930 242
63 iso_pu_bacteria 2857720070 2857721339 242
64 iso_pu_bacteria 2904509784 2904512518 242
65 iso_pu_bacteria 2908678064 2908679247 242
66 iso_pu_bacteria 2919069694 2919069886 242
67 iso_pu_bacteria 2919395869 2919397336 242
68 iso_pu_bacteria 2928090899 2928093027 242
69 iso_pu_bacteria 2945968032 2945969179 242
70 iso_pu_bacteria 2946033335 2946036017 242
71 iso_pu_bacteria 2946033335 2946036386 242
72 iso_pu_bacteria 2946041624 2946041630 242
73 iso_pu_bacteria 2946080515 2946083663 242
74 iso_pu_bacteria 2974294766 2974295934 242
75 iso_pu_bacteria 2974324384 2974327802 242
76 iso_pu_bacteria 2977228692 2977229439 242
77 iso_pu_bacteria 2977236895 2977238513 242
78 iso_pu_bacteria 2977251589 2977252261 242
79 iso_pu_bacteria 2977264416 2977264668 242
80 iso_pu_bacteria 2984542743 2984543708 242
81 iso_pu_bacteria 8016254467 8016256140 242
82 iso_pu_bacteria 8045830549 8045833527 242
83 3300009148 Ga0105243_10010459 Ga0105243_100104595 243
84 3300048922 Ga0496119_0052472 Ga0496119_0052472_180_950 243
85 3300006038 Ga0075365_10022564 Ga0075365_100225643 244
86 3300006051 Ga0075364_10007853 Ga0075364_100078537 244
87 3300048920 Ga0496117_0000014 Ga0496117_0000014_513491_514252 244
88 3300048922 Ga0496119_0010900 Ga0496119_0010900_1988_2749 244
89 3300048923 Ga0496120_0041161 Ga0496120_0041161_1082_1843 244
90 3300048925 Ga0496122_0068103 Ga0496122_0068103_1657_2418 244
91 3300048926 Ga0496123_0002519 Ga0496123_0002519_4231_4992 244
92 3300048927 Ga0496124_0003514 Ga0496124_0003514_17454_18215 244
93 3300048928 Ga0496125_0043443 Ga0496125_0043443_2273_3034 244
94 3300048929 Ga0496126_0049986 Ga0496126_0049986_1445_2206 244
95 3300050491 nmdc:mga00v17_49114_c1 nmdc:mga00v17_49114_c1_491_1279 244
96 3300050492 nmdc:mga0yw44_13555_c1 nmdc:mga0yw44_13555_c1_119_907 244
97 3300003578 Ga0006562J51391_1074255 Ga0006562J51391_10742556 245
98 3300003578 Ga0006562J51391_1074256 Ga0006562J51391_10742565 245
99 3300025246 Ga0209646_1000014 Ga0209646_1000014447 245
100 3300031727 Ga0316576_10011737 Ga0316576_100117371 245
101 3300035398 Ga0316574_0005220 Ga0316574_0005220_514_1281 245
102 3300048920 Ga0496117_0099786 Ga0496117_0099786_855_1634 245
103 3300048922 Ga0496119_0001350 Ga0496119_0001350_18013_18774 245
104 3300049568 Ga0501031_0075977 Ga0501031_0075977_177_962 245
105 3300049568 Ga0501031_0175836 Ga0501031_0175836_483_1268 245
106 3300049569 Ga0501032_0007783 Ga0501032_0007783_437_1222 245
107 3300049570 Ga0501033_0001035 Ga0501033_0001035_709_1494 245
108 3300049570 Ga0501033_0009990 Ga0501033_0009990_5840_6625 245
109 3300049570 Ga0501033_0030619 Ga0501033_0030619_3197_3982 245
110 3300049571 Ga0501034_0020040 Ga0501034_0020040_632_1417 245
111 3300049571 Ga0501034_0081856 Ga0501034_0081856_182_967 245
112 3300049571 Ga0501034_0310211 Ga0501034_0310211_80_865 245
113 3300049572 Ga0501036_0002127 Ga0501036_0002127_753_1538 245
114 3300049572 Ga0501036_0075748 Ga0501036_0075748_1544_2329 245
115 3300049573 Ga0501037_0050461 Ga0501037_0050461_2078_2863 245
116 3300049574 Ga0501038_0008240 Ga0501038_0008240_2820_3605 245
117 3300049575 Ga0501039_0019444 Ga0501039_0019444_513_1298 245
118 3300049575 Ga0501039_0023793 Ga0501039_0023793_3389_4174 245
119 3300049579 Ga0501043_0002323 Ga0501043_0002323_7281_8066 245
120 3300049580 Ga0501046_0021263 Ga0501046_0021263_4512_5297 245
121 3300049580 Ga0501046_0117034 Ga0501046_0117034_537_1322 245
122 3300049581 Ga0501047_0049608 Ga0501047_0049608_2013_2798 245
123 3300049581 Ga0501047_0241611 Ga0501047_0241611_514_1299 245
124 3300049581 Ga0501047_0336082 Ga0501047_0336082_551_1336 245
125 3300049582 Ga0501048_0017691 Ga0501048_0017691_3944_4729 245
126 3300049584 Ga0501068_0034417 Ga0501068_0034417_2205_2990 245
127 3300049585 Ga0501069_0063852 Ga0501069_0063852_799_1584 245
128 3300049586 Ga0501070_0017792 Ga0501070_0017792_1437_2222 245
129 3300049586 Ga0501070_0165872 Ga0501070_0165872_896_1681 245
130 3300049587 Ga0501071_0151891 Ga0501071_0151891_803_1588 245
131 3300049589 Ga0501073_0006081 Ga0501073_0006081_4098_4883 245
132 3300049590 Ga0501074_0011974 Ga0501074_0011974_5218_6003 245
133 3300049742 Ga0501080_0226759 Ga0501080_0226759_353_1138 245
134 3300049742 Ga0501080_0522919 Ga0501080_0522919_39_824 245
135 3300049822 Ga0501035_0063577 Ga0501035_0063577_2484_3269 245
136 3300049822 Ga0501035_0199178 Ga0501035_0199178_542_1327 245
137 3300049823 Ga0501044_0007531 Ga0501044_0007531_9855_10640 245
138 3300049823 Ga0501044_0037588 Ga0501044_0037588_837_1622 245
139 3300049823 Ga0501044_0041712 Ga0501044_0041712_3817_4602 245
140 3300049824 Ga0501045_0311962 Ga0501045_0311962_361_1146 245
141 3300054114 Ga0501084_0050227 Ga0501084_0050227_2428_3213 245
142 3300001979 JGI24740J21852_10002926 JGI24740J21852_100029264 246
143 3300005548 Ga0070665_100515750 Ga0070665_1005157501 246
144 3300006038 Ga0075365_10010112 Ga0075365_100101125 246
145 3300006051 Ga0075364_10046152 Ga0075364_100461522 246
146 3300006178 Ga0075367_10081792 Ga0075367_100817923 246
147 3300006186 Ga0075369_10065872 Ga0075369_100658723 246
148 3300009148 Ga0105243_10047190 Ga0105243_100471904 246
149 3300013105 Ga0157369_10770114 Ga0157369_107701141 246
150 3300013250 Ga0171462_1002 Ga0171462_1002427 246
151 3300013306 Ga0163162_10027329 Ga0163162_100273292 246
152 3300013307 Ga0157372_10059578 Ga0157372_100595785 246
153 3300025935 Ga0207709_10013866 Ga0207709_100138663 246
154 3300026121 Ga0207683_10587115 Ga0207683_105871151 246
155 3300028379 Ga0268266_10094391 Ga0268266_100943912 246
156 3300031731 Ga0307405_10018290 Ga0307405_100182903 246
157 3300031901 Ga0307406_10000040 Ga0307406_1000004060 246
158 3300031901 Ga0307406_10084348 Ga0307406_100843482 246
159 3300031901 Ga0307406_10568876 Ga0307406_105688761 246
160 3300031911 Ga0307412_10669516 Ga0307412_106695161 246
161 3300031995 Ga0307409_100701584 Ga0307409_1007015841 246
162 3300032002 Ga0307416_100616147 Ga0307416_1006161471 246
163 3300041451 Ga0451791_0762630 Ga0451791_0762630_278_1093 246
164 3300041451 Ga0451791_0874406 Ga0451791_0874406_444_1208 246
165 3300044658 Ga0466972_0024400 Ga0466972_0024400_1657_2418 246
166 3300044765 Ga0466970_0000279 Ga0466970_0000279_5206_5967 246
167 3300044765 Ga0466970_0018756 Ga0466970_0018756_1916_2677 246
168 3300045836 Ga0466958_0014376 Ga0466958_0014376_3416_4177 246
169 3300046460 Ga0495638_0148938 Ga0495638_0148938_198_962 246
170 3300046515 Ga0495620_0048322 Ga0495620_0048322_860_1654 246
171 3300046694 Ga0495649_0065653 Ga0495649_0065653_706_1500 246
172 3300047472 Ga0495686_0133347 Ga0495686_0133347_127_891 246
173 3300048903 Ga0496100_0229434 Ga0496100_0229434_171_932 246
174 3300048904 Ga0496101_0004461 Ga0496101_0004461_7891_8652 246
175 3300048905 Ga0496102_0136804 Ga0496102_0136804_280_1041 246
176 3300048907 Ga0496104_0076151 Ga0496104_0076151_1095_1856 246
177 3300048908 Ga0496105_0032698 Ga0496105_0032698_1280_2041 246
178 3300048908 Ga0496105_0298006 Ga0496105_0298006_424_1185 246
179 3300048910 Ga0496107_0010390 Ga0496107_0010390_2277_3038 246
180 3300048911 Ga0496108_0034952 Ga0496108_0034952_525_1286 246
181 3300048912 Ga0496109_0064063 Ga0496109_0064063_1685_2446 246
182 3300048913 Ga0496110_0011699 Ga0496110_0011699_279_1040 246
183 3300048913 Ga0496110_0126612 Ga0496110_0126612_1181_1942 246
184 3300048914 Ga0496111_0052889 Ga0496111_0052889_2135_2896 246
185 3300048915 Ga0496112_0570631 Ga0496112_0570631_171_932 246
186 3300048917 Ga0496114_0025381 Ga0496114_0025381_718_1479 246
187 3300048917 Ga0496114_0098244 Ga0496114_0098244_846_1607 246
188 3300048917 Ga0496114_0107931 Ga0496114_0107931_1597_2358 246
189 3300048917 Ga0496114_0504004 Ga0496114_0504004_175_936 246
190 3300048917 Ga0496114_0523772 Ga0496114_0523772_41_802 246
191 3300048917 Ga0496114_0584074 Ga0496114_0584074_23_784 246
192 3300048918 Ga0496115_0054251 Ga0496115_0054251_19_780 246
193 3300048919 Ga0496116_0015389 Ga0496116_0015389_4464_5225 246
194 3300048921 Ga0496118_0007937 Ga0496118_0007937_6203_6964 246
195 3300048922 Ga0496119_0000665 Ga0496119_0000665_37513_38274 246
196 3300048922 Ga0496119_0003047 Ga0496119_0003047_10982_11743 246
197 3300048923 Ga0496120_0001067 Ga0496120_0001067_29931_30692 246
198 3300048923 Ga0496120_0001471 Ga0496120_0001471_3254_4015 246
199 3300048923 Ga0496120_0132176 Ga0496120_0132176_447_1208 246
200 3300048925 Ga0496122_0000358 Ga0496122_0000358_93229_93990 246
201 3300048926 Ga0496123_0000280 Ga0496123_0000280_93282_94043 246
202 3300048927 Ga0496124_0004718 Ga0496124_0004718_7559_8320 246
203 3300048928 Ga0496125_0000444 Ga0496125_0000444_51000_51854 246
204 3300048928 Ga0496125_0002789 Ga0496125_0002789_15001_15762 246
205 3300048929 Ga0496126_0039447 Ga0496126_0039447_903_1664 246
206 3300049573 Ga0501037_0272790 Ga0501037_0272790_377_1138 246
207 3300049573 Ga0501037_0314559 Ga0501037_0314559_61_822 246
208 3300049574 Ga0501038_0025252 Ga0501038_0025252_1266_2027 246
209 3300049574 Ga0501038_0086343 Ga0501038_0086343_1641_2402 246
210 3300049579 Ga0501043_0178587 Ga0501043_0178587_29_790 246
211 3300049586 Ga0501070_0001598 Ga0501070_0001598_10646_11455 246
212 3300050491 nmdc:mga00v17_26750_c1 nmdc:mga00v17_26750_c1_25_807 246
213 3300050491 nmdc:mga00v17_31662_c1 nmdc:mga00v17_31662_c1_946_1707 246
214 3300050494 nmdc:mga06z11_9626_c1 nmdc:mga06z11_9626_c1_3043_3837 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

290

0.92

PF00106

adh_short

short chain dehydrogenase

48

247

0.9

PF08659

KR

KR domain

48

236

0.78

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

50

192

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u7t-assembly1.cif.gz_B crystal structure of abad/hsd10 with a bound inhibitor 0.9586 3 245
4pn3-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.9504 1 246
4o5o-assembly1.cif.gz_B-2 x-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis 0.9496 1 246
7n09-assembly1.cif.gz_A structural basis for branched substrate selectivity in a ketoreductase from ascaris suum 0.9482 1 243
4pn3-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.9467 1 246
ID Description Score Start End Superfamily
af_Q99714_1_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9587 1 245 3.40.50.720
af_Q86JE3_1_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9543 1 244 3.40.50.720
af_Q99714_1_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 1 245 3.40.50.720
af_Q86JE3_1_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 1 244 3.40.50.720
af_A4I111_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 1 246 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5F8HDQ4-F1-model_v4 17beta-estradiol 17-dehydrogenase (EC 1.1.1.62) 0.9665 1 243 GO:0000049
GO:0003857
GO:0004303
GO:0005739
GO:0006550
GO:0006631
GO:0006635
GO:0006699
GO:0007005
GO:0008207
GO:0008209
GO:0008210
GO:0008709
GO:0030678
GO:0042645
GO:0043527
GO:0044594
GO:0047015
GO:0047035
GO:0051289
GO:0062173
GO:0070901
GO:0097745
GO:0106281
GO:0106282
GO:0106283
GO:1990180
AF-A0A811W4E8-F1-model_v4 deleted 0.9661 5 242
AF-A0A0P1G9T7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.9651 1 243 GO:0004316
AF-A0A4W2FPB2-F1-model_v4 17beta-estradiol 17-dehydrogenase (EC 1.1.1.62) 0.9647 3 245 GO:0000049
GO:0003857
GO:0004303
GO:0006550
GO:0006635
GO:0006699
GO:0007005
GO:0008207
GO:0008209
GO:0008210
GO:0008709
GO:0030678
GO:0042645
GO:0043527
GO:0044594
GO:0047015
GO:0047035
GO:0051289
GO:0062173
GO:0070901
GO:0097745
GO:0106281
GO:0106282
GO:0106283
GO:1990180
AF-A0A7I0KFY0-F1-model_v4 deleted 0.9646 98 222

Feature Viewer

pLDDT pTM Quality
90.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map