F325004

General Info

Members Datasets Scaffolds Average Seq Length
214 132 214 88

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_102058902|Ga0068857_1020589022
Length 88
Sequence MSSRQLYRLRTPSTGREVLLPAEAGQTYRDHDTGEEMVIVGKVLPADSGSALPWSVENLRFCNWCDQLAQKDLNDCPHCGRRMAALPR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.48
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10476707 3300005327 Bacteria 1077
2 Ga0070683_100489779 3300005329 Unclassified 1174
3 Ga0068868_100169579 3300005338 Bacteria 1806
4 Ga0070660_100570054 3300005339 Bacteria 945
5 Ga0070691_10106343 3300005341 Bacteria 1399
6 Ga0070691_10239765 3300005341 Unclassified 968
7 Ga0070687_101165608 3300005343 Bacteria 567
8 Ga0070668_101368336 3300005347 Bacteria 645
9 Ga0070668_101732207 3300005347 Bacteria 574
10 Ga0070675_100329608 3300005354 Bacteria 1350
11 Ga0070674_100074000 3300005356 Bacteria 2416
12 Ga0070659_101179588 3300005366 Bacteria 677
13 Ga0070659_101507051 3300005366 Bacteria 599
14 Ga0070714_101358234 3300005435 Bacteria 694
15 Ga0070701_10147932 3300005438 Bacteria 1350
16 Ga0070705_101162413 3300005440 Bacteria 634
17 Ga0070700_100237651 3300005441 Bacteria 1300
18 Ga0068867_100144145 3300005459 Bacteria 1865
19 Ga0070707_101743493 3300005468 Bacteria 590
20 Ga0070684_100349523 3300005535 Bacteria 1360
21 Ga0070672_101551593 3300005543 Bacteria 594
22 Ga0070665_100339976 3300005548 Bacteria 1506
23 Ga0068857_102058902 3300005577 Bacteria 560
24 Ga0068854_100022145 3300005578 Bacteria 4323
25 Ga0068854_101671424 3300005578 Bacteria 582
26 Ga0070702_100028037 3300005615 Bacteria 3047
27 Ga0068852_101071510 3300005616 Bacteria 826
28 Ga0068852_101590169 3300005616 Unclassified 676
29 Ga0068859_100313399 3300005617 Bacteria 1663
30 Ga0068866_10244265 3300005718 Bacteria 1095
31 Ga0068866_10479257 3300005718 Unclassified 819
32 Ga0068866_10790566 3300005718 Bacteria 659
33 Ga0068861_100279401 3300005719 Unclassified 1437
34 Ga0068861_100648430 3300005719 Bacteria 975
35 Ga0068870_10380138 3300005840 Bacteria 914
36 Ga0068870_11059911 3300005840 Bacteria 581
37 Ga0068860_101487485 3300005843 Bacteria 699
38 Ga0068862_102089991 3300005844 Bacteria 577
39 Ga0081538_10012109 3300005981 Bacteria 6934
40 Ga0081538_10057883 3300005981 Bacteria 2253
41 Ga0070717_10588524 3300006028 Bacteria 1009
42 Ga0068865_100571584 3300006881 Bacteria 952
43 Ga0068865_100908405 3300006881 Unclassified 766
44 Ga0097620_100313386 3300006931 Bacteria 1663
45 Ga0111539_11582262 3300009094 Unclassified 760
46 Ga0111539_13475445 3300009094 Bacteria 506
47 Ga0111539_13530697 3300009094 Bacteria 501
48 Ga0105245_12406528 3300009098 Bacteria 580
49 Ga0105247_10218064 3300009101 Bacteria 1290
50 Ga0105243_11082146 3300009148 Bacteria 809
51 Ga0105241_12550473 3300009174 Bacteria 513
52 Ga0105242_11387255 3300009176 Unclassified 730
53 Ga0105248_11817135 3300009177 Bacteria 691
54 Ga0105249_12522453 3300009553 Bacteria 586
55 Ga0105239_11770595 3300010375 Bacteria 715
56 Ga0105246_10104026 3300011119 Bacteria 2073
57 Ga0163162_11406648 3300013306 Unclassified 794
58 Ga0157372_10475633 3300013307 Bacteria 1456
59 Ga0157375_10399464 3300013308 Bacteria 1541
60 Ga0163163_10743702 3300014325 Bacteria 1044
61 Ga0163163_12739861 3300014325 Bacteria 550
62 Ga0157380_10879337 3300014326 Bacteria 920
63 Ga0157380_12552665 3300014326 Unclassified 577
64 Ga0182008_10319550 3300014497 Bacteria 817
65 Ga0157377_10316063 3300014745 Unclassified 1036
66 Ga0213874_10057452 3300021377 Unclassified 1210
67 Ga0213874_10059819 3300021377 Bacteria 1191
68 Ga0213876_10093678 3300021384 Bacteria 1591
69 Ga0213875_10608289 3300021388 Bacteria 528
70 Ga0207642_10417745 3300025899 Unclassified 806
71 Ga0207642_10582059 3300025899 Bacteria 695
72 Ga0207688_10520848 3300025901 Bacteria 746
73 Ga0207688_10581734 3300025901 Bacteria 705
74 Ga0207643_10217324 3300025908 Bacteria 1169
75 Ga0207687_10200932 3300025927 Bacteria 1558
76 Ga0207706_10033264 3300025933 Bacteria 4591
77 Ga0207686_11561553 3300025934 Bacteria 545
78 Ga0207709_10077662 3300025935 Bacteria 2129
79 Ga0207709_10736671 3300025935 Unclassified 791
80 Ga0207669_10172602 3300025937 Bacteria 1541
81 Ga0207704_10070240 3300025938 Bacteria 2216
82 Ga0207704_10228092 3300025938 Bacteria 1383
83 Ga0207704_10825499 3300025938 Bacteria 775
84 Ga0207691_11382515 3300025940 Bacteria 579
85 Ga0207711_11994868 3300025941 Bacteria 523
86 Ga0207689_10271031 3300025942 Bacteria 1405
87 Ga0207712_10203816 3300025961 Bacteria 1570
88 Ga0207640_10066887 3300025981 Unclassified 2402
89 Ga0207640_10521877 3300025981 Bacteria 993
90 Ga0207677_11399472 3300026023 Unclassified 644
91 Ga0207708_10087099 3300026075 Bacteria 2404
92 Ga0207702_11227373 3300026078 Bacteria 744
93 Ga0207702_11749053 3300026078 Bacteria 614
94 Ga0207648_10207309 3300026089 Bacteria 1739
95 Ga0207675_100314307 3300026118 Bacteria 1528
96 Ga0207675_100534837 3300026118 Bacteria 1170
97 Ga0207698_11012721 3300026142 Bacteria 842
98 Ga0207698_11284164 3300026142 Unclassified 747
99 Ga0207428_10893919 3300027907 Unclassified 628
100 Ga0207428_11290246 3300027907 Bacteria 506
101 Ga0268266_10301144 3300028379 Bacteria 1496
102 Ga0268265_11646312 3300028380 Bacteria 647
103 Ga0307408_100846883 3300031548 Bacteria 833
104 Ga0307405_10061040 3300031731 Bacteria 2381
105 Ga0307405_11195122 3300031731 Bacteria 657
106 Ga0307405_11869555 3300031731 Bacteria 535
107 Ga0307413_10122471 3300031824 Bacteria 1764
108 Ga0307410_10232615 3300031852 Bacteria 1424
109 Ga0307410_10327594 3300031852 Bacteria 1217
110 Ga0307406_10369465 3300031901 Bacteria 1127
111 Ga0307406_10414607 3300031901 Bacteria 1071
112 Ga0307406_10420208 3300031901 Bacteria 1065
113 Ga0307406_10976492 3300031901 Bacteria 725
114 Ga0307407_10066192 3300031903 Bacteria 2130
115 Ga0307412_11087828 3300031911 Unclassified 711
116 Ga0307412_12246570 3300031911 Bacteria 508
117 Ga0307409_100290319 3300031995 Bacteria 1516
118 Ga0307409_100331021 3300031995 Bacteria 1429
119 Ga0307409_100480817 3300031995 Unclassified 1205
120 Ga0307409_101695532 3300031995 Bacteria 661
121 Ga0307416_100006509 3300032002 Bacteria 7320
122 Ga0307416_100050251 3300032002 Bacteria 3323
123 Ga0307416_100148810 3300032002 Bacteria 2143
124 Ga0307414_10101552 3300032004 Bacteria 2166
125 Ga0307414_10324018 3300032004 Bacteria 1313
126 Ga0307414_11338921 3300032004 Bacteria 665
127 Ga0307411_10354824 3300032005 Bacteria 1197
128 Ga0307411_11926980 3300032005 Bacteria 550
129 Ga0307415_100032667 3300032126 Bacteria 3369
130 Ga0307415_100082748 3300032126 Bacteria 2297
131 Ga0307415_100388594 3300032126 Bacteria 1187
132 Ga0307415_101218001 3300032126 Bacteria 710
133 Ga0436364_0080999 3300037853 Bacteria 13062
134 Ga0436364_0190011 3300037853 Bacteria 14208
135 Ga0436364_0280406 3300037853 Bacteria 978
136 Ga0436364_0499706 3300037853 Bacteria 930
137 Ga0436364_0513382 3300037853 Unclassified 700
138 Ga0436364_0841868 3300037853 Bacteria 2881
139 Ga0436364_1557863 3300037853 Bacteria 1105
140 Ga0395901_0679138 3300038443 Unclassified 1030
141 Ga0395901_0790467 3300038443 Bacteria 939
142 Ga0395901_1873628 3300038443 Bacteria 548
143 Ga0436365_0151332 3300039437 Bacteria 634
144 Ga0436365_1219508 3300039437 Bacteria 3973
145 Ga0436365_1318646 3300039437 Bacteria 21341
146 Ga0436365_1401350 3300039437 Bacteria 857
147 Ga0436363_0116001 3300039450 Bacteria 48959
148 Ga0436363_0241385 3300039450 Bacteria 2304
149 Ga0436363_0349934 3300039450 Unclassified 1599
150 Ga0436363_0667731 3300039450 Bacteria 567
151 Ga0436363_0841207 3300039450 Unclassified 1051
152 Ga0436363_1333975 3300039450 Bacteria 1098
153 Ga0436363_1485398 3300039450 Unclassified 896
154 Ga0436362_0319411 3300039453 Unclassified 519
155 Ga0436362_0551343 3300039453 Bacteria 2228
156 Ga0436362_1237332 3300039453 Bacteria 1160
157 Ga0451797_0909708 3300041453 Bacteria 1022
158 Ga0451835_0242547 3300041492 Unclassified 698
159 Ga0439459_0165704 3300042438 Bacteria 586
160 Ga0466972_0071289 3300044658 Unclassified 1658
161 Ga0466965_0129862 3300044683 Bacteria 1306
162 Ga0466965_0325498 3300044683 Bacteria 838
163 Ga0466965_0911114 3300044683 Bacteria 513
164 Ga0466966_0266507 3300044684 Bacteria 1031
165 Ga0466961_0387498 3300044693 Bacteria 849
166 Ga0466963_0492228 3300044694 Bacteria 866
167 Ga0466960_0470819 3300044901 Bacteria 733
168 Ga0466960_0610274 3300044901 Bacteria 648
169 Ga0466959_0089921 3300045049 Bacteria 2206
170 Ga0466959_0124459 3300045049 Unclassified 1831
171 Ga0466959_0226484 3300045049 Unclassified 1295
172 Ga0466959_0538400 3300045049 Bacteria 788
173 Ga0466959_0588143 3300045049 Bacteria 749
174 Ga0466958_0008834 3300045836 Bacteria 5599
175 Ga0466958_0339955 3300045836 Bacteria 966
176 Ga0466967_0084278 3300045976 Bacteria 2876
177 Ga0466967_0112435 3300045976 Bacteria 2504
178 Ga0466967_0405935 3300045976 Bacteria 1326
179 Ga0466967_0454499 3300045976 Bacteria 1252
180 Ga0466967_0555682 3300045976 Bacteria 1130
181 Ga0466967_2607521 3300045976 Bacteria 500
182 Ga0495629_0206293 3300046459 Bacteria 1358
183 Ga0495639_0501130 3300046475 Bacteria 620
184 Ga0495596_0348815 3300046500 Bacteria 576
185 Ga0495596_0409312 3300046500 Bacteria 529
186 Ga0495589_0397341 3300046794 Bacteria 633
187 Ga0495581_0862939 3300047315 Bacteria 518
188 Ga0495604_0001583 3300047317 Bacteria 18739
189 Ga0495676_1071863 3300047321 Bacteria 513
190 Ga0495684_0239025 3300047471 Bacteria 1326
191 Ga0496100_0700931 3300048903 Unclassified 790
192 Ga0496101_0277683 3300048904 Bacteria 1309
193 Ga0496102_0360335 3300048905 Unclassified 1369
194 Ga0496104_0000093 3300048907 Bacteria 87156
195 Ga0496105_0319197 3300048908 Bacteria 1245
196 Ga0496106_0101093 3300048909 Bacteria 2236
197 Ga0496107_0413903 3300048910 Bacteria 1002
198 Ga0496108_0232811 3300048911 Bacteria 1602
199 Ga0496108_0375467 3300048911 Bacteria 1241
200 Ga0496109_0181531 3300048912 Bacteria 1977
201 Ga0496110_0009548 3300048913 Bacteria 7853
202 Ga0496110_0147684 3300048913 Bacteria 2128
203 Ga0496111_0000033 3300048914 Bacteria 55040
204 Ga0496112_0095450 3300048915 Bacteria 2944
205 Ga0496113_0192678 3300048916 Bacteria 1618
206 Ga0501071_1377505 3300049587 Bacteria 545
207 Ga0501072_1524003 3300049588 Bacteria 516
208 nmdc:mga0qj67_1009674_c1 3300050509 Bacteria 652
209 nmdc:mga08y16_1497686_c1 3300050511 Unclassified 635
210 nmdc:mga08y16_2106669_c1 3300050511 Unclassified 512
211 Ga0495619_0300438 3300053085 Bacteria 1112
212 Ga0495619_1209108 3300053085 Bacteria 500
213 Ga0466962_0667280 3300061719 Bacteria 532
214 Ga0466962_0740594 3300061719 Bacteria 505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0206293 Ga0495629_0206293_23_253 71
2 3300005435 Ga0070714_101358234 Ga0070714_1013582341 81
3 3300006028 Ga0070717_10588524 Ga0070717_105885242 81
4 3300021377 Ga0213874_10057452 Ga0213874_100574522 81
5 3300021377 Ga0213874_10059819 Ga0213874_100598193 81
6 3300021384 Ga0213876_10093678 Ga0213876_100936783 81
7 3300021388 Ga0213875_10608289 Ga0213875_106082891 81
8 3300026078 Ga0207702_11749053 Ga0207702_117490532 81
9 3300037853 Ga0436364_0190011 Ga0436364_0190011_1889_2134 81
10 3300037853 Ga0436364_0499706 Ga0436364_0499706_75_320 81
11 3300037853 Ga0436364_0513382 Ga0436364_0513382_308_553 81
12 3300037853 Ga0436364_0841868 Ga0436364_0841868_1718_1963 81
13 3300038443 Ga0395901_1873628 Ga0395901_1873628_187_432 81
14 3300039437 Ga0436365_0151332 Ga0436365_0151332_22_267 81
15 3300039437 Ga0436365_1219508 Ga0436365_1219508_1292_1537 81
16 3300039450 Ga0436363_0116001 Ga0436363_0116001_1740_1985 81
17 3300039450 Ga0436363_0241385 Ga0436363_0241385_1375_1620 81
18 3300039450 Ga0436363_0349934 Ga0436363_0349934_418_663 81
19 3300039450 Ga0436363_0841207 Ga0436363_0841207_378_623 81
20 3300039453 Ga0436362_1237332 Ga0436362_1237332_721_966 81
21 3300041492 Ga0451835_0242547 Ga0451835_0242547_421_675 81
22 3300044658 Ga0466972_0071289 Ga0466972_0071289_677_922 81
23 3300044683 Ga0466965_0129862 Ga0466965_0129862_904_1149 81
24 3300044901 Ga0466960_0610274 Ga0466960_0610274_292_537 81
25 3300045049 Ga0466959_0124459 Ga0466959_0124459_977_1222 81
26 3300045049 Ga0466959_0226484 Ga0466959_0226484_532_777 81
27 3300045049 Ga0466959_0538400 Ga0466959_0538400_110_355 81
28 3300045976 Ga0466967_2607521 Ga0466967_2607521_182_427 81
29 3300053085 Ga0495619_1209108 Ga0495619_1209108_236_481 81
30 3300011119 Ga0105246_10104026 Ga0105246_101040262 86
31 3300032004 Ga0307414_11338921 Ga0307414_113389212 86
32 3300039450 Ga0436363_0667731 Ga0436363_0667731_61_324 86
33 3300050511 nmdc:mga08y16_1497686_c1 nmdc:mga08y16_1497686_c1_226_501 86
34 3300009177 Ga0105248_11817135 Ga0105248_118171351 87
35 3300014325 Ga0163163_12739861 Ga0163163_127398612 87
36 3300025941 Ga0207711_11994868 Ga0207711_119948681 87
37 3300026078 Ga0207702_11227373 Ga0207702_112273732 87
38 3300031852 Ga0307410_10232615 Ga0307410_102326152 87
39 3300031901 Ga0307406_10420208 Ga0307406_104202082 87
40 3300031995 Ga0307409_100480817 Ga0307409_1004808173 87
41 3300032004 Ga0307414_10324018 Ga0307414_103240182 87
42 3300041453 Ga0451797_0909708 Ga0451797_0909708_606_869 87
43 3300046500 Ga0495596_0409312 Ga0495596_0409312_255_518 87
44 3300050509 nmdc:mga0qj67_1009674_c1 nmdc:mga0qj67_1009674_c1_214_477 87
45 3300005468 Ga0070707_101743493 Ga0070707_1017434931 88
46 3300005577 Ga0068857_102058902 Ga0068857_1020589022 88
47 3300009098 Ga0105245_12406528 Ga0105245_124065281 88
48 3300009174 Ga0105241_12550473 Ga0105241_125504731 88
49 3300038443 Ga0395901_0790467 Ga0395901_0790467_467_733 88
50 3300046475 Ga0495639_0501130 Ga0495639_0501130_101_367 88
51 3300046794 Ga0495589_0397341 Ga0495589_0397341_302_568 88
52 3300047321 Ga0495676_1071863 Ga0495676_1071863_210_476 88
53 3300047471 Ga0495684_0239025 Ga0495684_0239025_782_1048 88
54 3300048907 Ga0496104_0000093 Ga0496104_0000093_40382_40648 88
55 3300048908 Ga0496105_0319197 Ga0496105_0319197_365_631 88
56 3300048913 Ga0496110_0009548 Ga0496110_0009548_6811_7077 88
57 3300048914 Ga0496111_0000033 Ga0496111_0000033_41103_41369 88
58 3300053085 Ga0495619_0300438 Ga0495619_0300438_92_358 88
59 3300005327 Ga0070658_10476707 Ga0070658_104767072 89
60 3300005329 Ga0070683_100489779 Ga0070683_1004897792 89
61 3300005338 Ga0068868_100169579 Ga0068868_1001695792 89
62 3300005339 Ga0070660_100570054 Ga0070660_1005700542 89
63 3300005341 Ga0070691_10106343 Ga0070691_101063431 89
64 3300005341 Ga0070691_10239765 Ga0070691_102397652 89
65 3300005343 Ga0070687_101165608 Ga0070687_1011656081 89
66 3300005347 Ga0070668_101368336 Ga0070668_1013683361 89
67 3300005347 Ga0070668_101732207 Ga0070668_1017322071 89
68 3300005354 Ga0070675_100329608 Ga0070675_1003296082 89
69 3300005356 Ga0070674_100074000 Ga0070674_1000740003 89
70 3300005366 Ga0070659_101179588 Ga0070659_1011795882 89
71 3300005366 Ga0070659_101507051 Ga0070659_1015070512 89
72 3300005438 Ga0070701_10147932 Ga0070701_101479322 89
73 3300005440 Ga0070705_101162413 Ga0070705_1011624132 89
74 3300005441 Ga0070700_100237651 Ga0070700_1002376512 89
75 3300005459 Ga0068867_100144145 Ga0068867_1001441453 89
76 3300005535 Ga0070684_100349523 Ga0070684_1003495231 89
77 3300005543 Ga0070672_101551593 Ga0070672_1015515931 89
78 3300005548 Ga0070665_100339976 Ga0070665_1003399762 89
79 3300005578 Ga0068854_100022145 Ga0068854_1000221455 89
80 3300005578 Ga0068854_101671424 Ga0068854_1016714242 89
81 3300005615 Ga0070702_100028037 Ga0070702_1000280372 89
82 3300005616 Ga0068852_101071510 Ga0068852_1010715102 89
83 3300005616 Ga0068852_101590169 Ga0068852_1015901692 89
84 3300005617 Ga0068859_100313399 Ga0068859_1003133992 89
85 3300005718 Ga0068866_10244265 Ga0068866_102442652 89
86 3300005718 Ga0068866_10479257 Ga0068866_104792572 89
87 3300005718 Ga0068866_10790566 Ga0068866_107905662 89
88 3300005719 Ga0068861_100279401 Ga0068861_1002794012 89
89 3300005719 Ga0068861_100648430 Ga0068861_1006484302 89
90 3300005840 Ga0068870_10380138 Ga0068870_103801382 89
91 3300005840 Ga0068870_11059911 Ga0068870_110599112 89
92 3300005843 Ga0068860_101487485 Ga0068860_1014874852 89
93 3300005844 Ga0068862_102089991 Ga0068862_1020899912 89
94 3300005981 Ga0081538_10012109 Ga0081538_100121096 89
95 3300005981 Ga0081538_10057883 Ga0081538_100578832 89
96 3300006881 Ga0068865_100571584 Ga0068865_1005715843 89
97 3300006881 Ga0068865_100908405 Ga0068865_1009084052 89
98 3300006931 Ga0097620_100313386 Ga0097620_1003133862 89
99 3300009094 Ga0111539_11582262 Ga0111539_115822622 89
100 3300009094 Ga0111539_13475445 Ga0111539_134754452 89
101 3300009094 Ga0111539_13530697 Ga0111539_135306972 89
102 3300009101 Ga0105247_10218064 Ga0105247_102180642 89
103 3300009148 Ga0105243_11082146 Ga0105243_110821461 89
104 3300009176 Ga0105242_11387255 Ga0105242_113872552 89
105 3300009553 Ga0105249_12522453 Ga0105249_125224532 89
106 3300010375 Ga0105239_11770595 Ga0105239_117705952 89
107 3300013306 Ga0163162_11406648 Ga0163162_114066482 89
108 3300013307 Ga0157372_10475633 Ga0157372_104756333 89
109 3300013308 Ga0157375_10399464 Ga0157375_103994642 89
110 3300014325 Ga0163163_10743702 Ga0163163_107437022 89
111 3300014326 Ga0157380_10879337 Ga0157380_108793372 89
112 3300014326 Ga0157380_12552665 Ga0157380_125526652 89
113 3300014497 Ga0182008_10319550 Ga0182008_103195502 89
114 3300014745 Ga0157377_10316063 Ga0157377_103160632 89
115 3300025899 Ga0207642_10417745 Ga0207642_104177452 89
116 3300025899 Ga0207642_10582059 Ga0207642_105820592 89
117 3300025901 Ga0207688_10520848 Ga0207688_105208482 89
118 3300025901 Ga0207688_10581734 Ga0207688_105817342 89
119 3300025908 Ga0207643_10217324 Ga0207643_102173242 89
120 3300025927 Ga0207687_10200932 Ga0207687_102009322 89
121 3300025933 Ga0207706_10033264 Ga0207706_100332643 89
122 3300025934 Ga0207686_11561553 Ga0207686_115615531 89
123 3300025935 Ga0207709_10077662 Ga0207709_100776622 89
124 3300025935 Ga0207709_10736671 Ga0207709_107366711 89
125 3300025937 Ga0207669_10172602 Ga0207669_101726022 89
126 3300025938 Ga0207704_10070240 Ga0207704_100702402 89
127 3300025938 Ga0207704_10228092 Ga0207704_102280922 89
128 3300025938 Ga0207704_10825499 Ga0207704_108254992 89
129 3300025940 Ga0207691_11382515 Ga0207691_113825151 89
130 3300025942 Ga0207689_10271031 Ga0207689_102710312 89
131 3300025961 Ga0207712_10203816 Ga0207712_102038162 89
132 3300025981 Ga0207640_10066887 Ga0207640_100668872 89
133 3300025981 Ga0207640_10521877 Ga0207640_105218772 89
134 3300026023 Ga0207677_11399472 Ga0207677_113994722 89
135 3300026075 Ga0207708_10087099 Ga0207708_100870993 89
136 3300026089 Ga0207648_10207309 Ga0207648_102073093 89
137 3300026118 Ga0207675_100314307 Ga0207675_1003143073 89
138 3300026118 Ga0207675_100534837 Ga0207675_1005348372 89
139 3300026142 Ga0207698_11012721 Ga0207698_110127212 89
140 3300026142 Ga0207698_11284164 Ga0207698_112841642 89
141 3300027907 Ga0207428_10893919 Ga0207428_108939192 89
142 3300027907 Ga0207428_11290246 Ga0207428_112902462 89
143 3300028379 Ga0268266_10301144 Ga0268266_103011442 89
144 3300028380 Ga0268265_11646312 Ga0268265_116463122 89
145 3300031548 Ga0307408_100846883 Ga0307408_1008468832 89
146 3300031731 Ga0307405_10061040 Ga0307405_100610402 89
147 3300031731 Ga0307405_11195122 Ga0307405_111951222 89
148 3300031731 Ga0307405_11869555 Ga0307405_118695551 89
149 3300031824 Ga0307413_10122471 Ga0307413_101224712 89
150 3300031852 Ga0307410_10327594 Ga0307410_103275942 89
151 3300031901 Ga0307406_10369465 Ga0307406_103694652 89
152 3300031901 Ga0307406_10414607 Ga0307406_104146072 89
153 3300031901 Ga0307406_10976492 Ga0307406_109764922 89
154 3300031903 Ga0307407_10066192 Ga0307407_100661922 89
155 3300031911 Ga0307412_11087828 Ga0307412_110878282 89
156 3300031911 Ga0307412_12246570 Ga0307412_122465702 89
157 3300031995 Ga0307409_100290319 Ga0307409_1002903192 89
158 3300031995 Ga0307409_100331021 Ga0307409_1003310213 89
159 3300031995 Ga0307409_101695532 Ga0307409_1016955322 89
160 3300032002 Ga0307416_100006509 Ga0307416_1000065092 89
161 3300032002 Ga0307416_100050251 Ga0307416_1000502513 89
162 3300032002 Ga0307416_100148810 Ga0307416_1001488102 89
163 3300032004 Ga0307414_10101552 Ga0307414_101015522 89
164 3300032005 Ga0307411_10354824 Ga0307411_103548242 89
165 3300032005 Ga0307411_11926980 Ga0307411_119269802 89
166 3300032126 Ga0307415_100032667 Ga0307415_1000326674 89
167 3300032126 Ga0307415_100082748 Ga0307415_1000827482 89
168 3300032126 Ga0307415_100388594 Ga0307415_1003885942 89
169 3300032126 Ga0307415_101218001 Ga0307415_1012180012 89
170 3300037853 Ga0436364_0080999 Ga0436364_0080999_10607_10876 89
171 3300037853 Ga0436364_0280406 Ga0436364_0280406_495_764 89
172 3300037853 Ga0436364_1557863 Ga0436364_1557863_758_1027 89
173 3300038443 Ga0395901_0679138 Ga0395901_0679138_32_310 89
174 3300039437 Ga0436365_1318646 Ga0436365_1318646_872_1141 89
175 3300039437 Ga0436365_1401350 Ga0436365_1401350_381_650 89
176 3300039450 Ga0436363_1333975 Ga0436363_1333975_174_443 89
177 3300039450 Ga0436363_1485398 Ga0436363_1485398_28_297 89
178 3300039453 Ga0436362_0319411 Ga0436362_0319411_144_413 89
179 3300039453 Ga0436362_0551343 Ga0436362_0551343_459_728 89
180 3300042438 Ga0439459_0165704 Ga0439459_0165704_115_384 89
181 3300044683 Ga0466965_0325498 Ga0466965_0325498_390_659 89
182 3300044683 Ga0466965_0911114 Ga0466965_0911114_194_463 89
183 3300044684 Ga0466966_0266507 Ga0466966_0266507_184_453 89
184 3300044693 Ga0466961_0387498 Ga0466961_0387498_119_388 89
185 3300044694 Ga0466963_0492228 Ga0466963_0492228_240_509 89
186 3300044901 Ga0466960_0470819 Ga0466960_0470819_451_720 89
187 3300045049 Ga0466959_0089921 Ga0466959_0089921_1796_2065 89
188 3300045049 Ga0466959_0588143 Ga0466959_0588143_339_608 89
189 3300045836 Ga0466958_0008834 Ga0466958_0008834_2253_2522 89
190 3300045836 Ga0466958_0339955 Ga0466958_0339955_178_447 89
191 3300045976 Ga0466967_0084278 Ga0466967_0084278_338_607 89
192 3300045976 Ga0466967_0112435 Ga0466967_0112435_2170_2439 89
193 3300045976 Ga0466967_0405935 Ga0466967_0405935_755_1024 89
194 3300045976 Ga0466967_0454499 Ga0466967_0454499_284_556 89
195 3300045976 Ga0466967_0555682 Ga0466967_0555682_655_927 89
196 3300046500 Ga0495596_0348815 Ga0495596_0348815_145_414 89
197 3300047315 Ga0495581_0862939 Ga0495581_0862939_237_506 89
198 3300047317 Ga0495604_0001583 Ga0495604_0001583_10924_11199 89
199 3300048903 Ga0496100_0700931 Ga0496100_0700931_37_306 89
200 3300048904 Ga0496101_0277683 Ga0496101_0277683_636_905 89
201 3300048905 Ga0496102_0360335 Ga0496102_0360335_513_782 89
202 3300048909 Ga0496106_0101093 Ga0496106_0101093_1417_1686 89
203 3300048910 Ga0496107_0413903 Ga0496107_0413903_646_915 89
204 3300048911 Ga0496108_0232811 Ga0496108_0232811_63_332 89
205 3300048911 Ga0496108_0375467 Ga0496108_0375467_435_704 89
206 3300048912 Ga0496109_0181531 Ga0496109_0181531_1147_1416 89
207 3300048913 Ga0496110_0147684 Ga0496110_0147684_580_849 89
208 3300048915 Ga0496112_0095450 Ga0496112_0095450_2202_2471 89
209 3300048916 Ga0496113_0192678 Ga0496113_0192678_1056_1325 89
210 3300049587 Ga0501071_1377505 Ga0501071_1377505_123_434 89
211 3300049588 Ga0501072_1524003 Ga0501072_1524003_144_416 89
212 3300050511 nmdc:mga08y16_2106669_c1 nmdc:mga08y16_2106669_c1_176_445 89
213 3300061719 Ga0466962_0667280 Ga0466962_0667280_171_443 89
214 3300061719 Ga0466962_0740594 Ga0466962_0740594_173_442 89

Feature Viewer

pLDDT pTM Quality
87.77 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map