F325004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 214 | 132 | 214 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_102058902|Ga0068857_1020589022 |
| Length | 88 |
| Sequence | MSSRQLYRLRTPSTGREVLLPAEAGQTYRDHDTGEEMVIVGKVLPADSGSALPWSVENLRFCNWCDQLAQKDLNDCPHCGRRMAALPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 52 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 53 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 54 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 78 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 79 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 80 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 81 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 82 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 83 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 86 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 87 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 88 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 89 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 90 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 91 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 92 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 93 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 94 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 95 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 96 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 97 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 101 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 116 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 117 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 118 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 119 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 120 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 121 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 124 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 125 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 126 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 127 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.48 |
| Rhizosphere | 81.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10476707 | 3300005327 | Bacteria | 1077 |
| 2 | Ga0070683_100489779 | 3300005329 | Unclassified | 1174 |
| 3 | Ga0068868_100169579 | 3300005338 | Bacteria | 1806 |
| 4 | Ga0070660_100570054 | 3300005339 | Bacteria | 945 |
| 5 | Ga0070691_10106343 | 3300005341 | Bacteria | 1399 |
| 6 | Ga0070691_10239765 | 3300005341 | Unclassified | 968 |
| 7 | Ga0070687_101165608 | 3300005343 | Bacteria | 567 |
| 8 | Ga0070668_101368336 | 3300005347 | Bacteria | 645 |
| 9 | Ga0070668_101732207 | 3300005347 | Bacteria | 574 |
| 10 | Ga0070675_100329608 | 3300005354 | Bacteria | 1350 |
| 11 | Ga0070674_100074000 | 3300005356 | Bacteria | 2416 |
| 12 | Ga0070659_101179588 | 3300005366 | Bacteria | 677 |
| 13 | Ga0070659_101507051 | 3300005366 | Bacteria | 599 |
| 14 | Ga0070714_101358234 | 3300005435 | Bacteria | 694 |
| 15 | Ga0070701_10147932 | 3300005438 | Bacteria | 1350 |
| 16 | Ga0070705_101162413 | 3300005440 | Bacteria | 634 |
| 17 | Ga0070700_100237651 | 3300005441 | Bacteria | 1300 |
| 18 | Ga0068867_100144145 | 3300005459 | Bacteria | 1865 |
| 19 | Ga0070707_101743493 | 3300005468 | Bacteria | 590 |
| 20 | Ga0070684_100349523 | 3300005535 | Bacteria | 1360 |
| 21 | Ga0070672_101551593 | 3300005543 | Bacteria | 594 |
| 22 | Ga0070665_100339976 | 3300005548 | Bacteria | 1506 |
| 23 | Ga0068857_102058902 | 3300005577 | Bacteria | 560 |
| 24 | Ga0068854_100022145 | 3300005578 | Bacteria | 4323 |
| 25 | Ga0068854_101671424 | 3300005578 | Bacteria | 582 |
| 26 | Ga0070702_100028037 | 3300005615 | Bacteria | 3047 |
| 27 | Ga0068852_101071510 | 3300005616 | Bacteria | 826 |
| 28 | Ga0068852_101590169 | 3300005616 | Unclassified | 676 |
| 29 | Ga0068859_100313399 | 3300005617 | Bacteria | 1663 |
| 30 | Ga0068866_10244265 | 3300005718 | Bacteria | 1095 |
| 31 | Ga0068866_10479257 | 3300005718 | Unclassified | 819 |
| 32 | Ga0068866_10790566 | 3300005718 | Bacteria | 659 |
| 33 | Ga0068861_100279401 | 3300005719 | Unclassified | 1437 |
| 34 | Ga0068861_100648430 | 3300005719 | Bacteria | 975 |
| 35 | Ga0068870_10380138 | 3300005840 | Bacteria | 914 |
| 36 | Ga0068870_11059911 | 3300005840 | Bacteria | 581 |
| 37 | Ga0068860_101487485 | 3300005843 | Bacteria | 699 |
| 38 | Ga0068862_102089991 | 3300005844 | Bacteria | 577 |
| 39 | Ga0081538_10012109 | 3300005981 | Bacteria | 6934 |
| 40 | Ga0081538_10057883 | 3300005981 | Bacteria | 2253 |
| 41 | Ga0070717_10588524 | 3300006028 | Bacteria | 1009 |
| 42 | Ga0068865_100571584 | 3300006881 | Bacteria | 952 |
| 43 | Ga0068865_100908405 | 3300006881 | Unclassified | 766 |
| 44 | Ga0097620_100313386 | 3300006931 | Bacteria | 1663 |
| 45 | Ga0111539_11582262 | 3300009094 | Unclassified | 760 |
| 46 | Ga0111539_13475445 | 3300009094 | Bacteria | 506 |
| 47 | Ga0111539_13530697 | 3300009094 | Bacteria | 501 |
| 48 | Ga0105245_12406528 | 3300009098 | Bacteria | 580 |
| 49 | Ga0105247_10218064 | 3300009101 | Bacteria | 1290 |
| 50 | Ga0105243_11082146 | 3300009148 | Bacteria | 809 |
| 51 | Ga0105241_12550473 | 3300009174 | Bacteria | 513 |
| 52 | Ga0105242_11387255 | 3300009176 | Unclassified | 730 |
| 53 | Ga0105248_11817135 | 3300009177 | Bacteria | 691 |
| 54 | Ga0105249_12522453 | 3300009553 | Bacteria | 586 |
| 55 | Ga0105239_11770595 | 3300010375 | Bacteria | 715 |
| 56 | Ga0105246_10104026 | 3300011119 | Bacteria | 2073 |
| 57 | Ga0163162_11406648 | 3300013306 | Unclassified | 794 |
| 58 | Ga0157372_10475633 | 3300013307 | Bacteria | 1456 |
| 59 | Ga0157375_10399464 | 3300013308 | Bacteria | 1541 |
| 60 | Ga0163163_10743702 | 3300014325 | Bacteria | 1044 |
| 61 | Ga0163163_12739861 | 3300014325 | Bacteria | 550 |
| 62 | Ga0157380_10879337 | 3300014326 | Bacteria | 920 |
| 63 | Ga0157380_12552665 | 3300014326 | Unclassified | 577 |
| 64 | Ga0182008_10319550 | 3300014497 | Bacteria | 817 |
| 65 | Ga0157377_10316063 | 3300014745 | Unclassified | 1036 |
| 66 | Ga0213874_10057452 | 3300021377 | Unclassified | 1210 |
| 67 | Ga0213874_10059819 | 3300021377 | Bacteria | 1191 |
| 68 | Ga0213876_10093678 | 3300021384 | Bacteria | 1591 |
| 69 | Ga0213875_10608289 | 3300021388 | Bacteria | 528 |
| 70 | Ga0207642_10417745 | 3300025899 | Unclassified | 806 |
| 71 | Ga0207642_10582059 | 3300025899 | Bacteria | 695 |
| 72 | Ga0207688_10520848 | 3300025901 | Bacteria | 746 |
| 73 | Ga0207688_10581734 | 3300025901 | Bacteria | 705 |
| 74 | Ga0207643_10217324 | 3300025908 | Bacteria | 1169 |
| 75 | Ga0207687_10200932 | 3300025927 | Bacteria | 1558 |
| 76 | Ga0207706_10033264 | 3300025933 | Bacteria | 4591 |
| 77 | Ga0207686_11561553 | 3300025934 | Bacteria | 545 |
| 78 | Ga0207709_10077662 | 3300025935 | Bacteria | 2129 |
| 79 | Ga0207709_10736671 | 3300025935 | Unclassified | 791 |
| 80 | Ga0207669_10172602 | 3300025937 | Bacteria | 1541 |
| 81 | Ga0207704_10070240 | 3300025938 | Bacteria | 2216 |
| 82 | Ga0207704_10228092 | 3300025938 | Bacteria | 1383 |
| 83 | Ga0207704_10825499 | 3300025938 | Bacteria | 775 |
| 84 | Ga0207691_11382515 | 3300025940 | Bacteria | 579 |
| 85 | Ga0207711_11994868 | 3300025941 | Bacteria | 523 |
| 86 | Ga0207689_10271031 | 3300025942 | Bacteria | 1405 |
| 87 | Ga0207712_10203816 | 3300025961 | Bacteria | 1570 |
| 88 | Ga0207640_10066887 | 3300025981 | Unclassified | 2402 |
| 89 | Ga0207640_10521877 | 3300025981 | Bacteria | 993 |
| 90 | Ga0207677_11399472 | 3300026023 | Unclassified | 644 |
| 91 | Ga0207708_10087099 | 3300026075 | Bacteria | 2404 |
| 92 | Ga0207702_11227373 | 3300026078 | Bacteria | 744 |
| 93 | Ga0207702_11749053 | 3300026078 | Bacteria | 614 |
| 94 | Ga0207648_10207309 | 3300026089 | Bacteria | 1739 |
| 95 | Ga0207675_100314307 | 3300026118 | Bacteria | 1528 |
| 96 | Ga0207675_100534837 | 3300026118 | Bacteria | 1170 |
| 97 | Ga0207698_11012721 | 3300026142 | Bacteria | 842 |
| 98 | Ga0207698_11284164 | 3300026142 | Unclassified | 747 |
| 99 | Ga0207428_10893919 | 3300027907 | Unclassified | 628 |
| 100 | Ga0207428_11290246 | 3300027907 | Bacteria | 506 |
| 101 | Ga0268266_10301144 | 3300028379 | Bacteria | 1496 |
| 102 | Ga0268265_11646312 | 3300028380 | Bacteria | 647 |
| 103 | Ga0307408_100846883 | 3300031548 | Bacteria | 833 |
| 104 | Ga0307405_10061040 | 3300031731 | Bacteria | 2381 |
| 105 | Ga0307405_11195122 | 3300031731 | Bacteria | 657 |
| 106 | Ga0307405_11869555 | 3300031731 | Bacteria | 535 |
| 107 | Ga0307413_10122471 | 3300031824 | Bacteria | 1764 |
| 108 | Ga0307410_10232615 | 3300031852 | Bacteria | 1424 |
| 109 | Ga0307410_10327594 | 3300031852 | Bacteria | 1217 |
| 110 | Ga0307406_10369465 | 3300031901 | Bacteria | 1127 |
| 111 | Ga0307406_10414607 | 3300031901 | Bacteria | 1071 |
| 112 | Ga0307406_10420208 | 3300031901 | Bacteria | 1065 |
| 113 | Ga0307406_10976492 | 3300031901 | Bacteria | 725 |
| 114 | Ga0307407_10066192 | 3300031903 | Bacteria | 2130 |
| 115 | Ga0307412_11087828 | 3300031911 | Unclassified | 711 |
| 116 | Ga0307412_12246570 | 3300031911 | Bacteria | 508 |
| 117 | Ga0307409_100290319 | 3300031995 | Bacteria | 1516 |
| 118 | Ga0307409_100331021 | 3300031995 | Bacteria | 1429 |
| 119 | Ga0307409_100480817 | 3300031995 | Unclassified | 1205 |
| 120 | Ga0307409_101695532 | 3300031995 | Bacteria | 661 |
| 121 | Ga0307416_100006509 | 3300032002 | Bacteria | 7320 |
| 122 | Ga0307416_100050251 | 3300032002 | Bacteria | 3323 |
| 123 | Ga0307416_100148810 | 3300032002 | Bacteria | 2143 |
| 124 | Ga0307414_10101552 | 3300032004 | Bacteria | 2166 |
| 125 | Ga0307414_10324018 | 3300032004 | Bacteria | 1313 |
| 126 | Ga0307414_11338921 | 3300032004 | Bacteria | 665 |
| 127 | Ga0307411_10354824 | 3300032005 | Bacteria | 1197 |
| 128 | Ga0307411_11926980 | 3300032005 | Bacteria | 550 |
| 129 | Ga0307415_100032667 | 3300032126 | Bacteria | 3369 |
| 130 | Ga0307415_100082748 | 3300032126 | Bacteria | 2297 |
| 131 | Ga0307415_100388594 | 3300032126 | Bacteria | 1187 |
| 132 | Ga0307415_101218001 | 3300032126 | Bacteria | 710 |
| 133 | Ga0436364_0080999 | 3300037853 | Bacteria | 13062 |
| 134 | Ga0436364_0190011 | 3300037853 | Bacteria | 14208 |
| 135 | Ga0436364_0280406 | 3300037853 | Bacteria | 978 |
| 136 | Ga0436364_0499706 | 3300037853 | Bacteria | 930 |
| 137 | Ga0436364_0513382 | 3300037853 | Unclassified | 700 |
| 138 | Ga0436364_0841868 | 3300037853 | Bacteria | 2881 |
| 139 | Ga0436364_1557863 | 3300037853 | Bacteria | 1105 |
| 140 | Ga0395901_0679138 | 3300038443 | Unclassified | 1030 |
| 141 | Ga0395901_0790467 | 3300038443 | Bacteria | 939 |
| 142 | Ga0395901_1873628 | 3300038443 | Bacteria | 548 |
| 143 | Ga0436365_0151332 | 3300039437 | Bacteria | 634 |
| 144 | Ga0436365_1219508 | 3300039437 | Bacteria | 3973 |
| 145 | Ga0436365_1318646 | 3300039437 | Bacteria | 21341 |
| 146 | Ga0436365_1401350 | 3300039437 | Bacteria | 857 |
| 147 | Ga0436363_0116001 | 3300039450 | Bacteria | 48959 |
| 148 | Ga0436363_0241385 | 3300039450 | Bacteria | 2304 |
| 149 | Ga0436363_0349934 | 3300039450 | Unclassified | 1599 |
| 150 | Ga0436363_0667731 | 3300039450 | Bacteria | 567 |
| 151 | Ga0436363_0841207 | 3300039450 | Unclassified | 1051 |
| 152 | Ga0436363_1333975 | 3300039450 | Bacteria | 1098 |
| 153 | Ga0436363_1485398 | 3300039450 | Unclassified | 896 |
| 154 | Ga0436362_0319411 | 3300039453 | Unclassified | 519 |
| 155 | Ga0436362_0551343 | 3300039453 | Bacteria | 2228 |
| 156 | Ga0436362_1237332 | 3300039453 | Bacteria | 1160 |
| 157 | Ga0451797_0909708 | 3300041453 | Bacteria | 1022 |
| 158 | Ga0451835_0242547 | 3300041492 | Unclassified | 698 |
| 159 | Ga0439459_0165704 | 3300042438 | Bacteria | 586 |
| 160 | Ga0466972_0071289 | 3300044658 | Unclassified | 1658 |
| 161 | Ga0466965_0129862 | 3300044683 | Bacteria | 1306 |
| 162 | Ga0466965_0325498 | 3300044683 | Bacteria | 838 |
| 163 | Ga0466965_0911114 | 3300044683 | Bacteria | 513 |
| 164 | Ga0466966_0266507 | 3300044684 | Bacteria | 1031 |
| 165 | Ga0466961_0387498 | 3300044693 | Bacteria | 849 |
| 166 | Ga0466963_0492228 | 3300044694 | Bacteria | 866 |
| 167 | Ga0466960_0470819 | 3300044901 | Bacteria | 733 |
| 168 | Ga0466960_0610274 | 3300044901 | Bacteria | 648 |
| 169 | Ga0466959_0089921 | 3300045049 | Bacteria | 2206 |
| 170 | Ga0466959_0124459 | 3300045049 | Unclassified | 1831 |
| 171 | Ga0466959_0226484 | 3300045049 | Unclassified | 1295 |
| 172 | Ga0466959_0538400 | 3300045049 | Bacteria | 788 |
| 173 | Ga0466959_0588143 | 3300045049 | Bacteria | 749 |
| 174 | Ga0466958_0008834 | 3300045836 | Bacteria | 5599 |
| 175 | Ga0466958_0339955 | 3300045836 | Bacteria | 966 |
| 176 | Ga0466967_0084278 | 3300045976 | Bacteria | 2876 |
| 177 | Ga0466967_0112435 | 3300045976 | Bacteria | 2504 |
| 178 | Ga0466967_0405935 | 3300045976 | Bacteria | 1326 |
| 179 | Ga0466967_0454499 | 3300045976 | Bacteria | 1252 |
| 180 | Ga0466967_0555682 | 3300045976 | Bacteria | 1130 |
| 181 | Ga0466967_2607521 | 3300045976 | Bacteria | 500 |
| 182 | Ga0495629_0206293 | 3300046459 | Bacteria | 1358 |
| 183 | Ga0495639_0501130 | 3300046475 | Bacteria | 620 |
| 184 | Ga0495596_0348815 | 3300046500 | Bacteria | 576 |
| 185 | Ga0495596_0409312 | 3300046500 | Bacteria | 529 |
| 186 | Ga0495589_0397341 | 3300046794 | Bacteria | 633 |
| 187 | Ga0495581_0862939 | 3300047315 | Bacteria | 518 |
| 188 | Ga0495604_0001583 | 3300047317 | Bacteria | 18739 |
| 189 | Ga0495676_1071863 | 3300047321 | Bacteria | 513 |
| 190 | Ga0495684_0239025 | 3300047471 | Bacteria | 1326 |
| 191 | Ga0496100_0700931 | 3300048903 | Unclassified | 790 |
| 192 | Ga0496101_0277683 | 3300048904 | Bacteria | 1309 |
| 193 | Ga0496102_0360335 | 3300048905 | Unclassified | 1369 |
| 194 | Ga0496104_0000093 | 3300048907 | Bacteria | 87156 |
| 195 | Ga0496105_0319197 | 3300048908 | Bacteria | 1245 |
| 196 | Ga0496106_0101093 | 3300048909 | Bacteria | 2236 |
| 197 | Ga0496107_0413903 | 3300048910 | Bacteria | 1002 |
| 198 | Ga0496108_0232811 | 3300048911 | Bacteria | 1602 |
| 199 | Ga0496108_0375467 | 3300048911 | Bacteria | 1241 |
| 200 | Ga0496109_0181531 | 3300048912 | Bacteria | 1977 |
| 201 | Ga0496110_0009548 | 3300048913 | Bacteria | 7853 |
| 202 | Ga0496110_0147684 | 3300048913 | Bacteria | 2128 |
| 203 | Ga0496111_0000033 | 3300048914 | Bacteria | 55040 |
| 204 | Ga0496112_0095450 | 3300048915 | Bacteria | 2944 |
| 205 | Ga0496113_0192678 | 3300048916 | Bacteria | 1618 |
| 206 | Ga0501071_1377505 | 3300049587 | Bacteria | 545 |
| 207 | Ga0501072_1524003 | 3300049588 | Bacteria | 516 |
| 208 | nmdc:mga0qj67_1009674_c1 | 3300050509 | Bacteria | 652 |
| 209 | nmdc:mga08y16_1497686_c1 | 3300050511 | Unclassified | 635 |
| 210 | nmdc:mga08y16_2106669_c1 | 3300050511 | Unclassified | 512 |
| 211 | Ga0495619_0300438 | 3300053085 | Bacteria | 1112 |
| 212 | Ga0495619_1209108 | 3300053085 | Bacteria | 500 |
| 213 | Ga0466962_0667280 | 3300061719 | Bacteria | 532 |
| 214 | Ga0466962_0740594 | 3300061719 | Bacteria | 505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0206293 | Ga0495629_0206293_23_253 | 71 |
| 2 | 3300005435 | Ga0070714_101358234 | Ga0070714_1013582341 | 81 |
| 3 | 3300006028 | Ga0070717_10588524 | Ga0070717_105885242 | 81 |
| 4 | 3300021377 | Ga0213874_10057452 | Ga0213874_100574522 | 81 |
| 5 | 3300021377 | Ga0213874_10059819 | Ga0213874_100598193 | 81 |
| 6 | 3300021384 | Ga0213876_10093678 | Ga0213876_100936783 | 81 |
| 7 | 3300021388 | Ga0213875_10608289 | Ga0213875_106082891 | 81 |
| 8 | 3300026078 | Ga0207702_11749053 | Ga0207702_117490532 | 81 |
| 9 | 3300037853 | Ga0436364_0190011 | Ga0436364_0190011_1889_2134 | 81 |
| 10 | 3300037853 | Ga0436364_0499706 | Ga0436364_0499706_75_320 | 81 |
| 11 | 3300037853 | Ga0436364_0513382 | Ga0436364_0513382_308_553 | 81 |
| 12 | 3300037853 | Ga0436364_0841868 | Ga0436364_0841868_1718_1963 | 81 |
| 13 | 3300038443 | Ga0395901_1873628 | Ga0395901_1873628_187_432 | 81 |
| 14 | 3300039437 | Ga0436365_0151332 | Ga0436365_0151332_22_267 | 81 |
| 15 | 3300039437 | Ga0436365_1219508 | Ga0436365_1219508_1292_1537 | 81 |
| 16 | 3300039450 | Ga0436363_0116001 | Ga0436363_0116001_1740_1985 | 81 |
| 17 | 3300039450 | Ga0436363_0241385 | Ga0436363_0241385_1375_1620 | 81 |
| 18 | 3300039450 | Ga0436363_0349934 | Ga0436363_0349934_418_663 | 81 |
| 19 | 3300039450 | Ga0436363_0841207 | Ga0436363_0841207_378_623 | 81 |
| 20 | 3300039453 | Ga0436362_1237332 | Ga0436362_1237332_721_966 | 81 |
| 21 | 3300041492 | Ga0451835_0242547 | Ga0451835_0242547_421_675 | 81 |
| 22 | 3300044658 | Ga0466972_0071289 | Ga0466972_0071289_677_922 | 81 |
| 23 | 3300044683 | Ga0466965_0129862 | Ga0466965_0129862_904_1149 | 81 |
| 24 | 3300044901 | Ga0466960_0610274 | Ga0466960_0610274_292_537 | 81 |
| 25 | 3300045049 | Ga0466959_0124459 | Ga0466959_0124459_977_1222 | 81 |
| 26 | 3300045049 | Ga0466959_0226484 | Ga0466959_0226484_532_777 | 81 |
| 27 | 3300045049 | Ga0466959_0538400 | Ga0466959_0538400_110_355 | 81 |
| 28 | 3300045976 | Ga0466967_2607521 | Ga0466967_2607521_182_427 | 81 |
| 29 | 3300053085 | Ga0495619_1209108 | Ga0495619_1209108_236_481 | 81 |
| 30 | 3300011119 | Ga0105246_10104026 | Ga0105246_101040262 | 86 |
| 31 | 3300032004 | Ga0307414_11338921 | Ga0307414_113389212 | 86 |
| 32 | 3300039450 | Ga0436363_0667731 | Ga0436363_0667731_61_324 | 86 |
| 33 | 3300050511 | nmdc:mga08y16_1497686_c1 | nmdc:mga08y16_1497686_c1_226_501 | 86 |
| 34 | 3300009177 | Ga0105248_11817135 | Ga0105248_118171351 | 87 |
| 35 | 3300014325 | Ga0163163_12739861 | Ga0163163_127398612 | 87 |
| 36 | 3300025941 | Ga0207711_11994868 | Ga0207711_119948681 | 87 |
| 37 | 3300026078 | Ga0207702_11227373 | Ga0207702_112273732 | 87 |
| 38 | 3300031852 | Ga0307410_10232615 | Ga0307410_102326152 | 87 |
| 39 | 3300031901 | Ga0307406_10420208 | Ga0307406_104202082 | 87 |
| 40 | 3300031995 | Ga0307409_100480817 | Ga0307409_1004808173 | 87 |
| 41 | 3300032004 | Ga0307414_10324018 | Ga0307414_103240182 | 87 |
| 42 | 3300041453 | Ga0451797_0909708 | Ga0451797_0909708_606_869 | 87 |
| 43 | 3300046500 | Ga0495596_0409312 | Ga0495596_0409312_255_518 | 87 |
| 44 | 3300050509 | nmdc:mga0qj67_1009674_c1 | nmdc:mga0qj67_1009674_c1_214_477 | 87 |
| 45 | 3300005468 | Ga0070707_101743493 | Ga0070707_1017434931 | 88 |
| 46 | 3300005577 | Ga0068857_102058902 | Ga0068857_1020589022 | 88 |
| 47 | 3300009098 | Ga0105245_12406528 | Ga0105245_124065281 | 88 |
| 48 | 3300009174 | Ga0105241_12550473 | Ga0105241_125504731 | 88 |
| 49 | 3300038443 | Ga0395901_0790467 | Ga0395901_0790467_467_733 | 88 |
| 50 | 3300046475 | Ga0495639_0501130 | Ga0495639_0501130_101_367 | 88 |
| 51 | 3300046794 | Ga0495589_0397341 | Ga0495589_0397341_302_568 | 88 |
| 52 | 3300047321 | Ga0495676_1071863 | Ga0495676_1071863_210_476 | 88 |
| 53 | 3300047471 | Ga0495684_0239025 | Ga0495684_0239025_782_1048 | 88 |
| 54 | 3300048907 | Ga0496104_0000093 | Ga0496104_0000093_40382_40648 | 88 |
| 55 | 3300048908 | Ga0496105_0319197 | Ga0496105_0319197_365_631 | 88 |
| 56 | 3300048913 | Ga0496110_0009548 | Ga0496110_0009548_6811_7077 | 88 |
| 57 | 3300048914 | Ga0496111_0000033 | Ga0496111_0000033_41103_41369 | 88 |
| 58 | 3300053085 | Ga0495619_0300438 | Ga0495619_0300438_92_358 | 88 |
| 59 | 3300005327 | Ga0070658_10476707 | Ga0070658_104767072 | 89 |
| 60 | 3300005329 | Ga0070683_100489779 | Ga0070683_1004897792 | 89 |
| 61 | 3300005338 | Ga0068868_100169579 | Ga0068868_1001695792 | 89 |
| 62 | 3300005339 | Ga0070660_100570054 | Ga0070660_1005700542 | 89 |
| 63 | 3300005341 | Ga0070691_10106343 | Ga0070691_101063431 | 89 |
| 64 | 3300005341 | Ga0070691_10239765 | Ga0070691_102397652 | 89 |
| 65 | 3300005343 | Ga0070687_101165608 | Ga0070687_1011656081 | 89 |
| 66 | 3300005347 | Ga0070668_101368336 | Ga0070668_1013683361 | 89 |
| 67 | 3300005347 | Ga0070668_101732207 | Ga0070668_1017322071 | 89 |
| 68 | 3300005354 | Ga0070675_100329608 | Ga0070675_1003296082 | 89 |
| 69 | 3300005356 | Ga0070674_100074000 | Ga0070674_1000740003 | 89 |
| 70 | 3300005366 | Ga0070659_101179588 | Ga0070659_1011795882 | 89 |
| 71 | 3300005366 | Ga0070659_101507051 | Ga0070659_1015070512 | 89 |
| 72 | 3300005438 | Ga0070701_10147932 | Ga0070701_101479322 | 89 |
| 73 | 3300005440 | Ga0070705_101162413 | Ga0070705_1011624132 | 89 |
| 74 | 3300005441 | Ga0070700_100237651 | Ga0070700_1002376512 | 89 |
| 75 | 3300005459 | Ga0068867_100144145 | Ga0068867_1001441453 | 89 |
| 76 | 3300005535 | Ga0070684_100349523 | Ga0070684_1003495231 | 89 |
| 77 | 3300005543 | Ga0070672_101551593 | Ga0070672_1015515931 | 89 |
| 78 | 3300005548 | Ga0070665_100339976 | Ga0070665_1003399762 | 89 |
| 79 | 3300005578 | Ga0068854_100022145 | Ga0068854_1000221455 | 89 |
| 80 | 3300005578 | Ga0068854_101671424 | Ga0068854_1016714242 | 89 |
| 81 | 3300005615 | Ga0070702_100028037 | Ga0070702_1000280372 | 89 |
| 82 | 3300005616 | Ga0068852_101071510 | Ga0068852_1010715102 | 89 |
| 83 | 3300005616 | Ga0068852_101590169 | Ga0068852_1015901692 | 89 |
| 84 | 3300005617 | Ga0068859_100313399 | Ga0068859_1003133992 | 89 |
| 85 | 3300005718 | Ga0068866_10244265 | Ga0068866_102442652 | 89 |
| 86 | 3300005718 | Ga0068866_10479257 | Ga0068866_104792572 | 89 |
| 87 | 3300005718 | Ga0068866_10790566 | Ga0068866_107905662 | 89 |
| 88 | 3300005719 | Ga0068861_100279401 | Ga0068861_1002794012 | 89 |
| 89 | 3300005719 | Ga0068861_100648430 | Ga0068861_1006484302 | 89 |
| 90 | 3300005840 | Ga0068870_10380138 | Ga0068870_103801382 | 89 |
| 91 | 3300005840 | Ga0068870_11059911 | Ga0068870_110599112 | 89 |
| 92 | 3300005843 | Ga0068860_101487485 | Ga0068860_1014874852 | 89 |
| 93 | 3300005844 | Ga0068862_102089991 | Ga0068862_1020899912 | 89 |
| 94 | 3300005981 | Ga0081538_10012109 | Ga0081538_100121096 | 89 |
| 95 | 3300005981 | Ga0081538_10057883 | Ga0081538_100578832 | 89 |
| 96 | 3300006881 | Ga0068865_100571584 | Ga0068865_1005715843 | 89 |
| 97 | 3300006881 | Ga0068865_100908405 | Ga0068865_1009084052 | 89 |
| 98 | 3300006931 | Ga0097620_100313386 | Ga0097620_1003133862 | 89 |
| 99 | 3300009094 | Ga0111539_11582262 | Ga0111539_115822622 | 89 |
| 100 | 3300009094 | Ga0111539_13475445 | Ga0111539_134754452 | 89 |
| 101 | 3300009094 | Ga0111539_13530697 | Ga0111539_135306972 | 89 |
| 102 | 3300009101 | Ga0105247_10218064 | Ga0105247_102180642 | 89 |
| 103 | 3300009148 | Ga0105243_11082146 | Ga0105243_110821461 | 89 |
| 104 | 3300009176 | Ga0105242_11387255 | Ga0105242_113872552 | 89 |
| 105 | 3300009553 | Ga0105249_12522453 | Ga0105249_125224532 | 89 |
| 106 | 3300010375 | Ga0105239_11770595 | Ga0105239_117705952 | 89 |
| 107 | 3300013306 | Ga0163162_11406648 | Ga0163162_114066482 | 89 |
| 108 | 3300013307 | Ga0157372_10475633 | Ga0157372_104756333 | 89 |
| 109 | 3300013308 | Ga0157375_10399464 | Ga0157375_103994642 | 89 |
| 110 | 3300014325 | Ga0163163_10743702 | Ga0163163_107437022 | 89 |
| 111 | 3300014326 | Ga0157380_10879337 | Ga0157380_108793372 | 89 |
| 112 | 3300014326 | Ga0157380_12552665 | Ga0157380_125526652 | 89 |
| 113 | 3300014497 | Ga0182008_10319550 | Ga0182008_103195502 | 89 |
| 114 | 3300014745 | Ga0157377_10316063 | Ga0157377_103160632 | 89 |
| 115 | 3300025899 | Ga0207642_10417745 | Ga0207642_104177452 | 89 |
| 116 | 3300025899 | Ga0207642_10582059 | Ga0207642_105820592 | 89 |
| 117 | 3300025901 | Ga0207688_10520848 | Ga0207688_105208482 | 89 |
| 118 | 3300025901 | Ga0207688_10581734 | Ga0207688_105817342 | 89 |
| 119 | 3300025908 | Ga0207643_10217324 | Ga0207643_102173242 | 89 |
| 120 | 3300025927 | Ga0207687_10200932 | Ga0207687_102009322 | 89 |
| 121 | 3300025933 | Ga0207706_10033264 | Ga0207706_100332643 | 89 |
| 122 | 3300025934 | Ga0207686_11561553 | Ga0207686_115615531 | 89 |
| 123 | 3300025935 | Ga0207709_10077662 | Ga0207709_100776622 | 89 |
| 124 | 3300025935 | Ga0207709_10736671 | Ga0207709_107366711 | 89 |
| 125 | 3300025937 | Ga0207669_10172602 | Ga0207669_101726022 | 89 |
| 126 | 3300025938 | Ga0207704_10070240 | Ga0207704_100702402 | 89 |
| 127 | 3300025938 | Ga0207704_10228092 | Ga0207704_102280922 | 89 |
| 128 | 3300025938 | Ga0207704_10825499 | Ga0207704_108254992 | 89 |
| 129 | 3300025940 | Ga0207691_11382515 | Ga0207691_113825151 | 89 |
| 130 | 3300025942 | Ga0207689_10271031 | Ga0207689_102710312 | 89 |
| 131 | 3300025961 | Ga0207712_10203816 | Ga0207712_102038162 | 89 |
| 132 | 3300025981 | Ga0207640_10066887 | Ga0207640_100668872 | 89 |
| 133 | 3300025981 | Ga0207640_10521877 | Ga0207640_105218772 | 89 |
| 134 | 3300026023 | Ga0207677_11399472 | Ga0207677_113994722 | 89 |
| 135 | 3300026075 | Ga0207708_10087099 | Ga0207708_100870993 | 89 |
| 136 | 3300026089 | Ga0207648_10207309 | Ga0207648_102073093 | 89 |
| 137 | 3300026118 | Ga0207675_100314307 | Ga0207675_1003143073 | 89 |
| 138 | 3300026118 | Ga0207675_100534837 | Ga0207675_1005348372 | 89 |
| 139 | 3300026142 | Ga0207698_11012721 | Ga0207698_110127212 | 89 |
| 140 | 3300026142 | Ga0207698_11284164 | Ga0207698_112841642 | 89 |
| 141 | 3300027907 | Ga0207428_10893919 | Ga0207428_108939192 | 89 |
| 142 | 3300027907 | Ga0207428_11290246 | Ga0207428_112902462 | 89 |
| 143 | 3300028379 | Ga0268266_10301144 | Ga0268266_103011442 | 89 |
| 144 | 3300028380 | Ga0268265_11646312 | Ga0268265_116463122 | 89 |
| 145 | 3300031548 | Ga0307408_100846883 | Ga0307408_1008468832 | 89 |
| 146 | 3300031731 | Ga0307405_10061040 | Ga0307405_100610402 | 89 |
| 147 | 3300031731 | Ga0307405_11195122 | Ga0307405_111951222 | 89 |
| 148 | 3300031731 | Ga0307405_11869555 | Ga0307405_118695551 | 89 |
| 149 | 3300031824 | Ga0307413_10122471 | Ga0307413_101224712 | 89 |
| 150 | 3300031852 | Ga0307410_10327594 | Ga0307410_103275942 | 89 |
| 151 | 3300031901 | Ga0307406_10369465 | Ga0307406_103694652 | 89 |
| 152 | 3300031901 | Ga0307406_10414607 | Ga0307406_104146072 | 89 |
| 153 | 3300031901 | Ga0307406_10976492 | Ga0307406_109764922 | 89 |
| 154 | 3300031903 | Ga0307407_10066192 | Ga0307407_100661922 | 89 |
| 155 | 3300031911 | Ga0307412_11087828 | Ga0307412_110878282 | 89 |
| 156 | 3300031911 | Ga0307412_12246570 | Ga0307412_122465702 | 89 |
| 157 | 3300031995 | Ga0307409_100290319 | Ga0307409_1002903192 | 89 |
| 158 | 3300031995 | Ga0307409_100331021 | Ga0307409_1003310213 | 89 |
| 159 | 3300031995 | Ga0307409_101695532 | Ga0307409_1016955322 | 89 |
| 160 | 3300032002 | Ga0307416_100006509 | Ga0307416_1000065092 | 89 |
| 161 | 3300032002 | Ga0307416_100050251 | Ga0307416_1000502513 | 89 |
| 162 | 3300032002 | Ga0307416_100148810 | Ga0307416_1001488102 | 89 |
| 163 | 3300032004 | Ga0307414_10101552 | Ga0307414_101015522 | 89 |
| 164 | 3300032005 | Ga0307411_10354824 | Ga0307411_103548242 | 89 |
| 165 | 3300032005 | Ga0307411_11926980 | Ga0307411_119269802 | 89 |
| 166 | 3300032126 | Ga0307415_100032667 | Ga0307415_1000326674 | 89 |
| 167 | 3300032126 | Ga0307415_100082748 | Ga0307415_1000827482 | 89 |
| 168 | 3300032126 | Ga0307415_100388594 | Ga0307415_1003885942 | 89 |
| 169 | 3300032126 | Ga0307415_101218001 | Ga0307415_1012180012 | 89 |
| 170 | 3300037853 | Ga0436364_0080999 | Ga0436364_0080999_10607_10876 | 89 |
| 171 | 3300037853 | Ga0436364_0280406 | Ga0436364_0280406_495_764 | 89 |
| 172 | 3300037853 | Ga0436364_1557863 | Ga0436364_1557863_758_1027 | 89 |
| 173 | 3300038443 | Ga0395901_0679138 | Ga0395901_0679138_32_310 | 89 |
| 174 | 3300039437 | Ga0436365_1318646 | Ga0436365_1318646_872_1141 | 89 |
| 175 | 3300039437 | Ga0436365_1401350 | Ga0436365_1401350_381_650 | 89 |
| 176 | 3300039450 | Ga0436363_1333975 | Ga0436363_1333975_174_443 | 89 |
| 177 | 3300039450 | Ga0436363_1485398 | Ga0436363_1485398_28_297 | 89 |
| 178 | 3300039453 | Ga0436362_0319411 | Ga0436362_0319411_144_413 | 89 |
| 179 | 3300039453 | Ga0436362_0551343 | Ga0436362_0551343_459_728 | 89 |
| 180 | 3300042438 | Ga0439459_0165704 | Ga0439459_0165704_115_384 | 89 |
| 181 | 3300044683 | Ga0466965_0325498 | Ga0466965_0325498_390_659 | 89 |
| 182 | 3300044683 | Ga0466965_0911114 | Ga0466965_0911114_194_463 | 89 |
| 183 | 3300044684 | Ga0466966_0266507 | Ga0466966_0266507_184_453 | 89 |
| 184 | 3300044693 | Ga0466961_0387498 | Ga0466961_0387498_119_388 | 89 |
| 185 | 3300044694 | Ga0466963_0492228 | Ga0466963_0492228_240_509 | 89 |
| 186 | 3300044901 | Ga0466960_0470819 | Ga0466960_0470819_451_720 | 89 |
| 187 | 3300045049 | Ga0466959_0089921 | Ga0466959_0089921_1796_2065 | 89 |
| 188 | 3300045049 | Ga0466959_0588143 | Ga0466959_0588143_339_608 | 89 |
| 189 | 3300045836 | Ga0466958_0008834 | Ga0466958_0008834_2253_2522 | 89 |
| 190 | 3300045836 | Ga0466958_0339955 | Ga0466958_0339955_178_447 | 89 |
| 191 | 3300045976 | Ga0466967_0084278 | Ga0466967_0084278_338_607 | 89 |
| 192 | 3300045976 | Ga0466967_0112435 | Ga0466967_0112435_2170_2439 | 89 |
| 193 | 3300045976 | Ga0466967_0405935 | Ga0466967_0405935_755_1024 | 89 |
| 194 | 3300045976 | Ga0466967_0454499 | Ga0466967_0454499_284_556 | 89 |
| 195 | 3300045976 | Ga0466967_0555682 | Ga0466967_0555682_655_927 | 89 |
| 196 | 3300046500 | Ga0495596_0348815 | Ga0495596_0348815_145_414 | 89 |
| 197 | 3300047315 | Ga0495581_0862939 | Ga0495581_0862939_237_506 | 89 |
| 198 | 3300047317 | Ga0495604_0001583 | Ga0495604_0001583_10924_11199 | 89 |
| 199 | 3300048903 | Ga0496100_0700931 | Ga0496100_0700931_37_306 | 89 |
| 200 | 3300048904 | Ga0496101_0277683 | Ga0496101_0277683_636_905 | 89 |
| 201 | 3300048905 | Ga0496102_0360335 | Ga0496102_0360335_513_782 | 89 |
| 202 | 3300048909 | Ga0496106_0101093 | Ga0496106_0101093_1417_1686 | 89 |
| 203 | 3300048910 | Ga0496107_0413903 | Ga0496107_0413903_646_915 | 89 |
| 204 | 3300048911 | Ga0496108_0232811 | Ga0496108_0232811_63_332 | 89 |
| 205 | 3300048911 | Ga0496108_0375467 | Ga0496108_0375467_435_704 | 89 |
| 206 | 3300048912 | Ga0496109_0181531 | Ga0496109_0181531_1147_1416 | 89 |
| 207 | 3300048913 | Ga0496110_0147684 | Ga0496110_0147684_580_849 | 89 |
| 208 | 3300048915 | Ga0496112_0095450 | Ga0496112_0095450_2202_2471 | 89 |
| 209 | 3300048916 | Ga0496113_0192678 | Ga0496113_0192678_1056_1325 | 89 |
| 210 | 3300049587 | Ga0501071_1377505 | Ga0501071_1377505_123_434 | 89 |
| 211 | 3300049588 | Ga0501072_1524003 | Ga0501072_1524003_144_416 | 89 |
| 212 | 3300050511 | nmdc:mga08y16_2106669_c1 | nmdc:mga08y16_2106669_c1_176_445 | 89 |
| 213 | 3300061719 | Ga0466962_0667280 | Ga0466962_0667280_171_443 | 89 |
| 214 | 3300061719 | Ga0466962_0740594 | Ga0466962_0740594_173_442 | 89 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar