F324261

General Info

Members Datasets Scaffolds Average Seq Length
213 131 422 185

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0225319|Ga0373937_0225319_598_1146
Length 182
Sequence MSTKTEATVDDLYRVPEHGKAELVNGELVLMSPTGGVPGRAAGEIYVSLREYERRVGGYAFPDNVGFIVNLPNRRSFSPEAAFYKAELRGGLFLEGAPIFAVEVQSEEDYGPAAEKKMALKRADYFAAGSLVVWDVDVLRAKVVHVYRASEPNSPTIYQVDQIAEAEPAVPGWSVSVRQIFS

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 26.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0225319 3300036401 Bacteria 1765
2 JGI25406J46586_10063273 3300003203 Bacteria 1185
3 Ga0065704_10127159 3300005289 Unclassified 1672
4 Ga0065704_10154145 3300005289 Bacteria 1405
5 Ga0065715_10027153 3300005293 Bacteria 2634
6 Ga0065715_10122078 3300005293 Bacteria 2214
7 Ga0065707_10020486 3300005295 Bacteria 1585
8 Ga0065707_10261007 3300005295 Bacteria 1097
9 Ga0070676_10544163 3300005328 Bacteria 830
10 Ga0070690_100069751 3300005330 Bacteria 2281
11 Ga0070690_100075411 3300005330 Bacteria 2198
12 Ga0070690_100106716 3300005330 Bacteria 1863
13 Ga0070690_100155541 3300005330 Bacteria 1563
14 Ga0068869_100346197 3300005334 Unclassified 1210
15 Ga0070680_100000051 3300005336 Bacteria 59953
16 Ga0068868_100019750 3300005338 Bacteria 5053
17 Ga0070689_100027927 3300005340 Bacteria 4260
18 Ga0070687_100098426 3300005343 Bacteria 1633
19 Ga0070692_10054017 3300005345 Bacteria 2096
20 Ga0070669_100052043 3300005353 Bacteria 2995
21 Ga0070669_100066010 3300005353 Bacteria 2666
22 Ga0070669_100865767 3300005353 Bacteria 770
23 Ga0070675_100222364 3300005354 Unclassified 1645
24 Ga0070674_100859916 3300005356 Bacteria 787
25 Ga0070673_100564880 3300005364 Unclassified 1035
26 Ga0070673_100672137 3300005364 Bacteria 949
27 Ga0070688_100057086 3300005365 Bacteria 2452
28 Ga0070667_100341227 3300005367 Unclassified 1355
29 Ga0070703_10002955 3300005406 Bacteria 4856
30 Ga0070709_10001715 3300005434 Bacteria 11916
31 Ga0070713_101656478 3300005436 Unclassified 621
32 Ga0070701_10179267 3300005438 Bacteria 1239
33 Ga0070711_100000021 3300005439 Bacteria 122874
34 Ga0070705_100001693 3300005440 Bacteria 11513
35 Ga0070694_100145739 3300005444 Bacteria 1724
36 Ga0070708_100000664 3300005445 Bacteria 26079
37 Ga0070708_100018471 3300005445 Bacteria 5836
38 Ga0070708_100311988 3300005445 Bacteria 1481
39 Ga0070708_100686646 3300005445 Bacteria 964
40 Ga0070678_100293728 3300005456 Unclassified 1379
41 Ga0070681_10001505 3300005458 Bacteria 20633
42 Ga0070685_10013032 3300005466 Bacteria 4378
43 Ga0070706_100000248 3300005467 Bacteria 65930
44 Ga0070706_100004064 3300005467 Bacteria 14224
45 Ga0070706_100141953 3300005467 Bacteria 2242
46 Ga0070706_100671062 3300005467 Bacteria 962
47 Ga0070706_101134683 3300005467 Bacteria 719
48 Ga0070707_100571503 3300005468 Bacteria 1093
49 Ga0070698_100003110 3300005471 Bacteria 18295
50 Ga0070698_100058742 3300005471 Bacteria 3888
51 Ga0070698_100662411 3300005471 Unclassified 985
52 Ga0070699_100004296 3300005518 Bacteria 12592
53 Ga0070699_100705134 3300005518 Unclassified 922
54 Ga0070699_100774494 3300005518 Bacteria 878
55 Ga0070699_101246549 3300005518 Unclassified 682
56 Ga0070679_100000319 3300005530 Bacteria 40705
57 Ga0070697_100013186 3300005536 Bacteria 6480
58 Ga0070697_100374687 3300005536 Bacteria 1232
59 Ga0070672_100050140 3300005543 Bacteria 3250
60 Ga0070686_100066853 3300005544 Archaea 2340
61 Ga0070695_101125309 3300005545 Unclassified 643
62 Ga0070696_100115796 3300005546 Bacteria 1935
63 Ga0070704_100741602 3300005549 Unclassified 874
64 Ga0068857_100098454 3300005577 Bacteria 2623
65 Ga0068854_100598240 3300005578 Bacteria 941
66 Ga0068856_100032442 3300005614 Bacteria 5113
67 Ga0070702_100024428 3300005615 Bacteria 3224
68 Ga0070702_100231899 3300005615 Bacteria 1241
69 Ga0068859_100224526 3300005617 Unclassified 1966
70 Ga0068864_100167499 3300005618 Unclassified 2001
71 Ga0068864_101289484 3300005618 Unclassified 731
72 Ga0068866_10036782 3300005718 Archaea 2400
73 Ga0068861_100034426 3300005719 Bacteria 3745
74 Ga0068861_100090378 3300005719 Bacteria 2415
75 Ga0068861_100210354 3300005719 Unclassified 1638
76 Ga0068863_100435319 3300005841 Unclassified 1286
77 Ga0068862_100033697 3300005844 Bacteria 4331
78 Ga0068862_100064068 3300005844 Bacteria 3163
79 Ga0068862_100081347 3300005844 Bacteria 2810
80 Ga0081539_10001754 3300005985 Bacteria 34587
81 Ga0081539_10066649 3300005985 Bacteria 1950
82 Ga0070716_100056372 3300006173 Unclassified 2253
83 Ga0070716_100472649 3300006173 Unclassified 919
84 Ga0097621_100260008 3300006237 Unclassified 1522
85 Ga0097621_100801827 3300006237 Unclassified 872
86 Ga0068871_100060989 3300006358 Bacteria 3078
87 Ga0068871_100114144 3300006358 Bacteria 2275
88 Ga0068871_100721267 3300006358 Unclassified 915
89 Ga0075428_100110213 3300006844 Bacteria 2999
90 Ga0075433_10251455 3300006852 Bacteria 1568
91 Ga0075433_10342064 3300006852 Unclassified 1322
92 Ga0075433_10376459 3300006852 Bacteria 1254
93 Ga0075433_10450968 3300006852 Bacteria 1134
94 Ga0075434_100008511 3300006871 Bacteria 9541
95 Ga0075434_100198174 3300006871 Bacteria 2028
96 Ga0075434_100405787 3300006871 Unclassified 1384
97 Ga0075434_100837750 3300006871 Unclassified 935
98 Ga0075429_100033523 3300006880 Bacteria 4463
99 Ga0075429_100042258 3300006880 Bacteria 3968
100 Ga0075429_100057363 3300006880 Bacteria 3390
101 Ga0068865_100531192 3300006881 Bacteria 985
102 Ga0075436_100146639 3300006914 Bacteria 1660
103 Ga0097620_100224543 3300006931 Unclassified 1966
104 Ga0111539_10290539 3300009094 Bacteria 1902
105 Ga0114129_10013602 3300009147 Bacteria 11597
106 Ga0114129_10087225 3300009147 Unclassified 4328
107 Ga0114129_10113325 3300009147 Bacteria 3739
108 Ga0114129_10261963 3300009147 Unclassified 2317
109 Ga0114129_10337241 3300009147 Bacteria 2001
110 Ga0105243_10029943 3300009148 Bacteria 4189
111 Ga0105243_10228422 3300009148 Bacteria 1650
112 Ga0105243_10744996 3300009148 Bacteria 960
113 Ga0105241_10195556 3300009174 Unclassified 1686
114 Ga0105241_10280777 3300009174 Unclassified 1422
115 Ga0105242_10037812 3300009176 Bacteria 3879
116 Ga0105242_10084623 3300009176 Bacteria 2658
117 Ga0105242_11154896 3300009176 Bacteria 791
118 Ga0105248_10018136 3300009177 Bacteria 7771
119 Ga0105248_10891575 3300009177 Unclassified 1004
120 Ga0105237_10053409 3300009545 Unclassified 4053
121 Ga0105249_10044488 3300009553 Bacteria 4037
122 Ga0105249_10112050 3300009553 Bacteria 2580
123 Ga0105249_10920575 3300009553 Bacteria 942
124 Ga0099796_10195110 3300010159 Unclassified 819
125 Ga0105239_10525165 3300010375 Bacteria 1347
126 Ga0157374_10771138 3300013296 Unclassified 977
127 Ga0157378_10051212 3300013297 Archaea 3674
128 Ga0157378_10156661 3300013297 Bacteria 2127
129 Ga0163162_11203726 3300013306 Unclassified 860
130 Ga0157375_10402667 3300013308 Bacteria 1535
131 Ga0157375_11284629 3300013308 Bacteria 860
132 Ga0163163_10412987 3300014325 Bacteria 1408
133 Ga0163163_10920416 3300014325 Unclassified 938
134 Ga0157380_10000792 3300014326 Bacteria 19855
135 Ga0157380_10001459 3300014326 Bacteria 15470
136 Ga0157380_10098579 3300014326 Bacteria 2428
137 Ga0157380_10480852 3300014326 Bacteria 1201
138 Ga0157380_10617352 3300014326 Unclassified 1076
139 Ga0157377_10026026 3300014745 Bacteria 3126
140 Ga0157379_10995905 3300014968 Unclassified 799
141 Ga0157376_10008867 3300014969 Bacteria 7279
142 Ga0157376_11104889 3300014969 Unclassified 819
143 Ga0163161_10040098 3300017792 Bacteria 3363
144 Ga0213875_10087223 3300021388 Unclassified 1455
145 Ga0207697_10107607 3300025315 Bacteria 1192
146 Ga0207653_10000022 3300025885 Bacteria 126662
147 Ga0207642_10004969 3300025899 Bacteria 4310
148 Ga0207699_10007777 3300025906 Bacteria 5251
149 Ga0207645_10379614 3300025907 Bacteria 948
150 Ga0207645_10500310 3300025907 Unclassified 823
151 Ga0207684_10000049 3300025910 Bacteria 240008
152 Ga0207707_10000008 3300025912 Bacteria 330313
153 Ga0207663_10000004 3300025916 Bacteria 294638
154 Ga0207660_10000118 3300025917 Bacteria 45983
155 Ga0207649_10134248 3300025920 Unclassified 1685
156 Ga0207652_10000065 3300025921 Bacteria 111252
157 Ga0207646_10077598 3300025922 Unclassified 2968
158 Ga0207681_10660186 3300025923 Unclassified 867
159 Ga0207709_10045792 3300025935 Bacteria 2651
160 Ga0207665_10147387 3300025939 Bacteria 1683
161 Ga0207665_10209423 3300025939 Bacteria 1423
162 Ga0207665_10587139 3300025939 Bacteria 869
163 Ga0207691_10001453 3300025940 Bacteria 23591
164 Ga0207711_10064114 3300025941 Bacteria 3173
165 Ga0207689_10056615 3300025942 Bacteria 3227
166 Ga0207651_10469779 3300025960 Unclassified 1082
167 Ga0207712_10210517 3300025961 Bacteria 1548
168 Ga0207712_11047067 3300025961 Unclassified 725
169 Ga0207677_10017973 3300026023 Bacteria 4233
170 Ga0207677_10039217 3300026023 Archaea 3113
171 Ga0207703_10782422 3300026035 Unclassified 910
172 Ga0207708_10361447 3300026075 Unclassified 1193
173 Ga0207708_10413039 3300026075 Bacteria 1118
174 Ga0207641_10087383 3300026088 Bacteria 2720
175 Ga0207648_10082001 3300026089 Bacteria 2812
176 Ga0207648_11213685 3300026089 Bacteria 708
177 Ga0207675_100005648 3300026118 Bacteria 11974
178 Ga0207675_100006359 3300026118 Bacteria 11198
179 Ga0207675_100259332 3300026118 Unclassified 1684
180 Ga0207428_10862752 3300027907 Bacteria 641
181 Ga0268265_10038411 3300028380 Bacteria 3522
182 Ga0268265_10214162 3300028380 Unclassified 1681
183 Ga0395900_0802353 3300037418 Bacteria 869
184 Ga0395905_0163189 3300037471 Bacteria 2094
185 Ga0436364_0759175 3300037853 Bacteria 10774
186 Ga0436364_0927397 3300037853 Unclassified 1317
187 Ga0395901_0587321 3300038443 Bacteria 1125
188 Ga0436363_0292089 3300039450 Bacteria 1485
189 Ga0439436_0068406 3300041404 Unclassified 991
190 Ga0439462_0046705 3300042015 Unclassified 1160
191 Ga0439435_0030940 3300042436 Bacteria 1453
192 Ga0439460_0010050 3300042461 Bacteria 2414
193 Ga0496102_0087217 3300048905 Bacteria 2883
194 Ga0496103_0307352 3300048906 Unclassified 1020
195 Ga0501298_134192 3300049521 Bacteria 594
196 Ga0501045_0537640 3300049824 Unclassified 867
197 nmdc:mga05p37_28_c1 3300050507 Bacteria 114869
198 nmdc:mga05p37_331906_c1 3300050507 Bacteria 1796
199 nmdc:mga05p37_39202_c1 3300050507 Bacteria 5814
200 nmdc:mga05p37_472979_c1 3300050507 Unclassified 1445
201 nmdc:mga09592_11957_c1 3300050508 Bacteria 4989
202 nmdc:mga09592_47055_c1 3300050508 Bacteria 3634
203 nmdc:mga0n895_1174523_c1 3300050512 Unclassified 742
204 nmdc:mga0n895_332152_c1 3300050512 Bacteria 1540
205 nmdc:mga0n895_9237_c1 3300050512 Bacteria 8615
206 nmdc:mga08x19_101_c1 3300050514 Bacteria 75974
207 nmdc:mga0a205_120277_c1 3300050515 Bacteria 2525
208 nmdc:mga0a205_273881_c1 3300050515 Bacteria 1564
209 nmdc:mga0a205_315305_c1 3300050515 Bacteria 1435
210 Ga0501084_0392559 3300054114 Archaea 1173
211 2913914948 2913912277 Bacteria 9037797
212 Ga0373937_0225319
213 JGI25406J46586_10063273
214 Ga0065704_10127159
215 Ga0065704_10154145
216 Ga0065715_10027153
217 Ga0065715_10122078
218 Ga0065707_10020486
219 Ga0065707_10261007
220 Ga0070676_10544163
221 Ga0070690_100069751
222 Ga0070690_100075411
223 Ga0070690_100106716
224 Ga0070690_100155541
225 Ga0068869_100346197
226 Ga0070680_100000051
227 Ga0068868_100019750
228 Ga0070689_100027927
229 Ga0070687_100098426
230 Ga0070692_10054017
231 Ga0070669_100052043
232 Ga0070669_100066010
233 Ga0070669_100865767
234 Ga0070675_100222364
235 Ga0070674_100859916
236 Ga0070673_100564880
237 Ga0070673_100672137
238 Ga0070688_100057086
239 Ga0070667_100341227
240 Ga0070703_10002955
241 Ga0070709_10001715
242 Ga0070713_101656478
243 Ga0070701_10179267
244 Ga0070711_100000021
245 Ga0070705_100001693
246 Ga0070694_100145739
247 Ga0070708_100000664
248 Ga0070708_100018471
249 Ga0070708_100311988
250 Ga0070708_100686646
251 Ga0070678_100293728
252 Ga0070681_10001505
253 Ga0070685_10013032
254 Ga0070706_100000248
255 Ga0070706_100004064
256 Ga0070706_100141953
257 Ga0070706_100671062
258 Ga0070706_101134683
259 Ga0070707_100571503
260 Ga0070698_100003110
261 Ga0070698_100058742
262 Ga0070698_100662411
263 Ga0070699_100004296
264 Ga0070699_100705134
265 Ga0070699_100774494
266 Ga0070699_101246549
267 Ga0070679_100000319
268 Ga0070697_100013186
269 Ga0070697_100374687
270 Ga0070672_100050140
271 Ga0070686_100066853
272 Ga0070695_101125309
273 Ga0070696_100115796
274 Ga0070704_100741602
275 Ga0068857_100098454
276 Ga0068854_100598240
277 Ga0068856_100032442
278 Ga0070702_100024428
279 Ga0070702_100231899
280 Ga0068859_100224526
281 Ga0068864_100167499
282 Ga0068864_101289484
283 Ga0068866_10036782
284 Ga0068861_100034426
285 Ga0068861_100090378
286 Ga0068861_100210354
287 Ga0068863_100435319
288 Ga0068862_100033697
289 Ga0068862_100064068
290 Ga0068862_100081347
291 Ga0081539_10001754
292 Ga0081539_10066649
293 Ga0070716_100056372
294 Ga0070716_100472649
295 Ga0097621_100260008
296 Ga0097621_100801827
297 Ga0068871_100060989
298 Ga0068871_100114144
299 Ga0068871_100721267
300 Ga0075428_100110213
301 Ga0075433_10251455
302 Ga0075433_10342064
303 Ga0075433_10376459
304 Ga0075433_10450968
305 Ga0075434_100008511
306 Ga0075434_100198174
307 Ga0075434_100405787
308 Ga0075434_100837750
309 Ga0075429_100033523
310 Ga0075429_100042258
311 Ga0075429_100057363
312 Ga0068865_100531192
313 Ga0075436_100146639
314 Ga0097620_100224543
315 Ga0111539_10290539
316 Ga0114129_10013602
317 Ga0114129_10087225
318 Ga0114129_10113325
319 Ga0114129_10261963
320 Ga0114129_10337241
321 Ga0105243_10029943
322 Ga0105243_10228422
323 Ga0105243_10744996
324 Ga0105241_10195556
325 Ga0105241_10280777
326 Ga0105242_10037812
327 Ga0105242_10084623
328 Ga0105242_11154896
329 Ga0105248_10018136
330 Ga0105248_10891575
331 Ga0105237_10053409
332 Ga0105249_10044488
333 Ga0105249_10112050
334 Ga0105249_10920575
335 Ga0099796_10195110
336 Ga0105239_10525165
337 Ga0157374_10771138
338 Ga0157378_10051212
339 Ga0157378_10156661
340 Ga0163162_11203726
341 Ga0157375_10402667
342 Ga0157375_11284629
343 Ga0163163_10412987
344 Ga0163163_10920416
345 Ga0157380_10000792
346 Ga0157380_10001459
347 Ga0157380_10098579
348 Ga0157380_10480852
349 Ga0157380_10617352
350 Ga0157377_10026026
351 Ga0157379_10995905
352 Ga0157376_10008867
353 Ga0157376_11104889
354 Ga0163161_10040098
355 Ga0213875_10087223
356 Ga0207697_10107607
357 Ga0207653_10000022
358 Ga0207642_10004969
359 Ga0207699_10007777
360 Ga0207645_10379614
361 Ga0207645_10500310
362 Ga0207684_10000049
363 Ga0207707_10000008
364 Ga0207663_10000004
365 Ga0207660_10000118
366 Ga0207649_10134248
367 Ga0207652_10000065
368 Ga0207646_10077598
369 Ga0207681_10660186
370 Ga0207709_10045792
371 Ga0207665_10147387
372 Ga0207665_10209423
373 Ga0207665_10587139
374 Ga0207691_10001453
375 Ga0207711_10064114
376 Ga0207689_10056615
377 Ga0207651_10469779
378 Ga0207712_10210517
379 Ga0207712_11047067
380 Ga0207677_10017973
381 Ga0207677_10039217
382 Ga0207703_10782422
383 Ga0207708_10361447
384 Ga0207708_10413039
385 Ga0207641_10087383
386 Ga0207648_10082001
387 Ga0207648_11213685
388 Ga0207675_100005648
389 Ga0207675_100006359
390 Ga0207675_100259332
391 Ga0207428_10862752
392 Ga0268265_10038411
393 Ga0268265_10214162
394 Ga0395900_0802353
395 Ga0395905_0163189
396 Ga0436364_0759175
397 Ga0436364_0927397
398 Ga0395901_0587321
399 Ga0436363_0292089
400 Ga0439436_0068406
401 Ga0439462_0046705
402 Ga0439435_0030940
403 Ga0439460_0010050
404 Ga0496102_0087217
405 Ga0496103_0307352
406 Ga0501298_134192
407 Ga0501045_0537640
408 nmdc:mga05p37_28_c1
409 nmdc:mga05p37_331906_c1
410 nmdc:mga05p37_39202_c1
411 nmdc:mga05p37_472979_c1
412 nmdc:mga09592_11957_c1
413 nmdc:mga09592_47055_c1
414 nmdc:mga0n895_1174523_c1
415 nmdc:mga0n895_332152_c1
416 nmdc:mga0n895_9237_c1
417 nmdc:mga08x19_101_c1
418 nmdc:mga0a205_120277_c1
419 nmdc:mga0a205_273881_c1
420 nmdc:mga0a205_315305_c1
421 Ga0501084_0392559
422 2913914948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

9

178

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.8114 29 181
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.8016 29 181
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7254 6 183
1wdj-assembly1.cif.gz_C crystal structure of tt1808 from thermus thermophilus hb8 0.717 6 181
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.714 6 183
ID Description Score Start End Superfamily
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8114 29 181 3.90.1570.10
af_Q9V674_16_515_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.8097 37 62 1.10.630.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8016 29 181 3.90.1570.10
af_Q4DNQ1_14_127_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.751 119 160 3.40.50.800
1wdjC00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.717 6 181 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A3B8JFV1-F1-model_v4 Uma2 family endonuclease 1.004 104 183 GO:0004519
AF-A0A2V9LY67-F1-model_v4 Uma2 family endonuclease 0.9856 31 181 GO:0004519
AF-A0A1Q7Y3X0-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9834 57 181
AF-A0A7V9UPS3-F1-model_v4 Uma2 family endonuclease 0.9713 126 181 GO:0004519
AF-A0A2V8PGC8-F1-model_v4 Uma2 family endonuclease 0.9693 119 181 GO:0004519

Map