F324066

General Info

Members Datasets Scaffolds Average Seq Length
213 116 426 267

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10640945|Ga0157372_106409452
Length 302
Sequence MIHYKSSEEIEKLRQSCKIVNDSIAHAASFLKPGISTLELNDIAEEFILAQGAVPNFKHYHGYPFACCISVNDAVVHGFPTKEPLKEGDIISIDCGALKNGYHGDSAYTFALGEISEEVKQLLRVTKEALYLGIEKAVVGNRIGDISAAIQEYTEKQHGYGVVRELVGHGIGRELHEDPQIPNYGKRGKGSKLKDGLVIAIEPMINLGTKDVYNDKDGWTVRTSDGKPAAHYEHMVCVRKNKADILTSFSSIEAAEKANSNLWSDYYLQATAILCELSNTPNTRINEGYISVFSKWNKKSLL

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
116 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0.94
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 0
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10640945 3300013307 Unclassified 1237
2 Ga0055540_1000044 3300003792 Bacteria 153394
3 Ga0065714_10135594 3300005288 Bacteria 1211
4 Ga0070676_10265327 3300005328 Bacteria 1151
5 Ga0070680_100009085 3300005336 Bacteria 7620
6 Ga0070680_100184723 3300005336 Bacteria 1756
7 Ga0070680_100259638 3300005336 Unclassified 1469
8 Ga0070682_100000039 3300005337 Bacteria 144400
9 Ga0070682_100035432 3300005337 Bacteria 3047
10 Ga0070660_100034214 3300005339 Bacteria 3837
11 Ga0070660_100044260 3300005339 Bacteria 3404
12 Ga0070660_100525777 3300005339 Bacteria 985
13 Ga0070692_10081425 3300005345 Bacteria 1744
14 Ga0070675_100022698 3300005354 Bacteria 5014
15 Ga0070671_100033495 3300005355 Bacteria 4250
16 Ga0070671_100183666 3300005355 Bacteria 1771
17 Ga0070673_100075597 3300005364 Bacteria 2717
18 Ga0070659_100039214 3300005366 Bacteria 3697
19 Ga0070659_100089281 3300005366 Bacteria 2469
20 Ga0070659_100120418 3300005366 Bacteria 2125
21 Ga0070659_100325817 3300005366 Bacteria 1285
22 Ga0070667_100346427 3300005367 Bacteria 1344
23 Ga0070709_10010041 3300005434 Bacteria 5233
24 Ga0070678_100042039 3300005456 Bacteria 3246
25 Ga0070681_10042072 3300005458 Bacteria 4579
26 Ga0070681_10260450 3300005458 Unclassified 1646
27 Ga0068867_100012400 3300005459 Bacteria 6029
28 Ga0070679_100000558 3300005530 Bacteria 31616
29 Ga0070679_100045117 3300005530 Bacteria 4392
30 Ga0070679_100586196 3300005530 Unclassified 1058
31 Ga0070679_100660939 3300005530 Bacteria 988
32 Ga0068853_100064199 3300005539 Bacteria 3183
33 Ga0068853_100318630 3300005539 Bacteria 1441
34 Ga0070672_100336439 3300005543 Bacteria 1285
35 Ga0070704_100001944 3300005549 Bacteria 11440
36 Ga0068855_100000943 3300005563 Bacteria 36241
37 Ga0068855_100102237 3300005563 Bacteria 3298
38 Ga0068855_100135716 3300005563 Bacteria 2807
39 Ga0068855_100211694 3300005563 Unclassified 2178
40 Ga0068855_100390717 3300005563 Bacteria 1526
41 Ga0068857_100417567 3300005577 Unclassified 1250
42 Ga0068854_100056452 3300005578 Bacteria 2830
43 Ga0068854_100094649 3300005578 Bacteria 2228
44 Ga0068856_100009626 3300005614 Bacteria 9382
45 Ga0068856_100031449 3300005614 Bacteria 5192
46 Ga0070702_100016016 3300005615 Bacteria 3840
47 Ga0068852_100077573 3300005616 Bacteria 2937
48 Ga0068852_100199500 3300005616 Unclassified 1893
49 Ga0068859_100000536 3300005617 Bacteria 37574
50 Ga0068864_100251252 3300005618 Bacteria 1642
51 Ga0068864_100581585 3300005618 Unclassified 1085
52 Ga0068866_10082479 3300005718 Bacteria 1730
53 Ga0068860_100085250 3300005843 Bacteria 3006
54 Ga0081455_10080680 3300005937 Bacteria 2666
55 Ga0070717_10733211 3300006028 Bacteria 898
56 Ga0097621_100041865 3300006237 Bacteria 3689
57 Ga0097621_100090533 3300006237 Bacteria 2560
58 Ga0075370_10205892 3300006353 Bacteria 1161
59 Ga0068871_100013362 3300006358 Bacteria 6092
60 Ga0068865_100048349 3300006881 Bacteria 2927
61 Ga0097620_100000536 3300006931 Bacteria 37574
62 Ga0105240_10000118 3300009093 Bacteria 163934
63 Ga0105240_10050909 3300009093 Bacteria 5216
64 Ga0105241_10008678 3300009174 Bacteria 7470
65 Ga0105237_10030357 3300009545 Bacteria 5490
66 Ga0105237_10075639 3300009545 Bacteria 3358
67 Ga0105249_10011004 3300009553 Bacteria 7949
68 Ga0105239_10041952 3300010375 Bacteria 5013
69 Ga0157373_10005189 3300013100 Bacteria 9789
70 Ga0157373_10059452 3300013100 Bacteria 2708
71 Ga0157373_10072228 3300013100 Bacteria 2436
72 Ga0157373_10295806 3300013100 Bacteria 1148
73 Ga0157371_10001816 3300013102 Bacteria 21541
74 Ga0157371_10004257 3300013102 Bacteria 12588
75 Ga0157371_10004272 3300013102 Bacteria 12548
76 Ga0157371_10005830 3300013102 Bacteria 10306
77 Ga0157371_10024723 3300013102 Bacteria 4382
78 Ga0157371_10028097 3300013102 Bacteria 4075
79 Ga0157371_10040975 3300013102 Bacteria 3306
80 Ga0157371_10270166 3300013102 Unclassified 1227
81 Ga0157370_10000926 3300013104 Bacteria 37246
82 Ga0157370_10016943 3300013104 Bacteria 7366
83 Ga0157370_10038547 3300013104 Bacteria 4622
84 Ga0157370_10233642 3300013104 Unclassified 1701
85 Ga0157369_10012427 3300013105 Bacteria 9664
86 Ga0157369_10026567 3300013105 Bacteria 6421
87 Ga0157369_10151989 3300013105 Bacteria 2447
88 Ga0157378_10038223 3300013297 Bacteria 4253
89 Ga0163162_10017797 3300013306 Bacteria 6954
90 Ga0163162_10019180 3300013306 Bacteria 6706
91 Ga0163162_10194477 3300013306 Bacteria 2157
92 Ga0163162_10625686 3300013306 Bacteria 1201
93 Ga0157372_10023315 3300013307 Bacteria 6708
94 Ga0157372_10052039 3300013307 Bacteria 4558
95 Ga0157372_10084818 3300013307 Bacteria 3592
96 Ga0157372_10165684 3300013307 Bacteria 2556
97 Ga0157372_10199500 3300013307 Bacteria 2318
98 Ga0157372_10582189 3300013307 Bacteria 1304
99 Ga0157375_10145177 3300013308 Bacteria 2503
100 Ga0157380_10000051 3300014326 Bacteria 68466
101 Ga0157380_10360808 3300014326 Bacteria 1363
102 Ga0157376_10502507 3300014969 Bacteria 1192
103 Ga0157376_10592793 3300014969 Bacteria 1102
104 Ga0163161_10075385 3300017792 Unclassified 2475
105 Ga0163161_10258001 3300017792 Bacteria 1361
106 Ga0209051_1000051 3300025303 Bacteria 283620
107 Ga0207642_10085434 3300025899 Bacteria 1544
108 Ga0207645_10042377 3300025907 Bacteria 2912
109 Ga0207705_10058325 3300025909 Bacteria 2785
110 Ga0207705_10101736 3300025909 Bacteria 2114
111 Ga0207654_10095863 3300025911 Unclassified 1818
112 Ga0207707_10089410 3300025912 Bacteria 2691
113 Ga0207695_10003048 3300025913 Bacteria 24011
114 Ga0207695_10004647 3300025913 Bacteria 18602
115 Ga0207671_10089510 3300025914 Bacteria 2316
116 Ga0207660_10020786 3300025917 Bacteria 4411
117 Ga0207660_10071943 3300025917 Bacteria 2517
118 Ga0207657_10138615 3300025919 Bacteria 1989
119 Ga0207652_10000064 3300025921 Bacteria 111997
120 Ga0207652_10000387 3300025921 Bacteria 45946
121 Ga0207652_10038911 3300025921 Bacteria 4034
122 Ga0207652_10175615 3300025921 Bacteria 1924
123 Ga0207650_10191385 3300025925 Unclassified 1635
124 Ga0207644_10035602 3300025931 Bacteria 3489
125 Ga0207644_10120726 3300025931 Bacteria 1995
126 Ga0207690_10014550 3300025932 Bacteria 4752
127 Ga0207690_10038464 3300025932 Bacteria 3114
128 Ga0207690_10047697 3300025932 Bacteria 2844
129 Ga0207704_10086287 3300025938 Bacteria 2046
130 Ga0207691_10055795 3300025940 Bacteria 3600
131 Ga0207661_10098438 3300025944 Bacteria 2451
132 Ga0207667_10001484 3300025949 Bacteria 29439
133 Ga0207667_10005923 3300025949 Bacteria 14885
134 Ga0207667_10022470 3300025949 Bacteria 6967
135 Ga0207667_10178453 3300025949 Bacteria 2181
136 Ga0207640_10058532 3300025981 Bacteria 2539
137 Ga0207640_10253929 3300025981 Bacteria 1366
138 Ga0207658_10430882 3300025986 Bacteria 1165
139 Ga0207639_10054590 3300026041 Bacteria 3054
140 Ga0207639_10305876 3300026041 Unclassified 1407
141 Ga0207639_10749522 3300026041 Unclassified 908
142 Ga0207678_10056701 3300026067 Bacteria 3372
143 Ga0207702_10080196 3300026078 Bacteria 2831
144 Ga0207702_10152938 3300026078 Bacteria 2100
145 Ga0207648_10020128 3300026089 Bacteria 6016
146 Ga0207648_10141527 3300026089 Bacteria 2120
147 Ga0207648_10289388 3300026089 Bacteria 1467
148 Ga0207648_10325435 3300026089 Bacteria 1382
149 Ga0207676_10498770 3300026095 Bacteria 1156
150 Ga0207683_10014210 3300026121 Bacteria 6783
151 Ga0207683_10027854 3300026121 Bacteria 4883
152 Ga0207683_10545426 3300026121 Bacteria 1072
153 Ga0207698_10031446 3300026142 Bacteria 3831
154 Ga0268264_10069555 3300028381 Bacteria 2977
155 Ga0265318_10043021 3300028577 Bacteria 1713
156 Ga0307515_10000001 3300028794 Bacteria 4259510
157 Ga0265338_10001855 3300028800 Bacteria 33207
158 Ga0265327_10000159 3300031251 Bacteria 145537
159 Ga0316576_10032421 3300031727 Bacteria 3713
160 Ga0316576_10152932 3300031727 Bacteria 1739
161 Ga0307415_100023957 3300032126 Bacteria 3801
162 Ga0316593_10070872 3300032168 Bacteria 1205
163 Ga0316592_1018576 3300033524 Bacteria 1466
164 Ga0395899_0005706 3300037312 Bacteria 9665
165 Ga0395899_0011094 3300037312 Bacteria 6901
166 Ga0395899_0017668 3300037312 Bacteria 5432
167 Ga0395899_0089768 3300037312 Bacteria 2228
168 Ga0395899_0355678 3300037312 Bacteria 978
169 Ga0395900_0006742 3300037418 Bacteria 11915
170 Ga0395900_0019424 3300037418 Bacteria 6928
171 Ga0395900_0049518 3300037418 Bacteria 4329
172 Ga0395900_0172288 3300037418 Bacteria 2202
173 Ga0395900_0182087 3300037418 Bacteria 2134
174 Ga0395898_0003249 3300037466 Bacteria 18266
175 Ga0395898_0018047 3300037466 Bacteria 7198
176 Ga0395898_0044959 3300037466 Bacteria 4341
177 Ga0395898_0064057 3300037466 Unclassified 3566
178 Ga0395905_0018728 3300037471 Bacteria 6567
179 Ga0395901_0001115 3300038443 Bacteria 28520
180 Ga0395901_0033522 3300038443 Bacteria 5301
181 Ga0395901_0051520 3300038443 Bacteria 4280
182 Ga0395901_0072630 3300038443 Bacteria 3587
183 Ga0439461_0033066 3300041410 Bacteria 1087
184 Ga0451855_0319846 3300041511 Bacteria 2063
185 Ga0466972_0024425 3300044658 Bacteria 2999
186 Ga0453683_0011208 3300044673 Bacteria 5922
187 Ga0453683_0058026 3300044673 Bacteria 2421
188 Ga0453684_0024422 3300044712 Bacteria 8837
189 Ga0453684_0064505 3300044712 Bacteria 4678
190 Ga0453684_0136620 3300044712 Bacteria 2934
191 Ga0451576_0176056 3300045051 Bacteria 2233
192 Ga0451576_0203523 3300045051 Bacteria 2067
193 Ga0451576_0263767 3300045051 Bacteria 1801
194 Ga0495587_0009359 3300046536 Bacteria 6282
195 Ga0501034_0002020 3300049571 Bacteria 25539
196 Ga0501036_0109139 3300049572 Bacteria 2338
197 Ga0501036_0187869 3300049572 Bacteria 1739
198 Ga0501038_0012082 3300049574 Bacteria 7884
199 Ga0501039_0002246 3300049575 Bacteria 14315
200 Ga0501040_0219710 3300049576 Bacteria 1352
201 Ga0501043_0000567 3300049579 Bacteria 33043
202 Ga0501047_0133364 3300049581 Bacteria 2364
203 Ga0501070_0006038 3300049586 Bacteria 10314
204 Ga0501073_0004745 3300049589 Bacteria 10201
205 Ga0501077_0099128 3300049593 Bacteria 1847
206 Ga0501035_0021560 3300049822 Bacteria 5924
207 Ga0501035_0060198 3300049822 Bacteria 3381
208 Ga0501044_0056087 3300049823 Bacteria 4045
209 Ga0501044_0267069 3300049823 Bacteria 1648
210 Ga0501044_0298981 3300049823 Bacteria 1539
211 Ga0500646_0001080 3300053090 Bacteria 7408
212 2795794809 2795385472 Bacteria 6627535
213 8054473634 8054472261 Bacteria 7464355
214 Ga0157372_10640945
215 Ga0055540_1000044
216 Ga0065714_10135594
217 Ga0070676_10265327
218 Ga0070680_100009085
219 Ga0070680_100184723
220 Ga0070680_100259638
221 Ga0070682_100000039
222 Ga0070682_100035432
223 Ga0070660_100034214
224 Ga0070660_100044260
225 Ga0070660_100525777
226 Ga0070692_10081425
227 Ga0070675_100022698
228 Ga0070671_100033495
229 Ga0070671_100183666
230 Ga0070673_100075597
231 Ga0070659_100039214
232 Ga0070659_100089281
233 Ga0070659_100120418
234 Ga0070659_100325817
235 Ga0070667_100346427
236 Ga0070709_10010041
237 Ga0070678_100042039
238 Ga0070681_10042072
239 Ga0070681_10260450
240 Ga0068867_100012400
241 Ga0070679_100000558
242 Ga0070679_100045117
243 Ga0070679_100586196
244 Ga0070679_100660939
245 Ga0068853_100064199
246 Ga0068853_100318630
247 Ga0070672_100336439
248 Ga0070704_100001944
249 Ga0068855_100000943
250 Ga0068855_100102237
251 Ga0068855_100135716
252 Ga0068855_100211694
253 Ga0068855_100390717
254 Ga0068857_100417567
255 Ga0068854_100056452
256 Ga0068854_100094649
257 Ga0068856_100009626
258 Ga0068856_100031449
259 Ga0070702_100016016
260 Ga0068852_100077573
261 Ga0068852_100199500
262 Ga0068859_100000536
263 Ga0068864_100251252
264 Ga0068864_100581585
265 Ga0068866_10082479
266 Ga0068860_100085250
267 Ga0081455_10080680
268 Ga0070717_10733211
269 Ga0097621_100041865
270 Ga0097621_100090533
271 Ga0075370_10205892
272 Ga0068871_100013362
273 Ga0068865_100048349
274 Ga0097620_100000536
275 Ga0105240_10000118
276 Ga0105240_10050909
277 Ga0105241_10008678
278 Ga0105237_10030357
279 Ga0105237_10075639
280 Ga0105249_10011004
281 Ga0105239_10041952
282 Ga0157373_10005189
283 Ga0157373_10059452
284 Ga0157373_10072228
285 Ga0157373_10295806
286 Ga0157371_10001816
287 Ga0157371_10004257
288 Ga0157371_10004272
289 Ga0157371_10005830
290 Ga0157371_10024723
291 Ga0157371_10028097
292 Ga0157371_10040975
293 Ga0157371_10270166
294 Ga0157370_10000926
295 Ga0157370_10016943
296 Ga0157370_10038547
297 Ga0157370_10233642
298 Ga0157369_10012427
299 Ga0157369_10026567
300 Ga0157369_10151989
301 Ga0157378_10038223
302 Ga0163162_10017797
303 Ga0163162_10019180
304 Ga0163162_10194477
305 Ga0163162_10625686
306 Ga0157372_10023315
307 Ga0157372_10052039
308 Ga0157372_10084818
309 Ga0157372_10165684
310 Ga0157372_10199500
311 Ga0157372_10582189
312 Ga0157375_10145177
313 Ga0157380_10000051
314 Ga0157380_10360808
315 Ga0157376_10502507
316 Ga0157376_10592793
317 Ga0163161_10075385
318 Ga0163161_10258001
319 Ga0209051_1000051
320 Ga0207642_10085434
321 Ga0207645_10042377
322 Ga0207705_10058325
323 Ga0207705_10101736
324 Ga0207654_10095863
325 Ga0207707_10089410
326 Ga0207695_10003048
327 Ga0207695_10004647
328 Ga0207671_10089510
329 Ga0207660_10020786
330 Ga0207660_10071943
331 Ga0207657_10138615
332 Ga0207652_10000064
333 Ga0207652_10000387
334 Ga0207652_10038911
335 Ga0207652_10175615
336 Ga0207650_10191385
337 Ga0207644_10035602
338 Ga0207644_10120726
339 Ga0207690_10014550
340 Ga0207690_10038464
341 Ga0207690_10047697
342 Ga0207704_10086287
343 Ga0207691_10055795
344 Ga0207661_10098438
345 Ga0207667_10001484
346 Ga0207667_10005923
347 Ga0207667_10022470
348 Ga0207667_10178453
349 Ga0207640_10058532
350 Ga0207640_10253929
351 Ga0207658_10430882
352 Ga0207639_10054590
353 Ga0207639_10305876
354 Ga0207639_10749522
355 Ga0207678_10056701
356 Ga0207702_10080196
357 Ga0207702_10152938
358 Ga0207648_10020128
359 Ga0207648_10141527
360 Ga0207648_10289388
361 Ga0207648_10325435
362 Ga0207676_10498770
363 Ga0207683_10014210
364 Ga0207683_10027854
365 Ga0207683_10545426
366 Ga0207698_10031446
367 Ga0268264_10069555
368 Ga0265318_10043021
369 Ga0307515_10000001
370 Ga0265338_10001855
371 Ga0265327_10000159
372 Ga0316576_10032421
373 Ga0316576_10152932
374 Ga0307415_100023957
375 Ga0316593_10070872
376 Ga0316592_1018576
377 Ga0395899_0005706
378 Ga0395899_0011094
379 Ga0395899_0017668
380 Ga0395899_0089768
381 Ga0395899_0355678
382 Ga0395900_0006742
383 Ga0395900_0019424
384 Ga0395900_0049518
385 Ga0395900_0172288
386 Ga0395900_0182087
387 Ga0395898_0003249
388 Ga0395898_0018047
389 Ga0395898_0044959
390 Ga0395898_0064057
391 Ga0395905_0018728
392 Ga0395901_0001115
393 Ga0395901_0033522
394 Ga0395901_0051520
395 Ga0395901_0072630
396 Ga0439461_0033066
397 Ga0451855_0319846
398 Ga0466972_0024425
399 Ga0453683_0011208
400 Ga0453683_0058026
401 Ga0453684_0024422
402 Ga0453684_0064505
403 Ga0453684_0136620
404 Ga0451576_0176056
405 Ga0451576_0203523
406 Ga0451576_0263767
407 Ga0495587_0009359
408 Ga0501034_0002020
409 Ga0501036_0109139
410 Ga0501036_0187869
411 Ga0501038_0012082
412 Ga0501039_0002246
413 Ga0501040_0219710
414 Ga0501043_0000567
415 Ga0501047_0133364
416 Ga0501070_0006038
417 Ga0501073_0004745
418 Ga0501077_0099128
419 Ga0501035_0021560
420 Ga0501035_0060198
421 Ga0501044_0056087
422 Ga0501044_0267069
423 Ga0501044_0298981
424 Ga0500646_0001080
425 2795794809
426 8054473634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

240

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.928 1 240
5yr4-assembly1.cif.gz_A human methionine aminopeptidase type 1b (f309m mutant) in complex with tnp470 0.9251 1 240
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.9242 1 240
5yr4-assembly1.cif.gz_A human methionine aminopeptidase type 1b (f309m mutant) in complex with tnp470 0.9214 1 240
8bqx-assembly1.cif.gz_x yeast 80s ribosome in complex with map1 (conformation 2) 0.9193 1 240
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9778 13 130 3.90.230.10
af_A0A1D6KR54_2_160_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9581 89 240 3.90.230.10
af_Q8IAP0_195_391_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9292 3 125 3.90.230.10
af_Q54VU7_119_404_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9268 1 240 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9248 1 240 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A067HD11-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9823 69 189 GO:0004239
GO:0006508
GO:0046872
GO:0070006
AF-A0A446LE53-F1-model_v4 deleted 0.9816 45 191
AF-A0A7J7WI53-F1-model_v4 Methionyl aminopeptidase type 1D, mitochondrial 0.9795 35 162 GO:0070006
AF-K0VC14-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9792 1 187 GO:0004239
GO:0006508
GO:0046872
GO:0070006
AF-A0A7K9CTD1-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9792 1 189 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map