F323932

General Info

Members Datasets Scaffolds Average Seq Length
213 137 213 322

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100347494|Ga0075431_1003474941
Length 363
Sequence MTSFGYTLSSEEHPPGDLVRQARRAEETGFDFVSISDHFHPWVSAQGHSPFVWSVLGAVAASTSEVRIGVGVTCPIIRIHPAILAQATATTSLLSDGRFFFGIGSGEALNEHILGDRWPPIDVRLAMLEEAVDVIRRLWEGETVDHRGDFYTVENARLFDPPAEAPPVIASGFGPKAVELAARIGDGYWGVAPDADALDRYRDAGGTGPRYAQLHVCWGEDAAEARKVVHHVWPTSGIRGQLSQDLPTWTHFEEAAGMVTEEEATRSIPCGPDVDPFIESVREYVTAGYDHLYFHQIGPDQEGFFRFWSEDLQRALAQTTSATEEQMPDKRPSVKNEKQYEALKDKGMSKERAARIANSPGAS

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
72 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
73 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
74 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 7.04
Rhizosphere 89.2
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000700 3300003373 Bacteria 6970
2 JGI25407J50210_10018394 3300003373 Bacteria 1815
3 Ga0070658_10000495 3300005327 Bacteria 34228
4 Ga0070670_100122877 3300005331 Bacteria 2240
5 Ga0070671_100000926 3300005355 Bacteria 21442
6 Ga0070674_100146256 3300005356 Unclassified 1779
7 Ga0070710_10104567 3300005437 Bacteria 1691
8 Ga0070701_10014024 3300005438 Bacteria 3665
9 Ga0070700_100082185 3300005441 Bacteria 2083
10 Ga0070672_100015449 3300005543 Bacteria 5437
11 Ga0070665_100154873 3300005548 Bacteria 2293
12 Ga0068859_100002530 3300005617 Bacteria 18560
13 Ga0068859_100206896 3300005617 Bacteria 2048
14 Ga0068851_10052280 3300005834 Bacteria 2077
15 Ga0068858_100060769 3300005842 Bacteria 3493
16 Ga0068858_100259628 3300005842 Bacteria 1651
17 Ga0068858_100347727 3300005842 Bacteria 1420
18 Ga0068858_100591654 3300005842 Bacteria 1076
19 Ga0081455_10000054 3300005937 Bacteria 121980
20 Ga0081538_10000159 3300005981 Bacteria 71002
21 Ga0081538_10006253 3300005981 Bacteria 10533
22 Ga0081538_10146413 3300005981 Bacteria 1079
23 Ga0081539_10009934 3300005985 Bacteria 7847
24 Ga0075363_100001479 3300006048 Bacteria 8942
25 Ga0070716_100080807 3300006173 Bacteria 1939
26 Ga0075428_100018537 3300006844 Bacteria 7695
27 Ga0075428_100075678 3300006844 Bacteria 3676
28 Ga0075431_100034240 3300006847 Bacteria 5233
29 Ga0075431_100347494 3300006847 Archaea 1492
30 Ga0075433_10209305 3300006852 Unclassified 1733
31 Ga0075434_100054664 3300006871 Plasmid 3966
32 Ga0075436_100023732 3300006914 Unclassified 4214
33 Ga0097620_100206902 3300006931 Bacteria 2048
34 Ga0075435_100069316 3300007076 Unclassified 2875
35 Ga0111539_10058868 3300009094 Bacteria 4557
36 Ga0105245_10029735 3300009098 Bacteria 4830
37 Ga0105245_10085404 3300009098 Bacteria 2893
38 Ga0105245_10120402 3300009098 Bacteria 2451
39 Ga0114129_10069393 3300009147 Bacteria 4913
40 Ga0105243_10072262 3300009148 Bacteria 2792
41 Ga0105242_10042428 3300009176 Bacteria 3674
42 Ga0105248_10287347 3300009177 Bacteria 1852
43 Ga0157375_10044293 3300013308 Bacteria 4322
44 Ga0157380_10187325 3300014326 Bacteria 1824
45 Ga0224712_10013382 3300022467 Bacteria 2610
46 Ga0224712_10015465 3300022467 Bacteria 2483
47 Ga0207688_10038748 3300025901 Bacteria 2646
48 Ga0207688_10041758 3300025901 Bacteria 2552
49 Ga0207688_10067722 3300025901 Bacteria 2020
50 Ga0207643_10087182 3300025908 Bacteria 1815
51 Ga0207705_10000947 3300025909 Bacteria 23695
52 Ga0207707_10248764 3300025912 Archaea 1544
53 Ga0207660_10054726 3300025917 Bacteria 2849
54 Ga0207662_10022000 3300025918 Bacteria 3651
55 Ga0207650_10093997 3300025925 Bacteria 2296
56 Ga0207687_10039269 3300025927 Bacteria 3240
57 Ga0207706_10030844 3300025933 Bacteria 4780
58 Ga0207709_10068339 3300025935 Bacteria 2245
59 Ga0207709_10201852 3300025935 Bacteria 1421
60 Ga0207670_10234069 3300025936 Bacteria 1412
61 Ga0207691_10113364 3300025940 Unclassified 2409
62 Ga0207661_10243766 3300025944 Bacteria 1596
63 Ga0207677_10041420 3300026023 Bacteria 3045
64 Ga0207677_10202414 3300026023 Bacteria 1579
65 Ga0207703_10023028 3300026035 Bacteria 4891
66 Ga0207703_10057254 3300026035 Bacteria 3178
67 Ga0207708_10008771 3300026075 Bacteria 7484
68 Ga0207648_10112511 3300026089 Bacteria 2390
69 Ga0207648_10345265 3300026089 Bacteria 1341
70 Ga0207676_10541149 3300026095 Bacteria 1111
71 Ga0207675_100119284 3300026118 Bacteria 2495
72 Ga0207683_10062994 3300026121 Bacteria 3266
73 Ga0207683_10078629 3300026121 Bacteria 2923
74 Ga0207428_10022367 3300027907 Bacteria 5337
75 Ga0268266_10227289 3300028379 Bacteria 1717
76 Ga0268264_10142198 3300028381 Bacteria 2141
77 Ga0307517_10183772 3300028786 Bacteria 1343
78 Ga0307515_10021023 3300028794 Bacteria 11594
79 Ga0307512_10005029 3300030522 Bacteria 14085
80 Ga0307513_10053800 3300031456 Bacteria 4323
81 Ga0307410_10123639 3300031852 Bacteria 1891
82 Ga0307406_10037262 3300031901 Bacteria 3002
83 Ga0307407_10027248 3300031903 Bacteria 3037
84 Ga0307409_100263359 3300031995 Bacteria 1583
85 Ga0307416_100534915 3300032002 Bacteria 1243
86 Ga0307414_10248948 3300032004 Bacteria 1476
87 Ga0373925_0215778 3300037068 Bacteria 1530
88 Ga0395898_0134764 3300037466 Bacteria 2365
89 Ga0451853_2451740 3300041512 Bacteria 1419
90 Ga0439450_001950 3300042008 Bacteria 3142
91 Ga0439463_003380 3300042016 Bacteria 4042
92 Ga0450907_008668 3300042146 Bacteria 1686
93 Ga0439464_0000503 3300042439 Bacteria 7968
94 Ga0466966_0139206 3300044684 Bacteria 1484
95 Ga0466963_0015052 3300044694 Bacteria 4782
96 Ga0466964_0007511 3300044706 Bacteria 4080
97 Ga0466967_0030055 3300045976 Bacteria 4555
98 Ga0466967_0041573 3300045976 Bacteria 3965
99 Ga0495653_0047114 3300046463 Bacteria 3336
100 Ga0495596_0076524 3300046500 Bacteria 1300
101 Ga0495630_0269503 3300046517 Bacteria 1301
102 Ga0495667_0054209 3300046559 Bacteria 2639
103 Ga0495674_0109592 3300047319 Bacteria 2342
104 Ga0495680_0173453 3300047322 Bacteria 1560
105 Ga0496100_0026356 3300048903 Bacteria 3563
106 Ga0496100_0567247 3300048903 Bacteria 879
107 Ga0496102_0020212 3300048905 Bacteria 5882
108 Ga0496102_0494098 3300048905 Bacteria 1145
109 Ga0496104_0024232 3300048907 Bacteria 5582
110 Ga0496104_0324979 3300048907 Bacteria 1451
111 Ga0496105_0017109 3300048908 Bacteria 5806
112 Ga0496106_0076947 3300048909 Bacteria 2558
113 Ga0496106_0299781 3300048909 Bacteria 1289
114 Ga0496109_0165202 3300048912 Bacteria 2075
115 Ga0496109_0334909 3300048912 Bacteria 1429
116 Ga0496110_0006818 3300048913 Bacteria 9082
117 Ga0496110_0132194 3300048913 Bacteria 2254
118 Ga0496110_0261298 3300048913 Bacteria 1576
119 Ga0496115_0014719 3300048918 Bacteria 5926
120 Ga0501033_0037980 3300049570 Bacteria 3603
121 Ga0501034_0001867 3300049571 Bacteria 26738
122 Ga0501034_0126446 3300049571 Bacteria 2541
123 Ga0501036_0003094 3300049572 Bacteria 13272
124 Ga0501036_0009170 3300049572 Bacteria 8136
125 Ga0501036_0040731 3300049572 Bacteria 3930
126 Ga0501037_0007414 3300049573 Bacteria 8019
127 Ga0501037_0029117 3300049573 Bacteria 4080
128 Ga0501038_0018569 3300049574 Bacteria 6280
129 Ga0501039_0048102 3300049575 Bacteria 3297
130 Ga0501040_0016208 3300049576 Bacteria 4927
131 Ga0501040_0028248 3300049576 Unclassified 3780
132 Ga0501040_0124138 3300049576 Bacteria 1813
133 Ga0501042_0004586 3300049578 Bacteria 8820
134 Ga0501042_0026458 3300049578 Unclassified 4076
135 Ga0501042_0163628 3300049578 Bacteria 1605
136 Ga0501042_0280484 3300049578 Bacteria 1203
137 Ga0501043_0040563 3300049579 Bacteria 3659
138 Ga0501043_0041809 3300049579 Bacteria 3601
139 Ga0501046_0004820 3300049580 Bacteria 12160
140 Ga0501046_0021943 3300049580 Bacteria 5262
141 Ga0501046_0041943 3300049580 Unclassified 3649
142 Ga0501047_0057557 3300049581 Bacteria 3758
143 Ga0501047_0207645 3300049581 Bacteria 1818
144 Ga0501048_0100838 3300049582 Unclassified 2037
145 Ga0501068_0002779 3300049584 Bacteria 9304
146 Ga0501068_0010366 3300049584 Bacteria 5235
147 Ga0501068_0014644 3300049584 Bacteria 4488
148 Ga0501070_0005907 3300049586 Bacteria 10439
149 Ga0501070_0017300 3300049586 Bacteria 6054
150 Ga0501070_0080459 3300049586 Bacteria 2696
151 Ga0501071_0002623 3300049587 Bacteria 10997
152 Ga0501071_0010541 3300049587 Bacteria 6199
153 Ga0501071_0024173 3300049587 Unclassified 4248
154 Ga0501071_0050896 3300049587 Bacteria 2984
155 Ga0501072_0000257 3300049588 Bacteria 38918
156 Ga0501072_0022727 3300049588 Bacteria 4865
157 Ga0501072_0029942 3300049588 Unclassified 4254
158 Ga0501073_0009133 3300049589 Bacteria 7315
159 Ga0501073_0152112 3300049589 Unclassified 1604
160 Ga0501074_0009343 3300049590 Bacteria 7123
161 Ga0501074_0014311 3300049590 Bacteria 5770
162 Ga0501074_0132596 3300049590 Bacteria 1782
163 Ga0501074_0213089 3300049590 Unclassified 1376
164 Ga0501074_0404687 3300049590 Bacteria 968
165 Ga0501075_0009038 3300049591 Bacteria 6955
166 Ga0501075_0085883 3300049591 Bacteria 2384
167 Ga0501075_0087054 3300049591 Unclassified 2367
168 Ga0501075_0250439 3300049591 Bacteria 1350
169 Ga0501076_0009101 3300049592 Bacteria 7310
170 Ga0501076_0063279 3300049592 Bacteria 2948
171 Ga0501076_0090730 3300049592 Bacteria 2458
172 Ga0501077_0007558 3300049593 Bacteria 6705
173 Ga0501077_0012448 3300049593 Bacteria 5327
174 Ga0501079_0085765 3300049741 Bacteria 2437
175 Ga0501080_0000420 3300049742 Bacteria 32621
176 Ga0501080_0028060 3300049742 Bacteria 5234
177 Ga0501080_0056440 3300049742 Bacteria 3657
178 Ga0501080_0376249 3300049742 Unclassified 1280
179 Ga0501081_0066517 3300049743 Bacteria 2506
180 Ga0501081_0066786 3300049743 Bacteria 2501
181 Ga0501083_0005891 3300049744 Bacteria 8673
182 Ga0501035_0070094 3300049822 Bacteria 3106
183 Ga0501044_0419569 3300049823 Bacteria 1248
184 Ga0501045_0003868 3300049824 Bacteria 10301
185 Ga0501045_0007501 3300049824 Bacteria 7578
186 Ga0501045_0015216 3300049824 Bacteria 5460
187 Ga0501045_0103819 3300049824 Bacteria 2105
188 nmdc:mga03n38_36224_c1 3300050490 Bacteria 2120
189 nmdc:mga05p37_16756_c1 3300050507 Bacteria 8834
190 nmdc:mga05p37_505413_c1 3300050507 Bacteria 1386
191 nmdc:mga0qj67_144946_c1 3300050509 Bacteria 1925
192 nmdc:mga06r32_148565_c1 3300050510 Bacteria 2321
193 nmdc:mga08y16_14687_c1 3300050511 Bacteria 8233
194 nmdc:mga0n895_28948_c1 3300050512 Bacteria 5277
195 nmdc:mga0rr50_42554_c1 3300050513 Plasmid 3318
196 nmdc:mga0a205_119705_c1 3300050515 Unclassified 2532
197 nmdc:mga0a205_22486_c1 3300050515 Bacteria 5975
198 Ga0495619_0071586 3300053085 Bacteria 2320
199 Ga0500616_0004008 3300053153 Bacteria 10739
200 Ga0501084_0000418 3300054114 Bacteria 32906
201 Ga0501084_0026422 3300054114 Bacteria 4844
202 Ga0501084_0028550 3300054114 Bacteria 4663
203 Ga0501084_0249519 3300054114 Unclassified 1498
204 Ga0590071_008771 3300059421 Bacteria 2376
205 Ga0590074_003409 3300059423 Bacteria 2623
206 Ga0590075_004237 3300059424 Bacteria 3393
207 Ga0590077_025257 3300059426 Bacteria 1279
208 Ga0501082_0032037 3300060353 Bacteria 4534
209 Ga0501082_0152932 3300060353 Unclassified 2004
210 Ga0530510_0000440 3300061734 Bacteria 26841
211 Ga0530510_0011701 3300061734 Bacteria 6158
212 Ga0530510_0124569 3300061734 Bacteria 1893
213 Ga0530510_0179045 3300061734 Bacteria 1572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0250439 Ga0501075_0250439_377_1171 264
2 3300049590 Ga0501074_0404687 Ga0501074_0404687_130_948 268
3 3300048903 Ga0496100_0567247 Ga0496100_0567247_28_840 269
4 3300005937 Ga0081455_10000054 Ga0081455_10000054108 279
5 3300061734 Ga0530510_0179045 Ga0530510_0179045_422_1309 295
6 3300049743 Ga0501081_0066517 Ga0501081_0066517_1536_2444 298
7 3300061734 Ga0530510_0124569 Ga0530510_0124569_47_955 298
8 3300006844 Ga0075428_100075678 Ga0075428_1000756785 308
9 3300009147 Ga0114129_10069393 Ga0114129_100693937 308
10 3300027907 Ga0207428_10022367 Ga0207428_1002236710 308
11 3300050507 nmdc:mga05p37_16756_c1 nmdc:mga05p37_16756_c1_7596_8600 308
12 3300050511 nmdc:mga08y16_14687_c1 nmdc:mga08y16_14687_c1_3359_4363 308
13 3300050515 nmdc:mga0a205_22486_c1 nmdc:mga0a205_22486_c1_4628_5632 308
14 3300046500 Ga0495596_0076524 Ga0495596_0076524_162_1145 311
15 3300049576 Ga0501040_0124138 Ga0501040_0124138_38_982 314
16 3300049587 Ga0501071_0050896 Ga0501071_0050896_1937_2881 314
17 3300049824 Ga0501045_0103819 Ga0501045_0103819_91_1035 314
18 3300053153 Ga0500616_0004008 Ga0500616_0004008_5177_6121 314
19 3300054114 Ga0501084_0000418 Ga0501084_0000418_18740_19684 314
20 3300044694 Ga0466963_0015052 Ga0466963_0015052_838_1788 315
21 3300044706 Ga0466964_0007511 Ga0466964_0007511_2106_3053 315
22 3300045976 Ga0466967_0041573 Ga0466967_0041573_1080_2027 315
23 3300005438 Ga0070701_10014024 Ga0070701_100140245 316
24 3300005441 Ga0070700_100082185 Ga0070700_1000821852 316
25 3300005617 Ga0068859_100002530 Ga0068859_10000253018 316
26 3300005617 Ga0068859_100206896 Ga0068859_1002068963 316
27 3300005842 Ga0068858_100060769 Ga0068858_1000607694 316
28 3300006931 Ga0097620_100206902 Ga0097620_1002069023 316
29 3300009098 Ga0105245_10029735 Ga0105245_100297354 316
30 3300009148 Ga0105243_10072262 Ga0105243_100722624 316
31 3300009176 Ga0105242_10042428 Ga0105242_100424284 316
32 3300025901 Ga0207688_10067722 Ga0207688_100677222 316
33 3300025908 Ga0207643_10087182 Ga0207643_100871822 316
34 3300025918 Ga0207662_10022000 Ga0207662_100220003 316
35 3300025935 Ga0207709_10201852 Ga0207709_102018522 316
36 3300026075 Ga0207708_10008771 Ga0207708_100087715 316
37 3300026118 Ga0207675_100119284 Ga0207675_1001192843 316
38 3300026121 Ga0207683_10062994 Ga0207683_100629944 316
39 3300041512 Ga0451853_2451740 Ga0451853_2451740_110_1069 316
40 3300045976 Ga0466967_0030055 Ga0466967_0030055_2689_3648 316
41 3300046517 Ga0495630_0269503 Ga0495630_0269503_77_1027 316
42 3300046559 Ga0495667_0054209 Ga0495667_0054209_159_1109 316
43 3300048905 Ga0496102_0494098 Ga0496102_0494098_70_1020 316
44 3300048909 Ga0496106_0076947 Ga0496106_0076947_1472_2422 316
45 3300048913 Ga0496110_0006818 Ga0496110_0006818_6652_7623 316
46 3300049570 Ga0501033_0037980 Ga0501033_0037980_128_1078 316
47 3300049572 Ga0501036_0003094 Ga0501036_0003094_3362_4312 316
48 3300049573 Ga0501037_0007414 Ga0501037_0007414_7038_7988 316
49 3300049574 Ga0501038_0018569 Ga0501038_0018569_4743_5693 316
50 3300049576 Ga0501040_0016208 Ga0501040_0016208_550_1500 316
51 3300049578 Ga0501042_0004586 Ga0501042_0004586_1594_2544 316
52 3300049579 Ga0501043_0041809 Ga0501043_0041809_2608_3558 316
53 3300049580 Ga0501046_0004820 Ga0501046_0004820_9613_10563 316
54 3300049584 Ga0501068_0014644 Ga0501068_0014644_47_997 316
55 3300049586 Ga0501070_0080459 Ga0501070_0080459_1630_2580 316
56 3300049587 Ga0501071_0002623 Ga0501071_0002623_6593_7543 316
57 3300049588 Ga0501072_0022727 Ga0501072_0022727_460_1410 316
58 3300049590 Ga0501074_0014311 Ga0501074_0014311_3571_4521 316
59 3300049591 Ga0501075_0009038 Ga0501075_0009038_1288_2238 316
60 3300049592 Ga0501076_0009101 Ga0501076_0009101_405_1355 316
61 3300049593 Ga0501077_0007558 Ga0501077_0007558_4718_5668 316
62 3300049743 Ga0501081_0066786 Ga0501081_0066786_258_1208 316
63 3300049822 Ga0501035_0070094 Ga0501035_0070094_1230_2180 316
64 3300049824 Ga0501045_0003868 Ga0501045_0003868_6652_7602 316
65 3300054114 Ga0501084_0028550 Ga0501084_0028550_258_1208 316
66 3300060353 Ga0501082_0032037 Ga0501082_0032037_130_1080 316
67 3300061734 Ga0530510_0000440 Ga0530510_0000440_312_1262 316
68 3300005437 Ga0070710_10104567 Ga0070710_101045672 317
69 3300006844 Ga0075428_100018537 Ga0075428_1000185374 317
70 3300006847 Ga0075431_100034240 Ga0075431_1000342404 317
71 3300009094 Ga0111539_10058868 Ga0111539_100588682 317
72 3300014326 Ga0157380_10187325 Ga0157380_101873252 317
73 3300025944 Ga0207661_10243766 Ga0207661_102437662 317
74 3300026023 Ga0207677_10041420 Ga0207677_100414204 317
75 3300026089 Ga0207648_10112511 Ga0207648_101125113 317
76 3300026095 Ga0207676_10541149 Ga0207676_105411491 317
77 3300037466 Ga0395898_0134764 Ga0395898_0134764_369_1322 317
78 3300044684 Ga0466966_0139206 Ga0466966_0139206_306_1265 317
79 3300049578 Ga0501042_0280484 Ga0501042_0280484_143_1102 317
80 3300049591 Ga0501075_0085883 Ga0501075_0085883_1409_2374 317
81 3300049592 Ga0501076_0063279 Ga0501076_0063279_1447_2406 317
82 3300049741 Ga0501079_0085765 Ga0501079_0085765_1362_2321 317
83 3300050507 nmdc:mga05p37_505413_c1 nmdc:mga05p37_505413_c1_274_1227 317
84 3300050509 nmdc:mga0qj67_144946_c1 nmdc:mga0qj67_144946_c1_829_1782 317
85 3300050510 nmdc:mga06r32_148565_c1 nmdc:mga06r32_148565_c1_1040_1993 317
86 3300061734 Ga0530510_0011701 Ga0530510_0011701_3716_4675 317
87 3300005327 Ga0070658_10000495 Ga0070658_1000049513 318
88 3300005985 Ga0081539_10009934 Ga0081539_1000993410 318
89 3300006852 Ga0075433_10209305 Ga0075433_102093052 318
90 3300006871 Ga0075434_100054664 Ga0075434_1000546645 318
91 3300006914 Ga0075436_100023732 Ga0075436_1000237324 318
92 3300007076 Ga0075435_100069316 Ga0075435_1000693163 318
93 3300022467 Ga0224712_10015465 Ga0224712_100154652 318
94 3300025909 Ga0207705_10000947 Ga0207705_1000094724 318
95 3300025912 Ga0207707_10248764 Ga0207707_102487641 318
96 3300025917 Ga0207660_10054726 Ga0207660_100547262 318
97 3300031852 Ga0307410_10123639 Ga0307410_101236392 318
98 3300042146 Ga0450907_008668 Ga0450907_008668_229_1191 318
99 3300048912 Ga0496109_0334909 Ga0496109_0334909_158_1117 318
100 3300049572 Ga0501036_0009170 Ga0501036_0009170_5295_6269 318
101 3300049575 Ga0501039_0048102 Ga0501039_0048102_882_1856 318
102 3300049576 Ga0501040_0028248 Ga0501040_0028248_13_987 318
103 3300049578 Ga0501042_0026458 Ga0501042_0026458_499_1473 318
104 3300049580 Ga0501046_0041943 Ga0501046_0041943_357_1331 318
105 3300049581 Ga0501047_0207645 Ga0501047_0207645_742_1713 318
106 3300049582 Ga0501048_0100838 Ga0501048_0100838_537_1511 318
107 3300049584 Ga0501068_0010366 Ga0501068_0010366_2144_3118 318
108 3300049587 Ga0501071_0024173 Ga0501071_0024173_167_1135 318
109 3300049588 Ga0501072_0029942 Ga0501072_0029942_844_1812 318
110 3300049589 Ga0501073_0152112 Ga0501073_0152112_406_1380 318
111 3300049590 Ga0501074_0213089 Ga0501074_0213089_168_1136 318
112 3300049591 Ga0501075_0087054 Ga0501075_0087054_327_1301 318
113 3300049593 Ga0501077_0012448 Ga0501077_0012448_1169_2143 318
114 3300049742 Ga0501080_0056440 Ga0501080_0056440_1532_2506 318
115 3300049742 Ga0501080_0376249 Ga0501080_0376249_139_1107 318
116 3300049824 Ga0501045_0007501 Ga0501045_0007501_6564_7538 318
117 3300050512 nmdc:mga0n895_28948_c1 nmdc:mga0n895_28948_c1_2178_3137 318
118 3300050513 nmdc:mga0rr50_42554_c1 nmdc:mga0rr50_42554_c1_1037_1996 318
119 3300050515 nmdc:mga0a205_119705_c1 nmdc:mga0a205_119705_c1_1028_1987 318
120 3300054114 Ga0501084_0026422 Ga0501084_0026422_2772_3746 318
121 3300054114 Ga0501084_0249519 Ga0501084_0249519_226_1194 318
122 3300060353 Ga0501082_0152932 Ga0501082_0152932_109_1083 318
123 3300005356 Ga0070674_100146256 Ga0070674_1001462561 319
124 3300005543 Ga0070672_100015449 Ga0070672_1000154495 319
125 3300005842 Ga0068858_100591654 Ga0068858_1005916541 319
126 3300006048 Ga0075363_100001479 Ga0075363_1000014792 319
127 3300025936 Ga0207670_10234069 Ga0207670_102340691 319
128 3300025940 Ga0207691_10113364 Ga0207691_101133642 319
129 3300031901 Ga0307406_10037262 Ga0307406_100372623 319
130 3300031903 Ga0307407_10027248 Ga0307407_100272483 319
131 3300031995 Ga0307409_100263359 Ga0307409_1002633593 319
132 3300032004 Ga0307414_10248948 Ga0307414_102489481 319
133 3300037068 Ga0373925_0215778 Ga0373925_0215778_151_1113 319
134 3300049571 Ga0501034_0126446 Ga0501034_0126446_1349_2308 319
135 3300049572 Ga0501036_0040731 Ga0501036_0040731_2554_3516 319
136 3300049579 Ga0501043_0040563 Ga0501043_0040563_1714_2676 319
137 3300049580 Ga0501046_0021943 Ga0501046_0021943_2506_3468 319
138 3300049581 Ga0501047_0057557 Ga0501047_0057557_1486_2448 319
139 3300049586 Ga0501070_0005907 Ga0501070_0005907_7355_8317 319
140 3300049590 Ga0501074_0132596 Ga0501074_0132596_627_1589 319
141 3300049742 Ga0501080_0028060 Ga0501080_0028060_3427_4389 319
142 3300049823 Ga0501044_0419569 Ga0501044_0419569_250_1212 319
143 3300050490 nmdc:mga03n38_36224_c1 nmdc:mga03n38_36224_c1_692_1654 319
144 3300046463 Ga0495653_0047114 Ga0495653_0047114_1463_2428 320
145 3300047322 Ga0495680_0173453 Ga0495680_0173453_340_1305 320
146 3300048912 Ga0496109_0165202 Ga0496109_0165202_199_1164 320
147 3300053085 Ga0495619_0071586 Ga0495619_0071586_384_1349 320
148 3300005548 Ga0070665_100154873 Ga0070665_1001548734 321
149 3300009098 Ga0105245_10085404 Ga0105245_100854044 321
150 3300009098 Ga0105245_10120402 Ga0105245_101204022 321
151 3300025901 Ga0207688_10041758 Ga0207688_100417581 321
152 3300025927 Ga0207687_10039269 Ga0207687_100392693 321
153 3300025933 Ga0207706_10030844 Ga0207706_100308442 321
154 3300025935 Ga0207709_10068339 Ga0207709_100683393 321
155 3300026023 Ga0207677_10202414 Ga0207677_102024142 321
156 3300026035 Ga0207703_10057254 Ga0207703_100572543 321
157 3300026121 Ga0207683_10078629 Ga0207683_100786292 321
158 3300028379 Ga0268266_10227289 Ga0268266_102272892 321
159 3300048913 Ga0496110_0132194 Ga0496110_0132194_538_1578 321
160 3300006173 Ga0070716_100080807 Ga0070716_1000808073 322
161 3300009177 Ga0105248_10287347 Ga0105248_102873472 322
162 3300022467 Ga0224712_10013382 Ga0224712_100133821 322
163 3300048903 Ga0496100_0026356 Ga0496100_0026356_287_1258 322
164 3300048905 Ga0496102_0020212 Ga0496102_0020212_4887_5858 322
165 3300048907 Ga0496104_0324979 Ga0496104_0324979_172_1143 322
166 3300048909 Ga0496106_0299781 Ga0496106_0299781_115_1086 322
167 3300048918 Ga0496115_0014719 Ga0496115_0014719_3610_4581 322
168 3300049578 Ga0501042_0163628 Ga0501042_0163628_279_1259 322
169 3300049587 Ga0501071_0010541 Ga0501071_0010541_2522_3502 322
170 3300049744 Ga0501083_0005891 Ga0501083_0005891_3959_4930 322
171 3300049824 Ga0501045_0015216 Ga0501045_0015216_1685_2665 322
172 3300059421 Ga0590071_008771 Ga0590071_008771_400_1386 322
173 3300059423 Ga0590074_003409 Ga0590074_003409_667_1653 322
174 3300059424 Ga0590075_004237 Ga0590075_004237_1037_2023 322
175 3300059426 Ga0590077_025257 Ga0590077_025257_221_1207 322
176 3300005331 Ga0070670_100122877 Ga0070670_1001228771 323
177 3300005355 Ga0070671_100000926 Ga0070671_10000092614 323
178 3300005842 Ga0068858_100259628 Ga0068858_1002596281 323
179 3300005842 Ga0068858_100347727 Ga0068858_1003477271 323
180 3300013308 Ga0157375_10044293 Ga0157375_100442933 323
181 3300025925 Ga0207650_10093997 Ga0207650_100939975 323
182 3300026035 Ga0207703_10023028 Ga0207703_100230281 323
183 3300026089 Ga0207648_10345265 Ga0207648_103452652 323
184 3300032002 Ga0307416_100534915 Ga0307416_1005349152 324
185 3300048913 Ga0496110_0261298 Ga0496110_0261298_402_1385 324
186 3300049571 Ga0501034_0001867 Ga0501034_0001867_13031_14008 324
187 3300049573 Ga0501037_0029117 Ga0501037_0029117_2476_3453 324
188 3300049584 Ga0501068_0002779 Ga0501068_0002779_8203_9180 324
189 3300049586 Ga0501070_0017300 Ga0501070_0017300_2972_3949 324
190 3300049588 Ga0501072_0000257 Ga0501072_0000257_33981_34958 324
191 3300049589 Ga0501073_0009133 Ga0501073_0009133_2682_3659 324
192 3300049590 Ga0501074_0009343 Ga0501074_0009343_4378_5355 324
193 3300049592 Ga0501076_0090730 Ga0501076_0090730_912_1889 324
194 3300049742 Ga0501080_0000420 Ga0501080_0000420_3006_3983 324
195 3300006847 Ga0075431_100347494 Ga0075431_1003474941 325
196 3300028786 Ga0307517_10183772 Ga0307517_101837722 325
197 3300028794 Ga0307515_10021023 Ga0307515_100210234 325
198 3300030522 Ga0307512_10005029 Ga0307512_100050299 325
199 3300031456 Ga0307513_10053800 Ga0307513_100538002 325
200 3300047319 Ga0495674_0109592 Ga0495674_0109592_39_1019 325
201 3300048907 Ga0496104_0024232 Ga0496104_0024232_1700_2704 325
202 3300048908 Ga0496105_0017109 Ga0496105_0017109_2947_3951 325
203 3300003373 JGI25407J50210_10000700 JGI25407J50210_100007005 327
204 3300003373 JGI25407J50210_10018394 JGI25407J50210_100183942 327
205 3300005834 Ga0068851_10052280 Ga0068851_100522802 327
206 3300005981 Ga0081538_10000159 Ga0081538_1000015934 327
207 3300005981 Ga0081538_10006253 Ga0081538_100062537 327
208 3300005981 Ga0081538_10146413 Ga0081538_101464131 327
209 3300025901 Ga0207688_10038748 Ga0207688_100387485 327
210 3300028381 Ga0268264_10142198 Ga0268264_101421982 327
211 3300042008 Ga0439450_001950 Ga0439450_001950_846_1832 327
212 3300042016 Ga0439463_003380 Ga0439463_003380_398_1384 327
213 3300042439 Ga0439464_0000503 Ga0439464_0000503_3184_4170 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23855

329

363

0.93

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

291

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9448 1 316
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9395 1 316
3c8n-assembly1.cif.gz_A crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.923 2 315
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9207 1 316
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.9178 2 315
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9178 2 315 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9122 1 316 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9025 2 315 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8905 1 316 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.883 2 315 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A3N5S6F1-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9915 1 187 GO:0016705
AF-A0A3D0DBT9-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9867 1 319 GO:0016705
AF-A0A074TV93-F1-model_v4 deleted 0.9866 68 163
AF-A0A536S5B2-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9864 1 324 GO:0016705
AF-A0A1T3WIC9-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9829 1 201 GO:0016705

Feature Viewer

pLDDT pTM Quality
93.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map