F325023

General Info

Members Datasets Scaffolds Average Seq Length
214 155 428 240

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100018082|Ga0068860_1000180827
Length 267
Sequence VHLRDVGALGPCYVTRGPQAPKAGATDVGRIFETRKATMFARWNKMAKAFTRVSREIAMAVKSGGTNPDSNPQLRRAIQNARAANMPKDKVEGAIQRASGQGGESYETVIYEGYAPHGVAVLVETATDNVVRTVANVRMHFKNNGGNMGNSGSVGFLFKRMGVFRLNPEGIDQDALELELIDHGLQEMGESTGEKGEKQIVIRCDFPDFGNLQHAIEAKGLTPVAVNSEYIPLNPMELPEDKATEVLKLVDALEQDDDVQRVFHTLG

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
80 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
81 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 1.4
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100018082 3300005843 Bacteria 6865
2 Ga0070670_100006120 3300005331 Bacteria 10173
3 Ga0070666_10127882 3300005335 Bacteria 1764
4 Ga0070682_100028752 3300005337 Bacteria 3345
5 Ga0068868_100063546 3300005338 Bacteria 2928
6 Ga0070689_100029613 3300005340 Bacteria 4146
7 Ga0070689_100215303 3300005340 Bacteria 1574
8 Ga0070687_100017485 3300005343 Bacteria 3298
9 Ga0070687_100356442 3300005343 Bacteria 946
10 Ga0070661_100043167 3300005344 Bacteria 3294
11 Ga0070661_100217000 3300005344 Bacteria 1466
12 Ga0070675_100260445 3300005354 Bacteria 1520
13 Ga0070688_100006498 3300005365 Bacteria 6251
14 Ga0070688_100008446 3300005365 Bacteria 5589
15 Ga0070688_100173086 3300005365 Bacteria 1492
16 Ga0070713_100038606 3300005436 Bacteria 3870
17 Ga0070713_100108540 3300005436 Bacteria 2416
18 Ga0070710_10091857 3300005437 Bacteria 1792
19 Ga0070705_100196712 3300005440 Bacteria 1379
20 Ga0070705_100280278 3300005440 Bacteria 1185
21 Ga0070694_100200741 3300005444 Bacteria 1486
22 Ga0070681_10001021 3300005458 Bacteria 23710
23 Ga0070681_10020140 3300005458 Bacteria 6687
24 Ga0070685_10066626 3300005466 Bacteria 2122
25 Ga0070706_100235874 3300005467 Bacteria 1708
26 Ga0070707_100117897 3300005468 Bacteria 2577
27 Ga0070698_100027824 3300005471 Bacteria 5875
28 Ga0070697_100169337 3300005536 Bacteria 1848
29 Ga0070686_100034483 3300005544 Bacteria 3119
30 Ga0070686_100042449 3300005544 Bacteria 2849
31 Ga0070665_100000090 3300005548 Bacteria 175078
32 Ga0070704_100043389 3300005549 Bacteria 3117
33 Ga0068855_100008222 3300005563 Bacteria 12613
34 Ga0068855_100010697 3300005563 Bacteria 11072
35 Ga0068859_100025463 3300005617 Bacteria 5935
36 Ga0068859_100079521 3300005617 Bacteria 3319
37 Ga0068859_100082957 3300005617 Bacteria 3247
38 Ga0068864_100173159 3300005618 Bacteria 1969
39 Ga0068863_100569012 3300005841 Bacteria 1120
40 Ga0068858_100321028 3300005842 Bacteria 1480
41 Ga0068862_100001639 3300005844 Bacteria 20358
42 Ga0068862_100119720 3300005844 Bacteria 2319
43 Ga0068862_100794318 3300005844 Bacteria 924
44 Ga0070717_10003860 3300006028 Bacteria 10777
45 Ga0070717_10160147 3300006028 Bacteria 1952
46 Ga0097621_100300759 3300006237 Bacteria 1417
47 Ga0075428_100052827 3300006844 Bacteria 4452
48 Ga0075428_100066359 3300006844 Bacteria 3951
49 Ga0075428_100142670 3300006844 Bacteria 2604
50 Ga0075430_100430555 3300006846 Bacteria 1089
51 Ga0075434_100024174 3300006871 Bacteria 5937
52 Ga0075429_100160037 3300006880 Bacteria 1972
53 Ga0097620_100025462 3300006931 Bacteria 5935
54 Ga0097620_100079521 3300006931 Bacteria 3319
55 Ga0097620_100082956 3300006931 Bacteria 3247
56 Ga0105240_10003765 3300009093 Bacteria 23440
57 Ga0114129_10085073 3300009147 Bacteria 4388
58 Ga0114129_10489465 3300009147 Bacteria 1608
59 Ga0105248_10175549 3300009177 Bacteria 2415
60 Ga0105248_10368862 3300009177 Bacteria 1616
61 Ga0105237_10075955 3300009545 Bacteria 3350
62 Ga0105238_10000393 3300009551 Bacteria 46691
63 Ga0105238_10007939 3300009551 Bacteria 10616
64 Ga0105239_10200846 3300010375 Bacteria 2233
65 Ga0157370_10001131 3300013104 Bacteria 33342
66 Ga0157378_10006700 3300013297 Bacteria 10067
67 Ga0163162_10721742 3300013306 Bacteria 1117
68 Ga0157375_10279093 3300013308 Bacteria 1834
69 Ga0157380_10445849 3300014326 Bacteria 1241
70 Ga0157377_10055102 3300014745 Bacteria 2253
71 Ga0224712_10161949 3300022467 Bacteria 998
72 Ga0207680_10158457 3300025903 Bacteria 1515
73 Ga0207699_10063002 3300025906 Bacteria 2238
74 Ga0207684_10198669 3300025910 Bacteria 1730
75 Ga0207707_10000123 3300025912 Bacteria 80128
76 Ga0207707_10034618 3300025912 Bacteria 4419
77 Ga0207695_10030244 3300025913 Bacteria 5964
78 Ga0207671_10000195 3300025914 Bacteria 94152
79 Ga0207663_10133336 3300025916 Bacteria 1720
80 Ga0207662_10000881 3300025918 Bacteria 13899
81 Ga0207649_10181633 3300025920 Bacteria 1473
82 Ga0207652_10010542 3300025921 Bacteria 7439
83 Ga0207694_10011084 3300025924 Bacteria 6808
84 Ga0207650_10004646 3300025925 Bacteria 9392
85 Ga0207670_10001665 3300025936 Bacteria 11605
86 Ga0207670_10082543 3300025936 Bacteria 2253
87 Ga0207711_10101420 3300025941 Bacteria 2547
88 Ga0207667_10019939 3300025949 Bacteria 7471
89 Ga0207712_10534078 3300025961 Bacteria 1007
90 Ga0207712_10608589 3300025961 Bacteria 946
91 Ga0207702_10044293 3300026078 Bacteria 3740
92 Ga0207641_10708779 3300026088 Bacteria 991
93 Ga0207676_10130097 3300026095 Bacteria 2139
94 Ga0268266_10000375 3300028379 Bacteria 68332
95 Ga0268265_10003199 3300028380 Bacteria 11896
96 Ga0268265_10843970 3300028380 Bacteria 896
97 Ga0268264_10010237 3300028381 Bacteria 7762
98 Ga0265338_10013342 3300028800 Bacteria 9282
99 Ga0265338_10305767 3300028800 Bacteria 1155
100 Ga0265324_10085262 3300029957 Bacteria 1075
101 Ga0265320_10040987 3300031240 Bacteria 2305
102 Ga0265325_10222102 3300031241 Bacteria 864
103 Ga0265314_10043123 3300031711 Bacteria 3210
104 Ga0373929_0037663 3300035085 Bacteria 1061
105 Ga0373934_0003579 3300035086 Bacteria 5713
106 Ga0373951_0095435 3300035091 Bacteria 785
107 Ga0373952_0037738 3300035092 Bacteria 1104
108 Ga0373939_0015905 3300035114 Bacteria 1976
109 Ga0373953_0010643 3300035117 Bacteria 3208
110 Ga0373956_0055115 3300035119 Bacteria 1793
111 Ga0373956_0064474 3300035119 Bacteria 1663
112 Ga0373957_0038409 3300035120 Bacteria 1792
113 Ga0373957_0123608 3300035120 Bacteria 1049
114 Ga0373946_0093427 3300035171 Bacteria 1337
115 Ga0373955_0008412 3300035172 Bacteria 4791
116 Ga0373955_0205920 3300035172 Bacteria 1172
117 Ga0373961_0000054 3300035241 Bacteria 65935
118 Ga0373931_0522940 3300035691 Bacteria 768
119 Ga0373937_0650045 3300036401 Bacteria 1000
120 Ga0395900_0397564 3300037418 Bacteria 1343
121 Ga0395900_0503600 3300037418 Bacteria 1161
122 Ga0395898_0161998 3300037466 Bacteria 2140
123 Ga0436360_0967094 3300039438 Bacteria 908
124 Ga0451577_0011001 3300042876 Bacteria 8593
125 Ga0451577_0042465 3300042876 Bacteria 4078
126 Ga0451577_0101657 3300042876 Bacteria 2568
127 Ga0451577_0156180 3300042876 Bacteria 2053
128 Ga0451577_0392503 3300042876 Bacteria 1259
129 Ga0451577_0548914 3300042876 Bacteria 1049
130 Ga0466969_0026977 3300044656 Bacteria 2943
131 Ga0453683_0000502 3300044673 Bacteria 44773
132 Ga0466966_0001098 3300044684 Bacteria 17326
133 Ga0466961_0002046 3300044693 Bacteria 12555
134 Ga0453684_0001724 3300044712 Bacteria 58581
135 Ga0453684_0001974 3300044712 Bacteria 52622
136 Ga0453684_0029532 3300044712 Bacteria 7780
137 Ga0453684_0034978 3300044712 Bacteria 6955
138 Ga0453684_0204469 3300044712 Bacteria 2299
139 Ga0453684_0208635 3300044712 Bacteria 2272
140 Ga0453684_0237300 3300044712 Bacteria 2101
141 Ga0453684_0427490 3300044712 Bacteria 1478
142 Ga0453684_0484441 3300044712 Bacteria 1372
143 Ga0453684_0684010 3300044712 Bacteria 1116
144 Ga0453684_0710511 3300044712 Bacteria 1091
145 Ga0453684_1189408 3300044712 Bacteria 801
146 Ga0466971_0034237 3300044719 Bacteria 2276
147 Ga0466970_0000713 3300044765 Bacteria 16282
148 Ga0466970_0281242 3300044765 Bacteria 936
149 Ga0466959_0022523 3300045049 Unclassified 4658
150 Ga0451576_0014543 3300045051 Bacteria 8750
151 Ga0451576_0030927 3300045051 Bacteria 5712
152 Ga0451576_0069449 3300045051 Bacteria 3666
153 Ga0451576_0071962 3300045051 Bacteria 3598
154 Ga0451576_0165526 3300045051 Bacteria 2307
155 Ga0495592_0050801 3300046454 Bacteria 3080
156 Ga0495651_0133319 3300046462 Bacteria 1811
157 Ga0495653_0367020 3300046463 Bacteria 922
158 Ga0495608_0006021 3300046511 Bacteria 8620
159 Ga0495618_0000702 3300046514 Bacteria 23319
160 Ga0495628_0008167 3300046516 Bacteria 9002
161 Ga0495628_0041220 3300046516 Bacteria 3686
162 Ga0495630_0012016 3300046517 Bacteria 6280
163 Ga0495586_0066552 3300046535 Bacteria 1964
164 Ga0495586_0125119 3300046535 Bacteria 1438
165 Ga0495587_0003698 3300046536 Bacteria 10172
166 Ga0495667_0067208 3300046559 Bacteria 2342
167 Ga0495634_0092129 3300046642 Bacteria 1967
168 Ga0495634_0230753 3300046642 Bacteria 1139
169 Ga0495657_0009087 3300046675 Bacteria 7553
170 Ga0495599_0031319 3300046678 Bacteria 3338
171 Ga0495600_0152579 3300046809 Bacteria 1495
172 Ga0495604_0350167 3300047317 Bacteria 981
173 Ga0495636_0031496 3300047318 Bacteria 2174
174 Ga0495674_0022883 3300047319 Bacteria 5758
175 Ga0495680_0014398 3300047322 Bacteria 6851
176 Ga0495687_107214 3300047443 Bacteria 1035
177 Ga0495675_0010880 3300047444 Bacteria 5701
178 Ga0495615_0038928 3300048090 Bacteria 1177
179 Ga0496102_0549880 3300048905 Bacteria 1077
180 Ga0496105_0044772 3300048908 Bacteria 3651
181 Ga0496111_0534862 3300048914 Bacteria 861
182 Ga0496124_0220487 3300048927 Bacteria 1427
183 Ga0501034_0114626 3300049571 Bacteria 2684
184 Ga0501039_0117688 3300049575 Bacteria 2081
185 Ga0501040_0029113 3300049576 Bacteria 3727
186 Ga0501040_0582615 3300049576 Bacteria 808
187 Ga0501041_0019201 3300049577 Bacteria 4078
188 Ga0501042_0030701 3300049578 Bacteria 3798
189 Ga0501068_0249050 3300049584 Bacteria 1132
190 Ga0501071_0167428 3300049587 Bacteria 1645
191 Ga0501072_0006305 3300049588 Bacteria 9030
192 Ga0501073_0050858 3300049589 Bacteria 2903
193 Ga0501074_0178903 3300049590 Bacteria 1513
194 Ga0501075_0014294 3300049591 Bacteria 5687
195 Ga0501075_0144393 3300049591 Bacteria 1814
196 Ga0501076_0152864 3300049592 Bacteria 1877
197 Ga0501077_0244554 3300049593 Bacteria 1140
198 Ga0501079_0101557 3300049741 Bacteria 2230
199 Ga0501079_0352978 3300049741 Bacteria 1152
200 Ga0501081_0171271 3300049743 Bacteria 1567
201 Ga0501083_0094306 3300049744 Bacteria 1976
202 Ga0501035_0000173 3300049822 Bacteria 78891
203 Ga0501045_0043335 3300049824 Bacteria 3277
204 nmdc:mga05p37_777426_c1 3300050507 Bacteria 1051
205 nmdc:mga09592_23057_c1 3300050508 Bacteria 5137
206 nmdc:mga0qj67_112174_c1 3300050509 Bacteria 2201
207 nmdc:mga06r32_114222_c1 3300050510 Bacteria 2658
208 Ga0495595_0003535 3300053084 Bacteria 6204
209 Ga0500658_0159411 3300053134 Bacteria 1021
210 Ga0501084_0064640 3300054114 Bacteria 3061
211 Ga0501082_0693928 3300060353 Bacteria 891
212 Ga0466962_0005756 3300061719 Bacteria 5953
213 Ga0530510_0085396 3300061734 Bacteria 2299
214 Ga0530510_0359915 3300061734 Bacteria 1093
215 Ga0068860_100018082
216 Ga0070670_100006120
217 Ga0070666_10127882
218 Ga0070682_100028752
219 Ga0068868_100063546
220 Ga0070689_100029613
221 Ga0070689_100215303
222 Ga0070687_100017485
223 Ga0070687_100356442
224 Ga0070661_100043167
225 Ga0070661_100217000
226 Ga0070675_100260445
227 Ga0070688_100006498
228 Ga0070688_100008446
229 Ga0070688_100173086
230 Ga0070713_100038606
231 Ga0070713_100108540
232 Ga0070710_10091857
233 Ga0070705_100196712
234 Ga0070705_100280278
235 Ga0070694_100200741
236 Ga0070681_10001021
237 Ga0070681_10020140
238 Ga0070685_10066626
239 Ga0070706_100235874
240 Ga0070707_100117897
241 Ga0070698_100027824
242 Ga0070697_100169337
243 Ga0070686_100034483
244 Ga0070686_100042449
245 Ga0070665_100000090
246 Ga0070704_100043389
247 Ga0068855_100008222
248 Ga0068855_100010697
249 Ga0068859_100025463
250 Ga0068859_100079521
251 Ga0068859_100082957
252 Ga0068864_100173159
253 Ga0068863_100569012
254 Ga0068858_100321028
255 Ga0068862_100001639
256 Ga0068862_100119720
257 Ga0068862_100794318
258 Ga0070717_10003860
259 Ga0070717_10160147
260 Ga0097621_100300759
261 Ga0075428_100052827
262 Ga0075428_100066359
263 Ga0075428_100142670
264 Ga0075430_100430555
265 Ga0075434_100024174
266 Ga0075429_100160037
267 Ga0097620_100025462
268 Ga0097620_100079521
269 Ga0097620_100082956
270 Ga0105240_10003765
271 Ga0114129_10085073
272 Ga0114129_10489465
273 Ga0105248_10175549
274 Ga0105248_10368862
275 Ga0105237_10075955
276 Ga0105238_10000393
277 Ga0105238_10007939
278 Ga0105239_10200846
279 Ga0157370_10001131
280 Ga0157378_10006700
281 Ga0163162_10721742
282 Ga0157375_10279093
283 Ga0157380_10445849
284 Ga0157377_10055102
285 Ga0224712_10161949
286 Ga0207680_10158457
287 Ga0207699_10063002
288 Ga0207684_10198669
289 Ga0207707_10000123
290 Ga0207707_10034618
291 Ga0207695_10030244
292 Ga0207671_10000195
293 Ga0207663_10133336
294 Ga0207662_10000881
295 Ga0207649_10181633
296 Ga0207652_10010542
297 Ga0207694_10011084
298 Ga0207650_10004646
299 Ga0207670_10001665
300 Ga0207670_10082543
301 Ga0207711_10101420
302 Ga0207667_10019939
303 Ga0207712_10534078
304 Ga0207712_10608589
305 Ga0207702_10044293
306 Ga0207641_10708779
307 Ga0207676_10130097
308 Ga0268266_10000375
309 Ga0268265_10003199
310 Ga0268265_10843970
311 Ga0268264_10010237
312 Ga0265338_10013342
313 Ga0265338_10305767
314 Ga0265324_10085262
315 Ga0265320_10040987
316 Ga0265325_10222102
317 Ga0265314_10043123
318 Ga0373929_0037663
319 Ga0373934_0003579
320 Ga0373951_0095435
321 Ga0373952_0037738
322 Ga0373939_0015905
323 Ga0373953_0010643
324 Ga0373956_0055115
325 Ga0373956_0064474
326 Ga0373957_0038409
327 Ga0373957_0123608
328 Ga0373946_0093427
329 Ga0373955_0008412
330 Ga0373955_0205920
331 Ga0373961_0000054
332 Ga0373931_0522940
333 Ga0373937_0650045
334 Ga0395900_0397564
335 Ga0395900_0503600
336 Ga0395898_0161998
337 Ga0436360_0967094
338 Ga0451577_0011001
339 Ga0451577_0042465
340 Ga0451577_0101657
341 Ga0451577_0156180
342 Ga0451577_0392503
343 Ga0451577_0548914
344 Ga0466969_0026977
345 Ga0453683_0000502
346 Ga0466966_0001098
347 Ga0466961_0002046
348 Ga0453684_0001724
349 Ga0453684_0001974
350 Ga0453684_0029532
351 Ga0453684_0034978
352 Ga0453684_0204469
353 Ga0453684_0208635
354 Ga0453684_0237300
355 Ga0453684_0427490
356 Ga0453684_0484441
357 Ga0453684_0684010
358 Ga0453684_0710511
359 Ga0453684_1189408
360 Ga0466971_0034237
361 Ga0466970_0000713
362 Ga0466970_0281242
363 Ga0466959_0022523
364 Ga0451576_0014543
365 Ga0451576_0030927
366 Ga0451576_0069449
367 Ga0451576_0071962
368 Ga0451576_0165526
369 Ga0495592_0050801
370 Ga0495651_0133319
371 Ga0495653_0367020
372 Ga0495608_0006021
373 Ga0495618_0000702
374 Ga0495628_0008167
375 Ga0495628_0041220
376 Ga0495630_0012016
377 Ga0495586_0066552
378 Ga0495586_0125119
379 Ga0495587_0003698
380 Ga0495667_0067208
381 Ga0495634_0092129
382 Ga0495634_0230753
383 Ga0495657_0009087
384 Ga0495599_0031319
385 Ga0495600_0152579
386 Ga0495604_0350167
387 Ga0495636_0031496
388 Ga0495674_0022883
389 Ga0495680_0014398
390 Ga0495687_107214
391 Ga0495675_0010880
392 Ga0495615_0038928
393 Ga0496102_0549880
394 Ga0496105_0044772
395 Ga0496111_0534862
396 Ga0496124_0220487
397 Ga0501034_0114626
398 Ga0501039_0117688
399 Ga0501040_0029113
400 Ga0501040_0582615
401 Ga0501041_0019201
402 Ga0501042_0030701
403 Ga0501068_0249050
404 Ga0501071_0167428
405 Ga0501072_0006305
406 Ga0501073_0050858
407 Ga0501074_0178903
408 Ga0501075_0014294
409 Ga0501075_0144393
410 Ga0501076_0152864
411 Ga0501077_0244554
412 Ga0501079_0101557
413 Ga0501079_0352978
414 Ga0501081_0171271
415 Ga0501083_0094306
416 Ga0501035_0000173
417 Ga0501045_0043335
418 nmdc:mga05p37_777426_c1
419 nmdc:mga09592_23057_c1
420 nmdc:mga0qj67_112174_c1
421 nmdc:mga06r32_114222_c1
422 Ga0495595_0003535
423 Ga0500658_0159411
424 Ga0501084_0064640
425 Ga0501082_0693928
426 Ga0466962_0005756
427 Ga0530510_0085396
428 Ga0530510_0359915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

30

101

0.97

PF01709

Transcrip_reg

TACO1/YebC second and third domain

106

266

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.928 23 240
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9158 23 240
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8907 20 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.814 5 239
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8106 20 240
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.971 80 240 3.30.70.980
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9157 26 75 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9008 80 240 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9004 3 76 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.891 80 240 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A534AWB0-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.992 84 240 GO:0003677
GO:0005829
AF-A0A534AWB0-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9857 84 240 GO:0003677
GO:0005829
AF-A0A3D2R6N4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9837 30 131 GO:0003677
GO:0005829
AF-A0A537IDI1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9748 1 213 GO:0003677
GO:0005829
AF-A0A4R7CJQ4-F1-model_v4 deleted 0.9719 13 240

Map