F324075

General Info

Members Datasets Scaffolds Average Seq Length
213 156 211 165

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10129057|Ga0163163_101290572
Length 184
Sequence LDARPPAILRANIDSAMIRTATSSDAEAICAVYNHYVIGSCITFEEEPVSEADMRVRIEETLAVLPWIVWEEEGSVIGYAYASKWKSRCAYRYAVESTIYLQENATGRGIGLKLYAELIAKLKAQGIHTVIGGIALPNSASQRLHEKLGFKKVAQFEQVGWKFNRWIDVGYWELIFPGAVPSSG

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
94 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.29
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000825 3300000546 Bacteria 5101
2 rootH1_10304518 3300003323 Bacteria 6810
3 Ga0070658_10081851 3300005327 Unclassified 2652
4 Ga0070658_10762147 3300005327 Bacteria 840
5 Ga0068869_100829412 3300005334 Bacteria 796
6 Ga0068869_100986731 3300005334 Bacteria 733
7 Ga0070680_100121439 3300005336 Bacteria 2181
8 Ga0070680_100902783 3300005336 Bacteria 762
9 Ga0070682_100125360 3300005337 Bacteria 1730
10 Ga0070691_10003412 3300005341 Bacteria 7140
11 Ga0070691_10188789 3300005341 Bacteria 1077
12 Ga0070687_100173875 3300005343 Bacteria 1284
13 Ga0070692_10153146 3300005345 Bacteria 1315
14 Ga0070671_101319196 3300005355 Bacteria 637
15 Ga0070713_100099260 3300005436 Bacteria 2519
16 Ga0070701_10388081 3300005438 Bacteria 882
17 Ga0070705_100520935 3300005440 Bacteria 906
18 Ga0070700_100036322 3300005441 Bacteria 2987
19 Ga0070694_100063039 3300005444 Bacteria 2534
20 Ga0070679_100699913 3300005530 Bacteria 956
21 Ga0070686_100806348 3300005544 Bacteria 757
22 Ga0070696_100526591 3300005546 Bacteria 944
23 Ga0070665_100447322 3300005548 Unclassified 1301
24 Ga0070664_100101502 3300005564 Bacteria 2502
25 Ga0068857_100651277 3300005577 Bacteria 998
26 Ga0068859_100101153 3300005617 Bacteria 2939
27 Ga0068864_100358012 3300005618 Unclassified 1378
28 Ga0068861_100121670 3300005719 Bacteria 2106
29 Ga0068862_101170106 3300005844 Bacteria 766
30 Ga0070717_10000035 3300006028 Bacteria 126598
31 Ga0075436_100152576 3300006914 Bacteria 1626
32 Ga0097620_100101158 3300006931 Bacteria 2939
33 Ga0075435_100799039 3300007076 Unclassified 821
34 Ga0105250_10215499 3300009092 Bacteria 813
35 Ga0105245_10179371 3300009098 Bacteria 2022
36 Ga0105247_10766961 3300009101 Bacteria 733
37 Ga0105243_10125637 3300009148 Bacteria 2169
38 Ga0105237_10178337 3300009545 Unclassified 2125
39 Ga0105237_11757225 3300009545 Bacteria 628
40 Ga0105238_10804242 3300009551 Unclassified 956
41 Ga0157369_10135839 3300013105 Bacteria 2604
42 Ga0157374_12231098 3300013296 Bacteria 575
43 Ga0157378_10166881 3300013297 Bacteria 2063
44 Ga0163163_10129057 3300014325 Bacteria 2568
45 Ga0157380_10461964 3300014326 Bacteria 1222
46 Ga0157380_11024686 3300014326 Unclassified 860
47 Ga0157376_10074627 3300014969 Unclassified 2892
48 Ga0163161_10905988 3300017792 Unclassified 747
49 Ga0207647_10001991 3300025904 Bacteria 15624
50 Ga0207645_10683552 3300025907 Bacteria 697
51 Ga0207705_10165199 3300025909 Unclassified 1664
52 Ga0207707_10756859 3300025912 Bacteria 812
53 Ga0207671_10328301 3300025914 Unclassified 1211
54 Ga0207662_10229175 3300025918 Bacteria 1213
55 Ga0207649_10321836 3300025920 Unclassified 1136
56 Ga0207650_11084335 3300025925 Unclassified 682
57 Ga0207670_10706720 3300025936 Bacteria 835
58 Ga0207689_10161309 3300025942 Bacteria 1847
59 Ga0207689_11004565 3300025942 Bacteria 704
60 Ga0207708_10039778 3300026075 Bacteria 3584
61 Ga0207648_10245995 3300026089 Bacteria 1594
62 Ga0207674_10654497 3300026116 Bacteria 1015
63 Ga0207675_100071317 3300026118 Bacteria 3248
64 Ga0268266_10375722 3300028379 Unclassified 1339
65 Ga0268265_10151493 3300028380 Bacteria 1956
66 Ga0265337_1046932 3300028556 Unclassified 1226
67 Ga0265319_1029135 3300028563 Bacteria 1940
68 Ga0265338_10013066 3300028800 Bacteria 9409
69 Ga0265338_10021070 3300028800 Bacteria 6816
70 Ga0265324_10000447 3300029957 Bacteria 29274
71 Ga0265324_10020346 3300029957 Unclassified 2385
72 Ga0265330_10049357 3300031235 Bacteria 1849
73 Ga0265332_10031165 3300031238 Bacteria 2327
74 Ga0265320_10003621 3300031240 Bacteria 10318
75 Ga0265325_10053303 3300031241 Bacteria 2074
76 Ga0265329_10006510 3300031242 Unclassified 4624
77 Ga0265340_10005596 3300031247 Bacteria 6966
78 Ga0265340_10332214 3300031247 Bacteria 672
79 Ga0265339_10000001 3300031249 Bacteria 613713
80 Ga0265339_10034559 3300031249 Bacteria 2840
81 Ga0265331_10006255 3300031250 Bacteria 7059
82 Ga0265331_10008242 3300031250 Bacteria 5941
83 Ga0265331_10039333 3300031250 Unclassified 2307
84 Ga0265331_10082495 3300031250 Bacteria 1492
85 Ga0265327_10200137 3300031251 Unclassified 905
86 Ga0265316_10324941 3300031344 Bacteria 1117
87 Ga0265313_10032851 3300031595 Unclassified 2643
88 Ga0265313_10052668 3300031595 Bacteria 1941
89 Ga0307508_10000581 3300031616 Bacteria 43575
90 Ga0265314_10000476 3300031711 Bacteria 52798
91 Ga0265314_10098832 3300031711 Bacteria 1881
92 Ga0265342_10003172 3300031712 Bacteria 13682
93 Ga0265342_10016689 3300031712 Bacteria 4791
94 Ga0265342_10025517 3300031712 Bacteria 3713
95 Ga0265342_10056716 3300031712 Bacteria 2321
96 Ga0265342_10075233 3300031712 Bacteria 1960
97 Ga0316576_10397279 3300031727 Bacteria 1022
98 Ga0307413_10475760 3300031824 Unclassified 997
99 Ga0307410_10194262 3300031852 Bacteria 1545
100 Ga0307410_11129726 3300031852 Unclassified 680
101 Ga0307407_10920929 3300031903 Bacteria 672
102 Ga0307412_11039084 3300031911 Bacteria 726
103 Ga0307409_100270804 3300031995 Unclassified 1564
104 Ga0307409_100271891 3300031995 Unclassified 1561
105 Ga0307411_10369095 3300032005 Bacteria 1176
106 Ga0307411_11183448 3300032005 Unclassified 692
107 Ga0316574_0012994 3300035398 Bacteria 4777
108 Ga0373935_0220270 3300035692 Bacteria 1318
109 Ga0373937_0076013 3300036401 Unclassified 3101
110 Ga0395899_0036429 3300037312 Bacteria 3690
111 Ga0395900_0843382 3300037418 Bacteria 842
112 Ga0395898_0051785 3300037466 Bacteria 4013
113 Ga0395901_0610889 3300038443 Bacteria 1098
114 Ga0400490_58215 3300038726 Unclassified 2333
115 Ga0400491_09814 3300038727 Bacteria 1289
116 Ga0400489_94102 3300039093 Archaea 2284
117 Ga0451841_1304763 3300041498 Bacteria 1252
118 Ga0451577_0014703 3300042876 Bacteria 7291
119 Ga0466966_0019974 3300044684 Bacteria 4407
120 Ga0453684_0061795 3300044712 Bacteria 4805
121 Ga0453684_0244074 3300044712 Unclassified 2066
122 Ga0451576_0004671 3300045051 Bacteria 17637
123 Ga0495603_0325317 3300046455 Bacteria 882
124 Ga0495629_0052783 3300046459 Bacteria 2844
125 Ga0495582_0178244 3300046473 Bacteria 1210
126 Ga0495605_0054258 3300046474 Bacteria 1942
127 Ga0495605_0089272 3300046474 Bacteria 1430
128 Ga0495605_0101457 3300046474 Bacteria 1322
129 Ga0495584_0001480 3300046491 Bacteria 14072
130 Ga0495584_0002931 3300046491 Bacteria 9507
131 Ga0495584_0005044 3300046491 Bacteria 7025
132 Ga0495584_0011853 3300046491 Bacteria 4458
133 Ga0495584_0030625 3300046491 Bacteria 2724
134 Ga0495585_0014828 3300046492 Bacteria 4533
135 Ga0495585_0039989 3300046492 Bacteria 2634
136 Ga0495585_0090775 3300046492 Bacteria 1645
137 Ga0495585_0211877 3300046492 Bacteria 981
138 Ga0495596_0002080 3300046500 Bacteria 10978
139 Ga0495596_0029078 3300046500 Bacteria 2217
140 Ga0495596_0058196 3300046500 Bacteria 1507
141 Ga0495596_0260798 3300046500 Unclassified 673
142 Ga0495607_0005245 3300046501 Bacteria 9327
143 Ga0495607_0046101 3300046501 Bacteria 2562
144 Ga0495583_0000431 3300046506 Bacteria 63149
145 Ga0495616_0009555 3300046513 Bacteria 5662
146 Ga0495616_0073057 3300046513 Bacteria 1655
147 Ga0495630_0174822 3300046517 Bacteria 1637
148 Ga0495631_0007725 3300046518 Bacteria 5458
149 Ga0495632_0010059 3300046519 Bacteria 5636
150 Ga0495643_0008099 3300046522 Bacteria 6696
151 Ga0495644_0009467 3300046523 Bacteria 3756
152 Ga0495644_0010751 3300046523 Bacteria 3527
153 Ga0495642_0030638 3300046528 Bacteria 2152
154 Ga0495654_0027128 3300046530 Bacteria 2939
155 Ga0495609_0158238 3300046538 Bacteria 961
156 Ga0495597_0002323 3300046542 Bacteria 12328
157 Ga0495645_0240878 3300046543 Bacteria 1207
158 Ga0495622_0020594 3300046557 Bacteria 3071
159 Ga0495633_0056308 3300046558 Bacteria 1847
160 Ga0495668_0004179 3300046616 Bacteria 10420
161 Ga0495668_0004799 3300046616 Bacteria 9415
162 Ga0495668_0039808 3300046616 Bacteria 2623
163 Ga0495668_0692845 3300046616 Bacteria 563
164 Ga0495611_0000809 3300046648 Bacteria 17356
165 Ga0495611_0024912 3300046648 Bacteria 2604
166 Ga0495611_0085400 3300046648 Bacteria 1455
167 Ga0495661_0050031 3300046665 Bacteria 2532
168 Ga0495588_0191018 3300046674 Bacteria 1081
169 Ga0495623_0075776 3300046679 Bacteria 2088
170 Ga0495669_0085713 3300046684 Bacteria 1450
171 Ga0495613_0116788 3300046689 Bacteria 1919
172 Ga0495613_0131380 3300046689 Bacteria 1793
173 Ga0495670_0028397 3300046691 Bacteria 2773
174 Ga0495649_0013017 3300046694 Bacteria 4813
175 Ga0495649_0051186 3300046694 Bacteria 2240
176 Ga0495649_0120578 3300046694 Bacteria 1387
177 Ga0495589_0122260 3300046794 Bacteria 1253
178 Ga0495589_0170687 3300046794 Bacteria 1034
179 Ga0495589_0423102 3300046794 Bacteria 610
180 Ga0495660_0006996 3300046810 Bacteria 6649
181 Ga0495581_0109469 3300047315 Bacteria 1606
182 Ga0495672_0014139 3300047320 Bacteria 5475
183 Ga0495683_0027400 3300047323 Bacteria 2913
184 Ga0495675_0021517 3300047444 Bacteria 4108
185 Ga0495677_0001803 3300047445 Bacteria 8564
186 Ga0495677_0063703 3300047445 Bacteria 1369
187 Ga0495679_015184 3300047446 Bacteria 2824
188 Ga0495681_0005804 3300047470 Bacteria 8202
189 Ga0495681_0068206 3300047470 Bacteria 1619
190 Ga0495686_0001090 3300047472 Bacteria 32264
191 Ga0495593_0075005 3300047673 Bacteria 1754
192 Ga0495614_0020692 3300048089 Bacteria 2843
193 Ga0495626_0007763 3300048091 Bacteria 5945
194 Ga0495626_0009485 3300048091 Bacteria 5260
195 Ga0495626_0020052 3300048091 Bacteria 3336
196 Ga0496109_0290348 3300048912 Bacteria 1542
197 Ga0496112_0405111 3300048915 Unclassified 1303
198 Ga0496112_0423697 3300048915 Unclassified 1269
199 Ga0496113_0040525 3300048916 Bacteria 3432
200 Ga0496113_1085340 3300048916 Unclassified 628
201 Ga0496115_0013225 3300048918 Bacteria 6235
202 Ga0496115_0229552 3300048918 Unclassified 1531
203 Ga0496126_0009231 3300048929 Bacteria 10515
204 Ga0495682_0000794 3300049460 Bacteria 20009
205 Ga0501036_0633959 3300049572 Bacteria 885
206 Ga0501046_0680688 3300049580 Bacteria 726
207 nmdc:mga0rr50_733316_c1 3300050513 Unclassified 843
208 nmdc:mga08x19_36090_c1 3300050514 Bacteria 3129
209 nmdc:mga0a205_1138491_c1 3300050515 Unclassified 628
210 nmdc:mga0a205_13152_c1 3300050515 Bacteria 7687
211 Ga0495601_0360951 3300053077 Unclassified 944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0843382 Ga0395900_0843382_282_794 135
2 3300048912 Ga0496109_0290348 Ga0496109_0290348_994_1506 137
3 3300037466 Ga0395898_0051785 Ga0395898_0051785_96_608 138
4 3300038443 Ga0395901_0610889 Ga0395901_0610889_358_870 138
5 3300044684 Ga0466966_0019974 Ga0466966_0019974_1810_2370 146
6 3300013297 Ga0157378_10166881 Ga0157378_101668812 148
7 3300050515 nmdc:mga0a205_1138491_c1 nmdc:mga0a205_1138491_c1_132_608 148
8 3300038726 Ga0400490_58215 Ga0400490_58215_305_796 151
9 3300038727 Ga0400491_09814 Ga0400491_09814_53_568 151
10 iso_pu_bacteria 2786546940 2788436791 157
11 3300028556 Ga0265337_1046932 Ga0265337_10469322 159
12 3300028800 Ga0265338_10013066 Ga0265338_100130666 159
13 3300028800 Ga0265338_10021070 Ga0265338_100210702 159
14 3300029957 Ga0265324_10000447 Ga0265324_1000044714 159
15 3300029957 Ga0265324_10020346 Ga0265324_100203462 159
16 3300031235 Ga0265330_10049357 Ga0265330_100493571 159
17 3300031241 Ga0265325_10053303 Ga0265325_100533033 159
18 3300031242 Ga0265329_10006510 Ga0265329_100065103 159
19 3300031247 Ga0265340_10005596 Ga0265340_100055963 159
20 3300031249 Ga0265339_10000001 Ga0265339_1000000114 159
21 3300031249 Ga0265339_10034559 Ga0265339_100345592 159
22 3300031250 Ga0265331_10006255 Ga0265331_100062554 159
23 3300031250 Ga0265331_10039333 Ga0265331_100393333 159
24 3300031344 Ga0265316_10324941 Ga0265316_103249412 159
25 3300031595 Ga0265313_10032851 Ga0265313_100328512 159
26 3300031595 Ga0265313_10052668 Ga0265313_100526682 159
27 3300031711 Ga0265314_10000476 Ga0265314_100004769 159
28 3300031712 Ga0265342_10003172 Ga0265342_100031723 159
29 3300031712 Ga0265342_10016689 Ga0265342_100166895 159
30 3300031712 Ga0265342_10025517 Ga0265342_100255175 159
31 3300042876 Ga0451577_0014703 Ga0451577_0014703_5248_5730 159
32 3300044712 Ga0453684_0061795 Ga0453684_0061795_2805_3287 159
33 3300044712 Ga0453684_0244074 Ga0453684_0244074_184_666 159
34 3300045051 Ga0451576_0004671 Ga0451576_0004671_10403_10885 159
35 3300050515 nmdc:mga0a205_13152_c1 nmdc:mga0a205_13152_c1_4437_4922 159
36 iso_pu_bacteria 2894414249 2894418060 159
37 3300000546 LJNas_1000825 LJNas_10008253 160
38 3300003323 rootH1_10304518 rootH1_103045184 160
39 3300005327 Ga0070658_10081851 Ga0070658_100818511 160
40 3300005327 Ga0070658_10762147 Ga0070658_107621472 160
41 3300005334 Ga0068869_100829412 Ga0068869_1008294121 160
42 3300005334 Ga0068869_100986731 Ga0068869_1009867311 160
43 3300005336 Ga0070680_100121439 Ga0070680_1001214393 160
44 3300005336 Ga0070680_100902783 Ga0070680_1009027831 160
45 3300005337 Ga0070682_100125360 Ga0070682_1001253603 160
46 3300005341 Ga0070691_10003412 Ga0070691_100034127 160
47 3300005341 Ga0070691_10188789 Ga0070691_101887892 160
48 3300005343 Ga0070687_100173875 Ga0070687_1001738752 160
49 3300005345 Ga0070692_10153146 Ga0070692_101531462 160
50 3300005355 Ga0070671_101319196 Ga0070671_1013191961 160
51 3300005436 Ga0070713_100099260 Ga0070713_1000992603 160
52 3300005438 Ga0070701_10388081 Ga0070701_103880811 160
53 3300005440 Ga0070705_100520935 Ga0070705_1005209352 160
54 3300005441 Ga0070700_100036322 Ga0070700_1000363222 160
55 3300005444 Ga0070694_100063039 Ga0070694_1000630392 160
56 3300005530 Ga0070679_100699913 Ga0070679_1006999131 160
57 3300005544 Ga0070686_100806348 Ga0070686_1008063481 160
58 3300005546 Ga0070696_100526591 Ga0070696_1005265912 160
59 3300005548 Ga0070665_100447322 Ga0070665_1004473223 160
60 3300005564 Ga0070664_100101502 Ga0070664_1001015022 160
61 3300005577 Ga0068857_100651277 Ga0068857_1006512772 160
62 3300005617 Ga0068859_100101153 Ga0068859_1001011533 160
63 3300005618 Ga0068864_100358012 Ga0068864_1003580122 160
64 3300005719 Ga0068861_100121670 Ga0068861_1001216701 160
65 3300005844 Ga0068862_101170106 Ga0068862_1011701061 160
66 3300006028 Ga0070717_10000035 Ga0070717_1000003565 160
67 3300006914 Ga0075436_100152576 Ga0075436_1001525762 160
68 3300006931 Ga0097620_100101158 Ga0097620_1001011583 160
69 3300007076 Ga0075435_100799039 Ga0075435_1007990391 160
70 3300009092 Ga0105250_10215499 Ga0105250_102154991 160
71 3300009098 Ga0105245_10179371 Ga0105245_101793712 160
72 3300009101 Ga0105247_10766961 Ga0105247_107669611 160
73 3300009148 Ga0105243_10125637 Ga0105243_101256373 160
74 3300009545 Ga0105237_10178337 Ga0105237_101783372 160
75 3300009545 Ga0105237_11757225 Ga0105237_117572251 160
76 3300009551 Ga0105238_10804242 Ga0105238_108042422 160
77 3300013105 Ga0157369_10135839 Ga0157369_101358393 160
78 3300013296 Ga0157374_12231098 Ga0157374_122310981 160
79 3300014325 Ga0163163_10129057 Ga0163163_101290572 160
80 3300014326 Ga0157380_10461964 Ga0157380_104619642 160
81 3300014326 Ga0157380_11024686 Ga0157380_110246861 160
82 3300014969 Ga0157376_10074627 Ga0157376_100746273 160
83 3300017792 Ga0163161_10905988 Ga0163161_109059882 160
84 3300025904 Ga0207647_10001991 Ga0207647_100019917 160
85 3300025907 Ga0207645_10683552 Ga0207645_106835521 160
86 3300025909 Ga0207705_10165199 Ga0207705_101651992 160
87 3300025912 Ga0207707_10756859 Ga0207707_107568592 160
88 3300025914 Ga0207671_10328301 Ga0207671_103283012 160
89 3300025918 Ga0207662_10229175 Ga0207662_102291752 160
90 3300025920 Ga0207649_10321836 Ga0207649_103218362 160
91 3300025925 Ga0207650_11084335 Ga0207650_110843351 160
92 3300025936 Ga0207670_10706720 Ga0207670_107067202 160
93 3300025942 Ga0207689_10161309 Ga0207689_101613092 160
94 3300025942 Ga0207689_11004565 Ga0207689_110045652 160
95 3300026075 Ga0207708_10039778 Ga0207708_100397783 160
96 3300026089 Ga0207648_10245995 Ga0207648_102459952 160
97 3300026116 Ga0207674_10654497 Ga0207674_106544971 160
98 3300026118 Ga0207675_100071317 Ga0207675_1000713172 160
99 3300028379 Ga0268266_10375722 Ga0268266_103757223 160
100 3300028380 Ga0268265_10151493 Ga0268265_101514932 160
101 3300028563 Ga0265319_1029135 Ga0265319_10291351 160
102 3300031238 Ga0265332_10031165 Ga0265332_100311651 160
103 3300031240 Ga0265320_10003621 Ga0265320_100036218 160
104 3300031247 Ga0265340_10332214 Ga0265340_103322141 160
105 3300031250 Ga0265331_10008242 Ga0265331_100082424 160
106 3300031250 Ga0265331_10082495 Ga0265331_100824952 160
107 3300031251 Ga0265327_10200137 Ga0265327_102001371 160
108 3300031616 Ga0307508_10000581 Ga0307508_1000058115 160
109 3300031711 Ga0265314_10098832 Ga0265314_100988323 160
110 3300031712 Ga0265342_10056716 Ga0265342_100567162 160
111 3300031712 Ga0265342_10075233 Ga0265342_100752332 160
112 3300031727 Ga0316576_10397279 Ga0316576_103972792 160
113 3300031824 Ga0307413_10475760 Ga0307413_104757602 160
114 3300031852 Ga0307410_10194262 Ga0307410_101942623 160
115 3300031852 Ga0307410_11129726 Ga0307410_111297261 160
116 3300031903 Ga0307407_10920929 Ga0307407_109209292 160
117 3300031911 Ga0307412_11039084 Ga0307412_110390842 160
118 3300031995 Ga0307409_100270804 Ga0307409_1002708042 160
119 3300031995 Ga0307409_100271891 Ga0307409_1002718912 160
120 3300032005 Ga0307411_10369095 Ga0307411_103690952 160
121 3300032005 Ga0307411_11183448 Ga0307411_111834481 160
122 3300035398 Ga0316574_0012994 Ga0316574_0012994_3842_4363 160
123 3300035692 Ga0373935_0220270 Ga0373935_0220270_301_840 160
124 3300036401 Ga0373937_0076013 Ga0373937_0076013_2018_2557 160
125 3300037312 Ga0395899_0036429 Ga0395899_0036429_1786_2289 160
126 3300039093 Ga0400489_94102 Ga0400489_94102_290_781 160
127 3300041498 Ga0451841_1304763 Ga0451841_1304763_53_565 160
128 3300046455 Ga0495603_0325317 Ga0495603_0325317_363_866 160
129 3300046459 Ga0495629_0052783 Ga0495629_0052783_363_866 160
130 3300046473 Ga0495582_0178244 Ga0495582_0178244_676_1179 160
131 3300046474 Ga0495605_0054258 Ga0495605_0054258_463_969 160
132 3300046474 Ga0495605_0089272 Ga0495605_0089272_48_551 160
133 3300046474 Ga0495605_0101457 Ga0495605_0101457_442_948 160
134 3300046491 Ga0495584_0001480 Ga0495584_0001480_1571_2074 160
135 3300046491 Ga0495584_0002931 Ga0495584_0002931_8399_8929 160
136 3300046491 Ga0495584_0005044 Ga0495584_0005044_1438_1941 160
137 3300046491 Ga0495584_0011853 Ga0495584_0011853_29_535 160
138 3300046491 Ga0495584_0030625 Ga0495584_0030625_116_619 160
139 3300046492 Ga0495585_0014828 Ga0495585_0014828_888_1391 160
140 3300046492 Ga0495585_0039989 Ga0495585_0039989_1432_1935 160
141 3300046492 Ga0495585_0090775 Ga0495585_0090775_25_528 160
142 3300046492 Ga0495585_0211877 Ga0495585_0211877_315_845 160
143 3300046500 Ga0495596_0002080 Ga0495596_0002080_2188_2691 160
144 3300046500 Ga0495596_0029078 Ga0495596_0029078_754_1257 160
145 3300046500 Ga0495596_0058196 Ga0495596_0058196_884_1387 160
146 3300046500 Ga0495596_0260798 Ga0495596_0260798_126_656 160
147 3300046501 Ga0495607_0005245 Ga0495607_0005245_8650_9153 160
148 3300046501 Ga0495607_0046101 Ga0495607_0046101_831_1334 160
149 3300046506 Ga0495583_0000431 Ga0495583_0000431_62349_62879 160
150 3300046513 Ga0495616_0009555 Ga0495616_0009555_4908_5411 160
151 3300046513 Ga0495616_0073057 Ga0495616_0073057_196_699 160
152 3300046517 Ga0495630_0174822 Ga0495630_0174822_628_1170 160
153 3300046518 Ga0495631_0007725 Ga0495631_0007725_265_768 160
154 3300046519 Ga0495632_0010059 Ga0495632_0010059_4872_5375 160
155 3300046522 Ga0495643_0008099 Ga0495643_0008099_2090_2593 160
156 3300046523 Ga0495644_0009467 Ga0495644_0009467_469_999 160
157 3300046523 Ga0495644_0010751 Ga0495644_0010751_1471_1974 160
158 3300046528 Ga0495642_0030638 Ga0495642_0030638_1174_1677 160
159 3300046530 Ga0495654_0027128 Ga0495654_0027128_2411_2917 160
160 3300046538 Ga0495609_0158238 Ga0495609_0158238_46_552 160
161 3300046542 Ga0495597_0002323 Ga0495597_0002323_589_1095 160
162 3300046543 Ga0495645_0240878 Ga0495645_0240878_130_672 160
163 3300046557 Ga0495622_0020594 Ga0495622_0020594_1677_2180 160
164 3300046558 Ga0495633_0056308 Ga0495633_0056308_298_801 160
165 3300046616 Ga0495668_0004179 Ga0495668_0004179_5732_6238 160
166 3300046616 Ga0495668_0004799 Ga0495668_0004799_309_803 160
167 3300046616 Ga0495668_0039808 Ga0495668_0039808_1860_2390 160
168 3300046616 Ga0495668_0692845 Ga0495668_0692845_42_545 160
169 3300046648 Ga0495611_0000809 Ga0495611_0000809_743_1246 160
170 3300046648 Ga0495611_0024912 Ga0495611_0024912_637_1167 160
171 3300046648 Ga0495611_0085400 Ga0495611_0085400_868_1371 160
172 3300046665 Ga0495661_0050031 Ga0495661_0050031_564_1067 160
173 3300046674 Ga0495588_0191018 Ga0495588_0191018_498_1001 160
174 3300046679 Ga0495623_0075776 Ga0495623_0075776_834_1337 160
175 3300046684 Ga0495669_0085713 Ga0495669_0085713_469_972 160
176 3300046689 Ga0495613_0116788 Ga0495613_0116788_1361_1900 160
177 3300046689 Ga0495613_0131380 Ga0495613_0131380_788_1291 160
178 3300046691 Ga0495670_0028397 Ga0495670_0028397_517_1020 160
179 3300046694 Ga0495649_0013017 Ga0495649_0013017_290_793 160
180 3300046694 Ga0495649_0051186 Ga0495649_0051186_1676_2206 160
181 3300046694 Ga0495649_0120578 Ga0495649_0120578_539_1045 160
182 3300046794 Ga0495589_0122260 Ga0495589_0122260_635_1138 160
183 3300046794 Ga0495589_0170687 Ga0495589_0170687_99_602 160
184 3300046794 Ga0495589_0423102 Ga0495589_0423102_12_515 160
185 3300046810 Ga0495660_0006996 Ga0495660_0006996_264_767 160
186 3300047315 Ga0495581_0109469 Ga0495581_0109469_49_552 160
187 3300047320 Ga0495672_0014139 Ga0495672_0014139_2236_2739 160
188 3300047323 Ga0495683_0027400 Ga0495683_0027400_1585_2088 160
189 3300047444 Ga0495675_0021517 Ga0495675_0021517_226_765 160
190 3300047445 Ga0495677_0001803 Ga0495677_0001803_7757_8260 160
191 3300047445 Ga0495677_0063703 Ga0495677_0063703_196_699 160
192 3300047446 Ga0495679_015184 Ga0495679_015184_281_784 160
193 3300047470 Ga0495681_0005804 Ga0495681_0005804_294_824 160
194 3300047470 Ga0495681_0068206 Ga0495681_0068206_271_774 160
195 3300047472 Ga0495686_0001090 Ga0495686_0001090_17454_17957 160
196 3300047673 Ga0495593_0075005 Ga0495593_0075005_808_1311 160
197 3300048089 Ga0495614_0020692 Ga0495614_0020692_766_1269 160
198 3300048091 Ga0495626_0007763 Ga0495626_0007763_4843_5349 160
199 3300048091 Ga0495626_0009485 Ga0495626_0009485_3785_4288 160
200 3300048091 Ga0495626_0020052 Ga0495626_0020052_1756_2259 160
201 3300048915 Ga0496112_0405111 Ga0496112_0405111_129_611 160
202 3300048915 Ga0496112_0423697 Ga0496112_0423697_602_1084 160
203 3300048916 Ga0496113_0040525 Ga0496113_0040525_111_593 160
204 3300048916 Ga0496113_1085340 Ga0496113_1085340_38_520 160
205 3300048918 Ga0496115_0013225 Ga0496115_0013225_2813_3319 160
206 3300048918 Ga0496115_0229552 Ga0496115_0229552_264_746 160
207 3300048929 Ga0496126_0009231 Ga0496126_0009231_2008_2490 160
208 3300049460 Ga0495682_0000794 Ga0495682_0000794_14106_14609 160
209 3300049572 Ga0501036_0633959 Ga0501036_0633959_289_861 160
210 3300049580 Ga0501046_0680688 Ga0501046_0680688_156_641 160
211 3300050513 nmdc:mga0rr50_733316_c1 nmdc:mga0rr50_733316_c1_23_571 160
212 3300050514 nmdc:mga08x19_36090_c1 nmdc:mga08x19_36090_c1_1898_2446 160
213 3300053077 Ga0495601_0360951 Ga0495601_0360951_16_558 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

18

170

0.94

PF08445

FR47

FR47-like protein

86

159

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

31

150

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

152

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

16

151

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.983 1 159
5jtf-assembly1.cif.gz_B crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440 0.9829 1 159
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9784 1 160
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9779 1 159
5t7d-assembly1.cif.gz_A crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a 0.9774 1 160
ID Description Score Start End Superfamily
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9834 1 159 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.978 1 159 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9771 1 160 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9713 1 159 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9711 1 160 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A517X0M6-F1-model_v4 Phosphinothricin N-acetyltransferase (EC 2.3.1.183) 0.9981 1 160 GO:0102971
AF-A0A1I4DYT8-F1-model_v4 Phosphinothricin acetyltransferase 0.9975 1 159 GO:0016747
AF-A0A843SG52-F1-model_v4 GNAT family N-acetyltransferase 0.9972 1 159 GO:0016747
AF-A0A5B9YN18-F1-model_v4 deleted 0.9968 1 160
AF-A0A7G8ZTF0-F1-model_v4 deleted 0.9957 1 160

Feature Viewer

pLDDT pTM Quality
96.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map