F324160

General Info

Members Datasets Scaffolds Average Seq Length
213 124 426 200

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10280941|Ga0207648_102809412
Length 229
Sequence MSAIALTARKVSSYPCSEAASAATGYARRVSDELELLDWKRRVFALYAALRSEPRGAGVAAFRAARDELFREHPQSPLPQEQRAGYGGVPWFPYDPAARVTAAVAPAEPQRFELDASAGEPMAFVRFGAASFALGGQELRLDLYWLDAYGGGLFVPFGDATSGSETYGAGRYLLDTVKGADLGADDGRLVLDFNVAYNPSCAYDPRWACPLAPPANRLPVAVRAGERAP

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.02
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10280941 3300026089 Bacteria 1489
2 Ga0070683_100284997 3300005329 Bacteria 1571
3 Ga0070668_100571166 3300005347 Bacteria 986
4 Ga0070671_100639586 3300005355 Bacteria 921
5 Ga0070709_10936691 3300005434 Bacteria 686
6 Ga0070714_100199369 3300005435 Bacteria 1830
7 Ga0070714_100614550 3300005435 Bacteria 1044
8 Ga0070713_100026415 3300005436 Bacteria 4557
9 Ga0070713_100457477 3300005436 Bacteria 1199
10 Ga0070710_10010293 3300005437 Bacteria 4593
11 Ga0070710_10083436 3300005437 Bacteria 1870
12 Ga0070711_100014965 3300005439 Bacteria 4901
13 Ga0070711_100144851 3300005439 Bacteria 1785
14 Ga0070694_100240270 3300005444 Bacteria 1366
15 Ga0070681_10017876 3300005458 Bacteria 7086
16 Ga0070681_10192531 3300005458 Bacteria 1959
17 Ga0070706_100035078 3300005467 Bacteria 4633
18 Ga0070706_100976954 3300005467 Bacteria 781
19 Ga0070698_100181698 3300005471 Bacteria 2042
20 Ga0070698_100323181 3300005471 Bacteria 1474
21 Ga0070679_101051315 3300005530 Bacteria 759
22 Ga0070684_100038660 3300005535 Bacteria 4100
23 Ga0070693_100814404 3300005547 Bacteria 693
24 Ga0068855_100073602 3300005563 Bacteria 3968
25 Ga0068856_100230203 3300005614 Bacteria 1869
26 Ga0068852_100533720 3300005616 Bacteria 1172
27 Ga0081455_10026522 3300005937 Bacteria 5325
28 Ga0070717_10230269 3300006028 Bacteria 1631
29 Ga0070715_10007625 3300006163 Bacteria 3734
30 Ga0070716_100076081 3300006173 Bacteria 1988
31 Ga0070712_100911526 3300006175 Bacteria 758
32 Ga0075428_100935188 3300006844 Bacteria 919
33 Ga0075433_10207074 3300006852 Bacteria 1744
34 Ga0075434_100797444 3300006871 Bacteria 961
35 Ga0105240_10418124 3300009093 Bacteria 1507
36 Ga0105240_10689673 3300009093 Bacteria 1116
37 Ga0111539_10550560 3300009094 Bacteria 1344
38 Ga0105245_10892306 3300009098 Bacteria 930
39 Ga0114129_10045667 3300009147 Bacteria 6157
40 Ga0105248_10387703 3300009177 Bacteria 1573
41 Ga0105239_10211171 3300010375 Bacteria 2176
42 Ga0157373_10287008 3300013100 Bacteria 1167
43 Ga0157369_10007452 3300013105 Bacteria 12603
44 Ga0157369_10041580 3300013105 Bacteria 5017
45 Ga0157369_10492762 3300013105 Bacteria 1268
46 Ga0182008_10003204 3300014497 Bacteria 9998
47 Ga0206356_10001528 3300020070 Bacteria 1488
48 Ga0207692_10075117 3300025898 Bacteria 1792
49 Ga0207685_10086858 3300025905 Bacteria 1308
50 Ga0207699_10513217 3300025906 Bacteria 866
51 Ga0207699_10774079 3300025906 Bacteria 705
52 Ga0207707_10012848 3300025912 Bacteria 7286
53 Ga0207707_10517455 3300025912 Bacteria 1016
54 Ga0207693_10000932 3300025915 Bacteria 26301
55 Ga0207693_10001629 3300025915 Bacteria 19823
56 Ga0207663_10275799 3300025916 Bacteria 1247
57 Ga0207663_10875826 3300025916 Bacteria 717
58 Ga0207660_10113777 3300025917 Bacteria 2040
59 Ga0207687_10034558 3300025927 Bacteria 3432
60 Ga0207687_10206702 3300025927 Bacteria 1538
61 Ga0207687_10347318 3300025927 Bacteria 1208
62 Ga0207664_10172670 3300025929 Bacteria 1851
63 Ga0207664_10302727 3300025929 Bacteria 1407
64 Ga0207669_10102267 3300025937 Bacteria 1898
65 Ga0207665_10057290 3300025939 Bacteria 2632
66 Ga0207665_10153445 3300025939 Bacteria 1651
67 Ga0207661_10322863 3300025944 Bacteria 1388
68 Ga0207667_10327693 3300025949 Bacteria 1564
69 Ga0207668_10663550 3300025972 Bacteria 914
70 Ga0207677_11223449 3300026023 Bacteria 688
71 Ga0207675_100645998 3300026118 Bacteria 1064
72 Ga0265338_10001558 3300028800 Bacteria 37008
73 Ga0265327_10026094 3300031251 Bacteria 3391
74 Ga0265342_10373449 3300031712 Bacteria 740
75 Ga0307409_100187476 3300031995 Bacteria 1838
76 Ga0373945_0044469 3300035116 Bacteria 1615
77 Ga0373933_0291095 3300035724 Bacteria 1056
78 Ga0373947_0003577 3300035725 Bacteria 9164
79 Ga0373937_0098926 3300036401 Bacteria 2706
80 Ga0373925_0205807 3300037068 Bacteria 1566
81 Ga0395900_0025443 3300037418 Bacteria 6059
82 Ga0395898_0032355 3300037466 Bacteria 5220
83 Ga0395898_0300756 3300037466 Bacteria 1531
84 Ga0395898_0463885 3300037466 Bacteria 1206
85 Ga0395898_0552518 3300037466 Bacteria 1094
86 Ga0395901_0014103 3300038443 Bacteria 8135
87 Ga0395901_0195512 3300038443 Bacteria 2121
88 Ga0395901_0235215 3300038443 Bacteria 1912
89 Ga0466972_0108039 3300044658 Bacteria 1315
90 Ga0466965_0152259 3300044683 Bacteria 1209
91 Ga0466966_0036023 3300044684 Bacteria 3196
92 Ga0466966_0088292 3300044684 Bacteria 1927
93 Ga0466963_0003864 3300044694 Bacteria 8646
94 Ga0466963_0005865 3300044694 Bacteria 7237
95 Ga0466963_0021627 3300044694 Bacteria 4061
96 Ga0466963_0031384 3300044694 Bacteria 3434
97 Ga0466963_0046063 3300044694 Bacteria 2874
98 Ga0466963_0074244 3300044694 Bacteria 2293
99 Ga0466963_0107864 3300044694 Bacteria 1910
100 Ga0466964_0060388 3300044706 Bacteria 1577
101 Ga0466964_0100151 3300044706 Bacteria 1276
102 Ga0466964_0217932 3300044706 Bacteria 925
103 Ga0466964_0288230 3300044706 Bacteria 823
104 Ga0466968_0038219 3300044735 Bacteria 2016
105 Ga0466968_0123157 3300044735 Bacteria 1174
106 Ga0466957_0127163 3300044842 Bacteria 1629
107 Ga0466957_0198625 3300044842 Bacteria 1316
108 Ga0466957_0335460 3300044842 Bacteria 1023
109 Ga0466957_0508864 3300044842 Bacteria 835
110 Ga0466960_0302221 3300044901 Bacteria 902
111 Ga0466960_0386966 3300044901 Bacteria 803
112 Ga0466958_0059826 3300045836 Bacteria 2318
113 Ga0466958_0073080 3300045836 Bacteria 2100
114 Ga0466958_0162687 3300045836 Bacteria 1411
115 Ga0466958_0269326 3300045836 Bacteria 1091
116 Ga0466958_0445137 3300045836 Bacteria 838
117 Ga0466958_0591581 3300045836 Bacteria 721
118 Ga0466967_0000295 3300045976 Bacteria 22299
119 Ga0466967_0010601 3300045976 Bacteria 6924
120 Ga0466967_0015671 3300045976 Bacteria 5951
121 Ga0466967_0035710 3300045976 Bacteria 4235
122 Ga0466967_0076470 3300045976 Bacteria 3011
123 Ga0466967_0105689 3300045976 Bacteria 2579
124 Ga0466967_0158297 3300045976 Bacteria 2124
125 Ga0466967_0172759 3300045976 Bacteria 2034
126 Ga0466967_0238304 3300045976 Bacteria 1734
127 Ga0466967_0504823 3300045976 Bacteria 1187
128 Ga0466967_0645860 3300045976 Bacteria 1046
129 Ga0495592_0105058 3300046454 Bacteria 2007
130 Ga0495603_0121323 3300046455 Bacteria 1523
131 Ga0495629_0004784 3300046459 Bacteria 10150
132 Ga0495629_0200337 3300046459 Bacteria 1380
133 Ga0495582_0000891 3300046473 Bacteria 16577
134 Ga0495639_0032159 3300046475 Bacteria 2339
135 Ga0495662_0085345 3300046476 Bacteria 1537
136 Ga0495608_0006673 3300046511 Bacteria 8185
137 Ga0495630_0009369 3300046517 Bacteria 7038
138 Ga0495652_0205600 3300046529 Bacteria 1491
139 Ga0495665_0007851 3300046531 Bacteria 5777
140 Ga0495665_0073316 3300046531 Bacteria 1803
141 Ga0495640_0011570 3300046533 Bacteria 6781
142 Ga0495640_0173107 3300046533 Bacteria 1379
143 Ga0495634_0099676 3300046642 Bacteria 1878
144 Ga0495588_0188693 3300046674 Bacteria 1089
145 Ga0495647_0027791 3300046681 Bacteria 2081
146 Ga0495658_0000613 3300046683 Bacteria 19403
147 Ga0495658_0146612 3300046683 Bacteria 1447
148 Ga0495613_0001243 3300046689 Bacteria 19454
149 Ga0495613_0020981 3300046689 Bacteria 4869
150 Ga0495613_0475510 3300046689 Bacteria 844
151 Ga0495624_0013349 3300046690 Bacteria 5602
152 Ga0495600_0213631 3300046809 Bacteria 1235
153 Ga0495581_0001756 3300047315 Bacteria 12091
154 Ga0495581_0057268 3300047315 Bacteria 2249
155 Ga0495674_0018297 3300047319 Bacteria 6525
156 Ga0495674_0085769 3300047319 Bacteria 2697
157 Ga0495676_0026152 3300047321 Bacteria 5028
158 Ga0495676_0155004 3300047321 Bacteria 1626
159 Ga0495680_0026540 3300047322 Bacteria 4773
160 Ga0495680_0096005 3300047322 Bacteria 2215
161 Ga0495593_0150989 3300047673 Bacteria 1175
162 Ga0495614_0011011 3300048089 Bacteria 3980
163 Ga0496100_0198154 3300048903 Bacteria 1462
164 Ga0496101_0142526 3300048904 Bacteria 1827
165 Ga0496102_0781142 3300048905 Bacteria 877
166 Ga0496103_0154134 3300048906 Bacteria 1472
167 Ga0496104_0021573 3300048907 Bacteria 5914
168 Ga0496104_0259242 3300048907 Bacteria 1651
169 Ga0496104_0468442 3300048907 Bacteria 1171
170 Ga0496105_0025214 3300048908 Bacteria 4837
171 Ga0496105_0058925 3300048908 Bacteria 3169
172 Ga0496105_0059957 3300048908 Bacteria 3139
173 Ga0496106_0000730 3300048909 Bacteria 23681
174 Ga0496106_0102053 3300048909 Bacteria 2225
175 Ga0496107_0002748 3300048910 Bacteria 11573
176 Ga0496107_0130574 3300048910 Bacteria 1854
177 Ga0496107_0661590 3300048910 Bacteria 770
178 Ga0496107_0747623 3300048910 Bacteria 718
179 Ga0496108_0027968 3300048911 Bacteria 4663
180 Ga0496108_0291196 3300048911 Bacteria 1421
181 Ga0496108_1046928 3300048911 Bacteria 695
182 Ga0496109_0056747 3300048912 Bacteria 3573
183 Ga0496109_0109700 3300048912 Bacteria 2565
184 Ga0496109_0577517 3300048912 Bacteria 1059
185 Ga0496110_0005774 3300048913 Bacteria 9726
186 Ga0496112_0031504 3300048915 Bacteria 5145
187 Ga0496112_0380281 3300048915 Bacteria 1353
188 Ga0496113_0046284 3300048916 Bacteria 3229
189 Ga0496113_0216192 3300048916 Bacteria 1527
190 Ga0496113_0495021 3300048916 Bacteria 981
191 Ga0496113_0547812 3300048916 Bacteria 928
192 Ga0496115_0115362 3300048918 Bacteria 2208
193 Ga0496115_0303259 3300048918 Bacteria 1308
194 Ga0496115_0652111 3300048918 Bacteria 832
195 Ga0501046_0305703 3300049580 Bacteria 1161
196 Ga0501067_0115796 3300049583 Bacteria 1491
197 Ga0501069_0014927 3300049585 Bacteria 4161
198 Ga0501069_0023537 3300049585 Bacteria 3360
199 Ga0501069_0163777 3300049585 Bacteria 1281
200 Ga0501069_0372401 3300049585 Bacteria 843
201 Ga0501070_0005751 3300049586 Bacteria 10571
202 Ga0501070_0016754 3300049586 Bacteria 6152
203 Ga0501070_0811033 3300049586 Bacteria 734
204 Ga0501074_0131197 3300049590 Bacteria 1792
205 Ga0501080_0064609 3300049742 Bacteria 3404
206 Ga0501080_0130301 3300049742 Bacteria 2328
207 Ga0501035_0091430 3300049822 Bacteria 2679
208 nmdc:mga0n895_365828_c1 3300050512 Bacteria 1460
209 nmdc:mga0a205_243080_c1 3300050515 Bacteria 1681
210 nmdc:mga0a205_770553_c1 3300050515 Bacteria 810
211 Ga0495619_0058976 3300053085 Bacteria 2549
212 Ga0466962_0020074 3300061719 Bacteria 3212
213 Ga0466962_0047510 3300061719 Bacteria 2051
214 Ga0207648_10280941
215 Ga0070683_100284997
216 Ga0070668_100571166
217 Ga0070671_100639586
218 Ga0070709_10936691
219 Ga0070714_100199369
220 Ga0070714_100614550
221 Ga0070713_100026415
222 Ga0070713_100457477
223 Ga0070710_10010293
224 Ga0070710_10083436
225 Ga0070711_100014965
226 Ga0070711_100144851
227 Ga0070694_100240270
228 Ga0070681_10017876
229 Ga0070681_10192531
230 Ga0070706_100035078
231 Ga0070706_100976954
232 Ga0070698_100181698
233 Ga0070698_100323181
234 Ga0070679_101051315
235 Ga0070684_100038660
236 Ga0070693_100814404
237 Ga0068855_100073602
238 Ga0068856_100230203
239 Ga0068852_100533720
240 Ga0081455_10026522
241 Ga0070717_10230269
242 Ga0070715_10007625
243 Ga0070716_100076081
244 Ga0070712_100911526
245 Ga0075428_100935188
246 Ga0075433_10207074
247 Ga0075434_100797444
248 Ga0105240_10418124
249 Ga0105240_10689673
250 Ga0111539_10550560
251 Ga0105245_10892306
252 Ga0114129_10045667
253 Ga0105248_10387703
254 Ga0105239_10211171
255 Ga0157373_10287008
256 Ga0157369_10007452
257 Ga0157369_10041580
258 Ga0157369_10492762
259 Ga0182008_10003204
260 Ga0206356_10001528
261 Ga0207692_10075117
262 Ga0207685_10086858
263 Ga0207699_10513217
264 Ga0207699_10774079
265 Ga0207707_10012848
266 Ga0207707_10517455
267 Ga0207693_10000932
268 Ga0207693_10001629
269 Ga0207663_10275799
270 Ga0207663_10875826
271 Ga0207660_10113777
272 Ga0207687_10034558
273 Ga0207687_10206702
274 Ga0207687_10347318
275 Ga0207664_10172670
276 Ga0207664_10302727
277 Ga0207669_10102267
278 Ga0207665_10057290
279 Ga0207665_10153445
280 Ga0207661_10322863
281 Ga0207667_10327693
282 Ga0207668_10663550
283 Ga0207677_11223449
284 Ga0207675_100645998
285 Ga0265338_10001558
286 Ga0265327_10026094
287 Ga0265342_10373449
288 Ga0307409_100187476
289 Ga0373945_0044469
290 Ga0373933_0291095
291 Ga0373947_0003577
292 Ga0373937_0098926
293 Ga0373925_0205807
294 Ga0395900_0025443
295 Ga0395898_0032355
296 Ga0395898_0300756
297 Ga0395898_0463885
298 Ga0395898_0552518
299 Ga0395901_0014103
300 Ga0395901_0195512
301 Ga0395901_0235215
302 Ga0466972_0108039
303 Ga0466965_0152259
304 Ga0466966_0036023
305 Ga0466966_0088292
306 Ga0466963_0003864
307 Ga0466963_0005865
308 Ga0466963_0021627
309 Ga0466963_0031384
310 Ga0466963_0046063
311 Ga0466963_0074244
312 Ga0466963_0107864
313 Ga0466964_0060388
314 Ga0466964_0100151
315 Ga0466964_0217932
316 Ga0466964_0288230
317 Ga0466968_0038219
318 Ga0466968_0123157
319 Ga0466957_0127163
320 Ga0466957_0198625
321 Ga0466957_0335460
322 Ga0466957_0508864
323 Ga0466960_0302221
324 Ga0466960_0386966
325 Ga0466958_0059826
326 Ga0466958_0073080
327 Ga0466958_0162687
328 Ga0466958_0269326
329 Ga0466958_0445137
330 Ga0466958_0591581
331 Ga0466967_0000295
332 Ga0466967_0010601
333 Ga0466967_0015671
334 Ga0466967_0035710
335 Ga0466967_0076470
336 Ga0466967_0105689
337 Ga0466967_0158297
338 Ga0466967_0172759
339 Ga0466967_0238304
340 Ga0466967_0504823
341 Ga0466967_0645860
342 Ga0495592_0105058
343 Ga0495603_0121323
344 Ga0495629_0004784
345 Ga0495629_0200337
346 Ga0495582_0000891
347 Ga0495639_0032159
348 Ga0495662_0085345
349 Ga0495608_0006673
350 Ga0495630_0009369
351 Ga0495652_0205600
352 Ga0495665_0007851
353 Ga0495665_0073316
354 Ga0495640_0011570
355 Ga0495640_0173107
356 Ga0495634_0099676
357 Ga0495588_0188693
358 Ga0495647_0027791
359 Ga0495658_0000613
360 Ga0495658_0146612
361 Ga0495613_0001243
362 Ga0495613_0020981
363 Ga0495613_0475510
364 Ga0495624_0013349
365 Ga0495600_0213631
366 Ga0495581_0001756
367 Ga0495581_0057268
368 Ga0495674_0018297
369 Ga0495674_0085769
370 Ga0495676_0026152
371 Ga0495676_0155004
372 Ga0495680_0026540
373 Ga0495680_0096005
374 Ga0495593_0150989
375 Ga0495614_0011011
376 Ga0496100_0198154
377 Ga0496101_0142526
378 Ga0496102_0781142
379 Ga0496103_0154134
380 Ga0496104_0021573
381 Ga0496104_0259242
382 Ga0496104_0468442
383 Ga0496105_0025214
384 Ga0496105_0058925
385 Ga0496105_0059957
386 Ga0496106_0000730
387 Ga0496106_0102053
388 Ga0496107_0002748
389 Ga0496107_0130574
390 Ga0496107_0661590
391 Ga0496107_0747623
392 Ga0496108_0027968
393 Ga0496108_0291196
394 Ga0496108_1046928
395 Ga0496109_0056747
396 Ga0496109_0109700
397 Ga0496109_0577517
398 Ga0496110_0005774
399 Ga0496112_0031504
400 Ga0496112_0380281
401 Ga0496113_0046284
402 Ga0496113_0216192
403 Ga0496113_0495021
404 Ga0496113_0547812
405 Ga0496115_0115362
406 Ga0496115_0303259
407 Ga0496115_0652111
408 Ga0501046_0305703
409 Ga0501067_0115796
410 Ga0501069_0014927
411 Ga0501069_0023537
412 Ga0501069_0163777
413 Ga0501069_0372401
414 Ga0501070_0005751
415 Ga0501070_0016754
416 Ga0501070_0811033
417 Ga0501074_0131197
418 Ga0501080_0064609
419 Ga0501080_0130301
420 Ga0501035_0091430
421 nmdc:mga0n895_365828_c1
422 nmdc:mga0a205_243080_c1
423 nmdc:mga0a205_770553_c1
424 Ga0495619_0058976
425 Ga0466962_0020074
426 Ga0466962_0047510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07920

DUF1684

Protein of unknown function (DUF1684)

84

227

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.8052 35 196
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8043 35 196
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.7729 30 196
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.7492 35 196
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.7344 30 196
ID Description Score Start End Superfamily
af_Q8NEZ4_4546_4685_3.30.160.360 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6438 84 124 3.30.160.360
af_B8A203_85_224_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5747 18 49 1.25.10.10
af_Q9HDZ2_710_875_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5049 78 113 3.60.10.10
af_Q91VB4_255_640_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4935 74 125 1.25.40.10
af_O14921_58_129_1.10.167.10 Mainly Alpha;Orthogonal Bundle;Regulator of G-protein Signalling 4; domain 2;Regulator of G-protein Signalling 4, domain 2 0.4875 17 70 1.10.167.10
ID Description Score Start End GO Terms
AF-A0A849HFX3-F1-model_v4 DUF1684 domain-containing protein 0.9596 12 197
AF-A0A7Y9UB58-F1-model_v4 deleted 0.9595 8 198
AF-A0A535RTX1-F1-model_v4 DUF1684 domain-containing protein 0.9593 12 196
AF-A0A6N6KWU5-F1-model_v4 DUF1684 domain-containing protein 0.9572 11 197
AF-A0A4R3G4S3-F1-model_v4 DUF1684 domain-containing protein 0.9558 10 196

Map