F324036

General Info

Members Datasets Scaffolds Average Seq Length
213 182 426 149

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10600664|Ga0105239_106006642
Length 170
Sequence MTGRARTSYFPNGLPIPVAEPDGLSAPYWTGLREGRLMVQRCRHCQTWQFGPEWLCHRCHAFDPDWVEVEPRGRIFSWERVWHPSHAALKEHGPYLAVLVELPHAGDVRMVGNLLGDPRQPVTIGDEVVGAFEHHPEAEPAYSLVQWRKPNWEDRMIDSEPISSPVGLVP

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
146 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
149 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
155 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
156 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
162 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
163 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
164 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
165 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
166 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
167 2643221683 Variovorax sp. Root473 Isolate Unclassified
168 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
169 2738541307 Variovorax sp. GV008 Isolate Unclassified
170 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
171 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
172 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
173 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
174 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
175 2904699407
176 2906610324
177 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
178 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
179 2922425934
180 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
181 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
182 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.9
Metatranscriptomes 0
Isolates 8.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.84
Nodule 4.69
Rhizoplane 0.47
Rhizosphere 62.91
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10600664 3300010375 Bacteria 1255
2 rootH1_10281028 3300003323 Bacteria 1336
3 JGI25404J52841_10000924 3300003659 Bacteria 4773
4 Ga0055531_10093829 3300003794 Bacteria 630
5 Ga0065165_1000348 3300005262 Bacteria 75762
6 Ga0065165_1002344 3300005262 Bacteria 16462
7 Ga0065707_10361017 3300005295 Bacteria 904
8 Ga0070658_10287295 3300005327 Archaea 1401
9 Ga0070689_100587312 3300005340 Bacteria 963
10 Ga0070669_100630892 3300005353 Bacteria 900
11 Ga0070671_100044168 3300005355 Bacteria 3703
12 Ga0070667_100095839 3300005367 Bacteria 2559
13 Ga0070662_100853972 3300005457 Bacteria 775
14 Ga0070662_100916009 3300005457 Bacteria 748
15 Ga0070706_100533119 3300005467 Bacteria 1092
16 Ga0070679_100310644 3300005530 Bacteria 1526
17 Ga0070696_100949244 3300005546 Bacteria 716
18 Ga0070665_100251555 3300005548 Bacteria 1768
19 Ga0068855_100149722 3300005563 Bacteria 2654
20 Ga0068856_100147725 3300005614 Bacteria 2358
21 Ga0068859_100134517 3300005617 Bacteria 2544
22 Ga0068864_100058409 3300005618 Bacteria 3334
23 Ga0068863_100002362 3300005841 Bacteria 18774
24 Ga0068863_100600610 3300005841 Bacteria 1089
25 Ga0068858_101277128 3300005842 Unclassified 722
26 Ga0068860_100188558 3300005843 Bacteria 1995
27 Ga0068862_100496119 3300005844 Bacteria 1158
28 Ga0068862_100547121 3300005844 Bacteria 1105
29 Ga0081455_10007622 3300005937 Bacteria 11372
30 Ga0081455_10496025 3300005937 Bacteria 821
31 Ga0081540_1000321 3300005983 Bacteria 49539
32 Ga0081540_1150202 3300005983 Bacteria 920
33 Ga0075363_100003460 3300006048 Bacteria 6716
34 Ga0070712_100088901 3300006175 Bacteria 2258
35 Ga0075362_10001073 3300006177 Bacteria 8460
36 Ga0075370_10057987 3300006353 Bacteria 2202
37 Ga0075434_100709908 3300006871 Bacteria 1023
38 Ga0097620_100134522 3300006931 Bacteria 2544
39 Ga0099794_10394128 3300007265 Bacteria 723
40 Ga0105244_10168643 3300009036 Bacteria 1042
41 Ga0105240_10148275 3300009093 Bacteria 2797
42 Ga0105240_10202720 3300009093 Bacteria 2324
43 Ga0105241_11921126 3300009174 Bacteria 581
44 Ga0105248_10011697 3300009177 Bacteria 9674
45 Ga0105237_10007548 3300009545 Bacteria 11884
46 Ga0105249_10511871 3300009553 Bacteria 1247
47 Ga0105239_10060052 3300010375 Bacteria 4172
48 Ga0105239_10300766 3300010375 Bacteria 1807
49 Ga0105239_10695739 3300010375 Bacteria 1162
50 Ga0157370_10092007 3300013104 Bacteria 2847
51 Ga0157369_10001394 3300013105 Bacteria 29676
52 Ga0157374_11240692 3300013296 Unclassified 767
53 Ga0163162_10402071 3300013306 Bacteria 1502
54 Ga0163163_10002074 3300014325 Bacteria 16923
55 Ga0213875_10045853 3300021388 Bacteria 2052
56 Ga0209233_1001415 3300025261 Bacteria 9460
57 Ga0209455_1005377 3300025272 Bacteria 3971
58 Ga0209564_1020150 3300025295 Bacteria 2457
59 Ga0209256_1003094 3300025299 Bacteria 12191
60 Ga0207426_1004671 3300025302 Bacteria 6584
61 Ga0207426_1035415 3300025302 Bacteria 1593
62 Ga0209257_1051297 3300025304 Bacteria 1163
63 Ga0207647_10131359 3300025904 Bacteria 1472
64 Ga0207699_10067970 3300025906 Bacteria 2168
65 Ga0207684_10032044 3300025910 Bacteria 4471
66 Ga0207695_10025006 3300025913 Bacteria 6699
67 Ga0207695_10245749 3300025913 Bacteria 1689
68 Ga0207693_10427270 3300025915 Bacteria 1036
69 Ga0207649_10401276 3300025920 Bacteria 1026
70 Ga0207644_10010947 3300025931 Bacteria 5993
71 Ga0207690_10251019 3300025932 Bacteria 1366
72 Ga0207706_10285339 3300025933 Bacteria 1439
73 Ga0207706_10600122 3300025933 Unclassified 946
74 Ga0207670_10982772 3300025936 Bacteria 710
75 Ga0207711_10058679 3300025941 Bacteria 3313
76 Ga0207711_10091355 3300025941 Bacteria 2678
77 Ga0207689_10206359 3300025942 Bacteria 1623
78 Ga0207661_10914044 3300025944 Bacteria 808
79 Ga0207667_10067113 3300025949 Bacteria 3737
80 Ga0207712_10315856 3300025961 Bacteria 1287
81 Ga0207658_10037197 3300025986 Bacteria 3495
82 Ga0207703_10014221 3300026035 Bacteria 6207
83 Ga0207703_11074959 3300026035 Bacteria 773
84 Ga0207702_12487993 3300026078 Bacteria 504
85 Ga0207641_10059121 3300026088 Bacteria 3263
86 Ga0268265_10073829 3300028380 Bacteria 2666
87 Ga0268265_10268808 3300028380 Bacteria 1520
88 Ga0268265_10294523 3300028380 Bacteria 1458
89 Ga0268264_10018334 3300028381 Bacteria 5723
90 Ga0268264_10805817 3300028381 Bacteria 939
91 Ga0307513_10688787 3300031456 Bacteria 728
92 Ga0307509_10277847 3300031507 Bacteria 1438
93 Ga0307514_10446534 3300031649 Bacteria 638
94 Ga0316577_10220587 3300031733 Bacteria 1072
95 Ga0373923_0073361 3300035111 Bacteria 1473
96 Ga0373954_0272434 3300035118 Bacteria 834
97 Ga0373943_0070207 3300035170 Bacteria 1772
98 Ga0373946_0012817 3300035171 Bacteria 3144
99 Ga0373955_0136848 3300035172 Bacteria 1433
100 Ga0373924_0192902 3300035410 Bacteria 897
101 Ga0373927_0055724 3300035695 Bacteria 2556
102 Ga0373933_0035280 3300035724 Bacteria 2920
103 Ga0373937_0001808 3300036401 Bacteria 17942
104 Ga0395900_0147203 3300037418 Bacteria 2408
105 Ga0395898_0051988 3300037466 Bacteria 4004
106 Ga0395905_0000984 3300037471 Bacteria 36542
107 Ga0436364_1189903 3300037853 Bacteria 2798
108 Ga0395901_0125884 3300038443 Bacteria 2693
109 Ga0436360_0595304 3300039438 Bacteria 1625
110 Ga0439436_0083687 3300041404 Bacteria 888
111 Ga0439466_0052730 3300041411 Bacteria 1329
112 Ga0451839_1236655 3300041496 Bacteria 625
113 Ga0439449_0014043 3300042007 Bacteria 3012
114 Ga0495617_015409 3300046452 Bacteria 2591
115 Ga0495638_0022695 3300046460 Bacteria 4116
116 Ga0495651_0620159 3300046462 Bacteria 680
117 Ga0495605_0337631 3300046474 Bacteria 633
118 Ga0495585_0030993 3300046492 Bacteria 3039
119 Ga0495596_0068800 3300046500 Bacteria 1376
120 Ga0495607_0408932 3300046501 Bacteria 616
121 Ga0495608_0090660 3300046511 Bacteria 1977
122 Ga0495610_0120533 3300046512 Bacteria 1150
123 Ga0495610_0293120 3300046512 Bacteria 630
124 Ga0495616_0049205 3300046513 Bacteria 2114
125 Ga0495632_0083951 3300046519 Bacteria 1516
126 Ga0495648_0020338 3300046524 Bacteria 4632
127 Ga0495640_0068411 3300046533 Bacteria 2390
128 Ga0495640_0481851 3300046533 Unclassified 756
129 Ga0495587_0022630 3300046536 Bacteria 3868
130 Ga0495609_0029220 3300046538 Bacteria 2511
131 Ga0495667_0193336 3300046559 Bacteria 1303
132 Ga0495656_0423785 3300046615 Bacteria 698
133 Ga0495668_0076507 3300046616 Bacteria 1837
134 Ga0495611_0023755 3300046648 Bacteria 2662
135 Ga0495669_0134472 3300046684 Bacteria 1165
136 Ga0495670_0245246 3300046691 Bacteria 954
137 Ga0495649_0091633 3300046694 Bacteria 1620
138 Ga0495589_0350332 3300046794 Bacteria 680
139 Ga0495600_0164173 3300046809 Bacteria 1435
140 Ga0495674_0768946 3300047319 Unclassified 751
141 Ga0495672_0507950 3300047320 Bacteria 535
142 Ga0495680_0893502 3300047322 Bacteria 574
143 Ga0495683_0122453 3300047323 Bacteria 1233
144 Ga0495684_0009508 3300047471 Bacteria 7502
145 Ga0495602_0043647 3300048088 Bacteria 4074
146 Ga0495626_0159201 3300048091 Bacteria 948
147 Ga0496120_0024898 3300048923 Bacteria 3724
148 Ga0496121_0056959 3300048924 Bacteria 3242
149 Ga0496121_0078003 3300048924 Bacteria 2635
150 Ga0496121_0081016 3300048924 Bacteria 2571
151 Ga0496121_0358542 3300048924 Bacteria 969
152 Ga0496122_0042319 3300048925 Bacteria 3586
153 Ga0496122_0453063 3300048925 Unclassified 636
154 Ga0496124_0009112 3300048927 Bacteria 10259
155 Ga0496124_0046772 3300048927 Bacteria 3704
156 Ga0496126_0007873 3300048929 Bacteria 11603
157 Ga0496126_0017764 3300048929 Bacteria 7080
158 Ga0496126_0053645 3300048929 Bacteria 3656
159 Ga0496126_0094364 3300048929 Bacteria 2626
160 Ga0496126_0209001 3300048929 Bacteria 1644
161 Ga0495682_0180578 3300049460 Bacteria 750
162 Ga0501033_0600094 3300049570 Bacteria 755
163 Ga0501046_0102969 3300049580 Bacteria 2189
164 Ga0501047_0006290 3300049581 Bacteria 11167
165 Ga0501075_0294874 3300049591 Bacteria 1235
166 Ga0501080_0172180 3300049742 Bacteria 1996
167 Ga0501035_1047458 3300049822 Unclassified 639
168 Ga0501045_0135753 3300049824 Bacteria 1829
169 nmdc:mga03683_8906_c1 3300050489 Bacteria 3548
170 nmdc:mga0yw44_124142_c1 3300050492 Bacteria 1666
171 nmdc:mga07m45_162305_c1 3300050496 Bacteria 1297
172 Ga0500643_009658 3300053087 Bacteria 3666
173 Ga0500644_0084324 3300053088 Bacteria 1176
174 Ga0500646_0053748 3300053090 Bacteria 1168
175 Ga0500650_0211797 3300053098 Bacteria 880
176 Ga0500650_0381607 3300053098 Bacteria 612
177 Ga0500556_0144661 3300053104 Bacteria 935
178 Ga0500562_005275 3300053108 Bacteria 3249
179 Ga0500594_0066409 3300053118 Bacteria 1051
180 Ga0500642_0087182 3300053130 Bacteria 1440
181 Ga0500655_036077 3300053133 Bacteria 962
182 Ga0500559_0000120 3300053136 Bacteria 61423
183 Ga0500577_0150077 3300053142 Bacteria 988
184 Ga0500588_0038427 3300053146 Bacteria 1428
185 Ga0500588_0065464 3300053146 Bacteria 1177
186 Ga0500589_115673 3300053147 Bacteria 1144
187 Ga0500590_006116 3300053148 Bacteria 5842
188 Ga0500622_0011598 3300053156 Bacteria 4794
189 Ga0500627_0460917 3300053158 Bacteria 534
190 Ga0500633_0099396 3300053160 Bacteria 1070
191 Ga0500634_0067046 3300053161 Bacteria 1889
192 Ga0500611_173417 3300053727 Bacteria 602
193 Ga0500656_021453 3300053732 Bacteria 803
194 2513641368 2513237094 Bacteria 8789602
195 2513656977 2513237096 Bacteria 8722461
196 2513918717 2513237145 Bacteria 8979722
197 2524536663 2524023228 Bacteria 10118060
198 2644464356 2643221683 Bacteria 5749203
199 2671118328 2667528175 Bacteria 7532676
200 2738883839 2738541307 Bacteria 8606193
201 2793068995 2791355197 Bacteria 8420563
202 2847935623 2847930680 Bacteria 9342022
203 2881673374 2881665667 Bacteria 8175609
204 2885381046 2885374607 Bacteria 8927485
205 2904697915 2904690495 Bacteria 9412302
206 2904704525
207 2906616891
208 2908742078 2908739725 Bacteria 8628932
209 2908759738 2908756301 Bacteria 8864324
210 2922431036
211 3005480859 3005474847 Bacteria 9259049
212 8006939859 8006933436 Bacteria 10410654
213 8056682477 8056681323 Bacteria 8472857
214 Ga0105239_10600664
215 rootH1_10281028
216 JGI25404J52841_10000924
217 Ga0055531_10093829
218 Ga0065165_1000348
219 Ga0065165_1002344
220 Ga0065707_10361017
221 Ga0070658_10287295
222 Ga0070689_100587312
223 Ga0070669_100630892
224 Ga0070671_100044168
225 Ga0070667_100095839
226 Ga0070662_100853972
227 Ga0070662_100916009
228 Ga0070706_100533119
229 Ga0070679_100310644
230 Ga0070696_100949244
231 Ga0070665_100251555
232 Ga0068855_100149722
233 Ga0068856_100147725
234 Ga0068859_100134517
235 Ga0068864_100058409
236 Ga0068863_100002362
237 Ga0068863_100600610
238 Ga0068858_101277128
239 Ga0068860_100188558
240 Ga0068862_100496119
241 Ga0068862_100547121
242 Ga0081455_10007622
243 Ga0081455_10496025
244 Ga0081540_1000321
245 Ga0081540_1150202
246 Ga0075363_100003460
247 Ga0070712_100088901
248 Ga0075362_10001073
249 Ga0075370_10057987
250 Ga0075434_100709908
251 Ga0097620_100134522
252 Ga0099794_10394128
253 Ga0105244_10168643
254 Ga0105240_10148275
255 Ga0105240_10202720
256 Ga0105241_11921126
257 Ga0105248_10011697
258 Ga0105237_10007548
259 Ga0105249_10511871
260 Ga0105239_10060052
261 Ga0105239_10300766
262 Ga0105239_10695739
263 Ga0157370_10092007
264 Ga0157369_10001394
265 Ga0157374_11240692
266 Ga0163162_10402071
267 Ga0163163_10002074
268 Ga0213875_10045853
269 Ga0209233_1001415
270 Ga0209455_1005377
271 Ga0209564_1020150
272 Ga0209256_1003094
273 Ga0207426_1004671
274 Ga0207426_1035415
275 Ga0209257_1051297
276 Ga0207647_10131359
277 Ga0207699_10067970
278 Ga0207684_10032044
279 Ga0207695_10025006
280 Ga0207695_10245749
281 Ga0207693_10427270
282 Ga0207649_10401276
283 Ga0207644_10010947
284 Ga0207690_10251019
285 Ga0207706_10285339
286 Ga0207706_10600122
287 Ga0207670_10982772
288 Ga0207711_10058679
289 Ga0207711_10091355
290 Ga0207689_10206359
291 Ga0207661_10914044
292 Ga0207667_10067113
293 Ga0207712_10315856
294 Ga0207658_10037197
295 Ga0207703_10014221
296 Ga0207703_11074959
297 Ga0207702_12487993
298 Ga0207641_10059121
299 Ga0268265_10073829
300 Ga0268265_10268808
301 Ga0268265_10294523
302 Ga0268264_10018334
303 Ga0268264_10805817
304 Ga0307513_10688787
305 Ga0307509_10277847
306 Ga0307514_10446534
307 Ga0316577_10220587
308 Ga0373923_0073361
309 Ga0373954_0272434
310 Ga0373943_0070207
311 Ga0373946_0012817
312 Ga0373955_0136848
313 Ga0373924_0192902
314 Ga0373927_0055724
315 Ga0373933_0035280
316 Ga0373937_0001808
317 Ga0395900_0147203
318 Ga0395898_0051988
319 Ga0395905_0000984
320 Ga0436364_1189903
321 Ga0395901_0125884
322 Ga0436360_0595304
323 Ga0439436_0083687
324 Ga0439466_0052730
325 Ga0451839_1236655
326 Ga0439449_0014043
327 Ga0495617_015409
328 Ga0495638_0022695
329 Ga0495651_0620159
330 Ga0495605_0337631
331 Ga0495585_0030993
332 Ga0495596_0068800
333 Ga0495607_0408932
334 Ga0495608_0090660
335 Ga0495610_0120533
336 Ga0495610_0293120
337 Ga0495616_0049205
338 Ga0495632_0083951
339 Ga0495648_0020338
340 Ga0495640_0068411
341 Ga0495640_0481851
342 Ga0495587_0022630
343 Ga0495609_0029220
344 Ga0495667_0193336
345 Ga0495656_0423785
346 Ga0495668_0076507
347 Ga0495611_0023755
348 Ga0495669_0134472
349 Ga0495670_0245246
350 Ga0495649_0091633
351 Ga0495589_0350332
352 Ga0495600_0164173
353 Ga0495674_0768946
354 Ga0495672_0507950
355 Ga0495680_0893502
356 Ga0495683_0122453
357 Ga0495684_0009508
358 Ga0495602_0043647
359 Ga0495626_0159201
360 Ga0496120_0024898
361 Ga0496121_0056959
362 Ga0496121_0078003
363 Ga0496121_0081016
364 Ga0496121_0358542
365 Ga0496122_0042319
366 Ga0496122_0453063
367 Ga0496124_0009112
368 Ga0496124_0046772
369 Ga0496126_0007873
370 Ga0496126_0017764
371 Ga0496126_0053645
372 Ga0496126_0094364
373 Ga0496126_0209001
374 Ga0495682_0180578
375 Ga0501033_0600094
376 Ga0501046_0102969
377 Ga0501047_0006290
378 Ga0501075_0294874
379 Ga0501080_0172180
380 Ga0501035_1047458
381 Ga0501045_0135753
382 nmdc:mga03683_8906_c1
383 nmdc:mga0yw44_124142_c1
384 nmdc:mga07m45_162305_c1
385 Ga0500643_009658
386 Ga0500644_0084324
387 Ga0500646_0053748
388 Ga0500650_0211797
389 Ga0500650_0381607
390 Ga0500556_0144661
391 Ga0500562_005275
392 Ga0500594_0066409
393 Ga0500642_0087182
394 Ga0500655_036077
395 Ga0500559_0000120
396 Ga0500577_0150077
397 Ga0500588_0038427
398 Ga0500588_0065464
399 Ga0500589_115673
400 Ga0500590_006116
401 Ga0500622_0011598
402 Ga0500627_0460917
403 Ga0500633_0099396
404 Ga0500634_0067046
405 Ga0500611_173417
406 Ga0500656_021453
407 2513641368
408 2513656977
409 2513918717
410 2524536663
411 2644464356
412 2671118328
413 2738883839
414 2793068995
415 2847935623
416 2881673374
417 2885381046
418 2904697915
419 2904704525
420 2906616891
421 2908742078
422 2908759738
423 2922431036
424 3005480859
425 8006939859
426 8056682477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

29

65

0.95

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

66

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hku-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8902 28 53
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8829 28 55
7qep-assembly1.cif.gz_P0 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8759 28 54
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8655 28 53
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8654 17 140
ID Description Score Start End Superfamily
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.7936 28 55 4.10.1060.50
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.7608 11 58 6.10.30.10
af_A0A1D6MEG7_37_119_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7178 61 106 2.40.50.140
af_A0A0P0XT53_109_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7159 60 117 2.40.50.140
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6807 61 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6L7YDX8-F1-model_v4 DNA-binding protein 0.9489 12 139 GO:0003677
AF-A0A7X7SMV4-F1-model_v4 DNA-binding protein 0.9443 17 141 GO:0003677
AF-A0A844SBX0-F1-model_v4 DNA-binding protein 0.935 20 140 GO:0003677
AF-A0A1F3AGM9-F1-model_v4 DNA-binding protein 0.9336 26 139 GO:0003677
AF-A0A537MUS0-F1-model_v4 OB-fold domain-containing protein 0.9283 38 139

Map