F323746

General Info

Members Datasets Scaffolds Average Seq Length
213 148 426 158

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100782185|Ga0070713_1007821852
Length 181
Sequence MADTLFASVNYIRRARAFGAAKGEDMPSLAPKVLEPREGLRLQSGPGRDLVFKVTGEDTGGAFDYFIVEVAPKGGPPLHVHHVQEETIHALKGRYKIQIGDETFHIEEGGFAYLPSGVPHAFLNLTDDPGEIVVVYTPGGGHKFYEELGPLTRKGTPDRAAVAAVFEKYDMTLLGPPLSAD

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 2.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 8.45
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 45.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100782185 3300005436 Bacteria 914
2 Ga0058861_11244209 3300004800 Unclassified 932
3 Ga0065707_10175153 3300005295 Bacteria 1456
4 Ga0070658_10698550 3300005327 Unclassified 880
5 Ga0070683_100104483 3300005329 Unclassified 2670
6 Ga0070683_101389554 3300005329 Bacteria 675
7 Ga0068868_100198854 3300005338 Bacteria 1670
8 Ga0070660_100419284 3300005339 Unclassified 1108
9 Ga0070661_100200500 3300005344 Bacteria 1525
10 Ga0070692_10310223 3300005345 Unclassified 966
11 Ga0070714_100240269 3300005435 Bacteria 1671
12 Ga0070714_100797117 3300005435 Bacteria 915
13 Ga0070714_101310273 3300005435 Bacteria 707
14 Ga0070701_10531923 3300005438 Unclassified 768
15 Ga0070711_100309775 3300005439 Unclassified 1258
16 Ga0070711_100564698 3300005439 Unclassified 945
17 Ga0070705_100074714 3300005440 Bacteria 2061
18 Ga0070708_101315346 3300005445 Bacteria 675
19 Ga0070678_101621523 3300005456 Bacteria 608
20 Ga0070707_100013629 3300005468 Bacteria 7612
21 Ga0070707_100033238 3300005468 Bacteria 4918
22 Ga0070707_100999005 3300005468 Unclassified 802
23 Ga0070698_100012678 3300005471 Bacteria 8923
24 Ga0070698_101017372 3300005471 Unclassified 776
25 Ga0070699_100114448 3300005518 Bacteria 2370
26 Ga0070699_100414927 3300005518 Bacteria 1218
27 Ga0070684_100028078 3300005535 Bacteria 4756
28 Ga0068853_101690806 3300005539 Unclassified 613
29 Ga0068855_100613280 3300005563 Bacteria 1172
30 Ga0070664_101771831 3300005564 Unclassified 586
31 Ga0068862_100560366 3300005844 Bacteria 1092
32 Ga0070717_10094204 3300006028 Bacteria 2533
33 Ga0070715_10061996 3300006163 Bacteria 1644
34 Ga0070716_100317086 3300006173 Bacteria 1091
35 Ga0075428_101467276 3300006844 Unclassified 715
36 Ga0075434_100692083 3300006871 Unclassified 1037
37 Ga0075436_100093517 3300006914 Bacteria 2090
38 Ga0075435_100758030 3300007076 Unclassified 844
39 Ga0114129_10443937 3300009147 Bacteria 1703
40 Ga0114129_10631600 3300009147 Unclassified 1384
41 Ga0105243_11084528 3300009148 Unclassified 808
42 Ga0105241_11142707 3300009174 Bacteria 735
43 Ga0105241_11708158 3300009174 Unclassified 612
44 Ga0105246_11470936 3300011119 Unclassified 638
45 Ga0157370_10052448 3300013104 Unclassified 3894
46 Ga0157369_10076100 3300013105 Bacteria 3598
47 Ga0157372_11093723 3300013307 Unclassified 922
48 Ga0182008_10202922 3300014497 Bacteria 1009
49 Ga0163161_10000103 3300017792 Bacteria 81496
50 Ga0207692_10148377 3300025898 Bacteria 1341
51 Ga0207685_10000036 3300025905 Bacteria 65666
52 Ga0207699_10461696 3300025906 Unclassified 912
53 Ga0207654_10280692 3300025911 Unclassified 1126
54 Ga0207693_10167186 3300025915 Unclassified 1732
55 Ga0207663_10301717 3300025916 Unclassified 1197
56 Ga0207657_11001459 3300025919 Unclassified 641
57 Ga0207646_10001416 3300025922 Bacteria 29797
58 Ga0207646_10083624 3300025922 Bacteria 2855
59 Ga0207646_10749048 3300025922 Unclassified 872
60 Ga0207687_10138634 3300025927 Bacteria 1843
61 Ga0207700_10407822 3300025928 Bacteria 1192
62 Ga0207664_10036504 3300025929 Bacteria 3799
63 Ga0207664_10428424 3300025929 Bacteria 1179
64 Ga0207664_10507978 3300025929 Unclassified 1080
65 Ga0207661_10336747 3300025944 Bacteria 1359
66 Ga0207661_10473888 3300025944 Unclassified 1142
67 Ga0207639_11524964 3300026041 Unclassified 627
68 Ga0207702_11403656 3300026078 Unclassified 692
69 Ga0207648_10000872 3300026089 Bacteria 33984
70 Ga0265338_10204741 3300028800 Unclassified 1486
71 Ga0265324_10008011 3300029957 Bacteria 4233
72 Ga0265327_10040185 3300031251 Bacteria 2532
73 Ga0316583_10026596 3300032133 Bacteria 2066
74 Ga0373923_0133454 3300035111 Bacteria 1118
75 Ga0373953_0163124 3300035117 Bacteria 958
76 Ga0373956_0122515 3300035119 Bacteria 1215
77 Ga0373943_0470715 3300035170 Unclassified 732
78 Ga0373931_0352876 3300035691 Unclassified 921
79 Ga0373927_0748465 3300035695 Unclassified 646
80 Ga0373933_0249128 3300035724 Bacteria 1144
81 Ga0373933_0457527 3300035724 Bacteria 835
82 Ga0373947_0345348 3300035725 Unclassified 998
83 Ga0373947_0561851 3300035725 Unclassified 777
84 Ga0373937_0043990 3300036401 Bacteria 4078
85 Ga0373937_0180160 3300036401 Bacteria 1984
86 Ga0373937_0208795 3300036401 Bacteria 1837
87 Ga0373937_1436488 3300036401 Unclassified 637
88 Ga0436363_0329878 3300039450 Bacteria 1195
89 Ga0451577_0027831 3300042876 Bacteria 5115
90 Ga0466961_0411675 3300044693 Unclassified 820
91 Ga0453684_0113327 3300044712 Unclassified 3290
92 Ga0453684_1068230 3300044712 Unclassified 855
93 Ga0453684_1949166 3300044712 Bacteria 593
94 Ga0451576_0279693 3300045051 Bacteria 1745
95 Ga0451576_0834120 3300045051 Unclassified 968
96 Ga0466967_0346871 3300045976 Bacteria 1436
97 Ga0466967_0384914 3300045976 Bacteria 1362
98 Ga0495592_0409877 3300046454 Bacteria 857
99 Ga0495603_0079296 3300046455 Bacteria 1925
100 Ga0495603_0114098 3300046455 Bacteria 1575
101 Ga0495629_0983071 3300046459 Unclassified 550
102 Ga0495641_0022182 3300046461 Bacteria 3180
103 Ga0495641_0483207 3300046461 Unclassified 564
104 Ga0495651_0105068 3300046462 Bacteria 2096
105 Ga0495651_0367585 3300046462 Unclassified 946
106 Ga0495653_0052849 3300046463 Bacteria 3112
107 Ga0495653_0200486 3300046463 Bacteria 1355
108 Ga0495582_0000303 3300046473 Bacteria 27186
109 Ga0495582_0115951 3300046473 Unclassified 1506
110 Ga0495639_0020183 3300046475 Bacteria 2911
111 Ga0495664_0056935 3300046477 Unclassified 2326
112 Ga0495594_0168956 3300046499 Unclassified 1244
113 Ga0495608_0082709 3300046511 Bacteria 2085
114 Ga0495618_0000174 3300046514 Bacteria 45942
115 Ga0495630_0940211 3300046517 Unclassified 658
116 Ga0495652_0127042 3300046529 Bacteria 2024
117 Ga0495652_0678445 3300046529 Bacteria 695
118 Ga0495652_0815047 3300046529 Unclassified 621
119 Ga0495665_0058288 3300046531 Bacteria 2039
120 Ga0495587_0035735 3300046536 Bacteria 2992
121 Ga0495587_0508536 3300046536 Unclassified 666
122 Ga0495645_0312067 3300046543 Bacteria 1024
123 Ga0495667_0189421 3300046559 Bacteria 1319
124 Ga0495667_0232401 3300046559 Unclassified 1176
125 Ga0495667_0235345 3300046559 Bacteria 1167
126 Ga0495667_0290011 3300046559 Unclassified 1038
127 Ga0495634_0602610 3300046642 Unclassified 637
128 Ga0495634_0697388 3300046642 Unclassified 584
129 Ga0495635_0282078 3300046663 Bacteria 1116
130 Ga0495635_0318193 3300046663 Unclassified 1042
131 Ga0495635_0584020 3300046663 Unclassified 730
132 Ga0495657_0013552 3300046675 Bacteria 6010
133 Ga0495657_0338002 3300046675 Unclassified 893
134 Ga0495623_0531474 3300046679 Bacteria 618
135 Ga0495646_0447209 3300046680 Unclassified 668
136 Ga0495647_0071969 3300046681 Unclassified 1386
137 Ga0495658_0000307 3300046683 Bacteria 27835
138 Ga0495658_0088718 3300046683 Unclassified 1828
139 Ga0495658_0358908 3300046683 Unclassified 927
140 Ga0495658_0486762 3300046683 Unclassified 789
141 Ga0495624_0019723 3300046690 Bacteria 4495
142 Ga0495600_0000779 3300046809 Bacteria 16825
143 Ga0495600_0615466 3300046809 Unclassified 659
144 Ga0495581_0134923 3300047315 Unclassified 1439
145 Ga0495604_0387158 3300047317 Unclassified 923
146 Ga0495604_0461797 3300047317 Unclassified 828
147 Ga0495604_0855678 3300047317 Unclassified 570
148 Ga0495676_0013154 3300047321 Bacteria 7443
149 Ga0495676_0157515 3300047321 Unclassified 1610
150 Ga0495676_0209047 3300047321 Bacteria 1351
151 Ga0495680_0215508 3300047322 Bacteria 1373
152 Ga0495680_0336128 3300047322 Bacteria 1054
153 Ga0495680_0815463 3300047322 Unclassified 608
154 Ga0495684_0303297 3300047471 Bacteria 1147
155 Ga0495593_0653070 3300047673 Bacteria 528
156 Ga0495602_0268851 3300048088 Bacteria 1261
157 Ga0496100_0114030 3300048903 Unclassified 1882
158 Ga0496100_0490321 3300048903 Unclassified 946
159 Ga0496102_0600060 3300048905 Bacteria 1024
160 Ga0496104_0162884 3300048907 Bacteria 2139
161 Ga0496104_1063958 3300048907 Bacteria 713
162 Ga0496105_0128354 3300048908 Bacteria 2091
163 Ga0496105_0253255 3300048908 Bacteria 1426
164 Ga0496105_1082720 3300048908 Bacteria 596
165 Ga0496106_0614647 3300048909 Bacteria 870
166 Ga0496107_0039844 3300048910 Bacteria 3371
167 Ga0496108_0080940 3300048911 Unclassified 2752
168 Ga0496109_0566893 3300048912 Bacteria 1071
169 Ga0496110_0129787 3300048913 Unclassified 2275
170 Ga0496110_1017287 3300048913 Bacteria 736
171 Ga0496112_0102768 3300048915 Bacteria 2828
172 Ga0496113_0627899 3300048916 Bacteria 860
173 Ga0496114_0302912 3300048917 Unclassified 1411
174 Ga0496115_0005261 3300048918 Bacteria 9404
175 Ga0501036_0121396 3300049572 Bacteria 2207
176 Ga0501039_0502167 3300049575 Unclassified 952
177 Ga0501041_0529700 3300049577 Unclassified 750
178 Ga0501042_0370914 3300049578 Bacteria 1036
179 Ga0501043_0715042 3300049579 Unclassified 731
180 Ga0501046_0163562 3300049580 Bacteria 1673
181 Ga0501067_0000814 3300049583 Bacteria 16819
182 Ga0501067_0084482 3300049583 Bacteria 1761
183 Ga0501068_0000272 3300049584 Bacteria 25560
184 Ga0501068_0574743 3300049584 Unclassified 734
185 Ga0501069_0000097 3300049585 Bacteria 41382
186 Ga0501072_0340723 3300049588 Unclassified 1191
187 Ga0501075_0026420 3300049591 Bacteria 4274
188 Ga0501075_0611194 3300049591 Unclassified 831
189 Ga0501076_0043562 3300049592 Unclassified 3537
190 Ga0501081_0859860 3300049743 Unclassified 683
191 Ga0501045_0071697 3300049824 Bacteria 2550
192 nmdc:mga05p37_1638279_c1 3300050507 Bacteria 631
193 nmdc:mga05p37_1839499_c1 3300050507 Bacteria 582
194 nmdc:mga05p37_515585_c1 3300050507 Unclassified 1369
195 nmdc:mga05p37_936150_c1 3300050507 Bacteria 929
196 nmdc:mga06r32_791671_c1 3300050510 Unclassified 909
197 nmdc:mga08x19_110133_c1 3300050514 Bacteria 1836
198 Ga0495601_0292264 3300053077 Unclassified 1062
199 Ga0495601_0747321 3300053077 Unclassified 622
200 Ga0495595_0179353 3300053084 Bacteria 1050
201 Ga0495595_0254439 3300053084 Bacteria 880
202 Ga0495595_0503814 3300053084 Unclassified 617
203 Ga0495619_0006661 3300053085 Bacteria 7310
204 Ga0495619_0545305 3300053085 Unclassified 796
205 Ga0495619_0635773 3300053085 Unclassified 729
206 Ga0500566_0428195 3300053094 Unclassified 585
207 Ga0501084_0199957 3300054114 Unclassified 1686
208 Ga0587094_084856 3300059513 Unclassified 591
209 Ga0587101_079028 3300059623 Unclassified 620
210 Ga0587079_105611 3300059647 Unclassified 678
211 Ga0587111_0132129 3300060346 Unclassified 654
212 Ga0501082_0105252 3300060353 Bacteria 2441
213 Ga0530510_0200990 3300061734 Unclassified 1480
214 Ga0070713_100782185
215 Ga0058861_11244209
216 Ga0065707_10175153
217 Ga0070658_10698550
218 Ga0070683_100104483
219 Ga0070683_101389554
220 Ga0068868_100198854
221 Ga0070660_100419284
222 Ga0070661_100200500
223 Ga0070692_10310223
224 Ga0070714_100240269
225 Ga0070714_100797117
226 Ga0070714_101310273
227 Ga0070701_10531923
228 Ga0070711_100309775
229 Ga0070711_100564698
230 Ga0070705_100074714
231 Ga0070708_101315346
232 Ga0070678_101621523
233 Ga0070707_100013629
234 Ga0070707_100033238
235 Ga0070707_100999005
236 Ga0070698_100012678
237 Ga0070698_101017372
238 Ga0070699_100114448
239 Ga0070699_100414927
240 Ga0070684_100028078
241 Ga0068853_101690806
242 Ga0068855_100613280
243 Ga0070664_101771831
244 Ga0068862_100560366
245 Ga0070717_10094204
246 Ga0070715_10061996
247 Ga0070716_100317086
248 Ga0075428_101467276
249 Ga0075434_100692083
250 Ga0075436_100093517
251 Ga0075435_100758030
252 Ga0114129_10443937
253 Ga0114129_10631600
254 Ga0105243_11084528
255 Ga0105241_11142707
256 Ga0105241_11708158
257 Ga0105246_11470936
258 Ga0157370_10052448
259 Ga0157369_10076100
260 Ga0157372_11093723
261 Ga0182008_10202922
262 Ga0163161_10000103
263 Ga0207692_10148377
264 Ga0207685_10000036
265 Ga0207699_10461696
266 Ga0207654_10280692
267 Ga0207693_10167186
268 Ga0207663_10301717
269 Ga0207657_11001459
270 Ga0207646_10001416
271 Ga0207646_10083624
272 Ga0207646_10749048
273 Ga0207687_10138634
274 Ga0207700_10407822
275 Ga0207664_10036504
276 Ga0207664_10428424
277 Ga0207664_10507978
278 Ga0207661_10336747
279 Ga0207661_10473888
280 Ga0207639_11524964
281 Ga0207702_11403656
282 Ga0207648_10000872
283 Ga0265338_10204741
284 Ga0265324_10008011
285 Ga0265327_10040185
286 Ga0316583_10026596
287 Ga0373923_0133454
288 Ga0373953_0163124
289 Ga0373956_0122515
290 Ga0373943_0470715
291 Ga0373931_0352876
292 Ga0373927_0748465
293 Ga0373933_0249128
294 Ga0373933_0457527
295 Ga0373947_0345348
296 Ga0373947_0561851
297 Ga0373937_0043990
298 Ga0373937_0180160
299 Ga0373937_0208795
300 Ga0373937_1436488
301 Ga0436363_0329878
302 Ga0451577_0027831
303 Ga0466961_0411675
304 Ga0453684_0113327
305 Ga0453684_1068230
306 Ga0453684_1949166
307 Ga0451576_0279693
308 Ga0451576_0834120
309 Ga0466967_0346871
310 Ga0466967_0384914
311 Ga0495592_0409877
312 Ga0495603_0079296
313 Ga0495603_0114098
314 Ga0495629_0983071
315 Ga0495641_0022182
316 Ga0495641_0483207
317 Ga0495651_0105068
318 Ga0495651_0367585
319 Ga0495653_0052849
320 Ga0495653_0200486
321 Ga0495582_0000303
322 Ga0495582_0115951
323 Ga0495639_0020183
324 Ga0495664_0056935
325 Ga0495594_0168956
326 Ga0495608_0082709
327 Ga0495618_0000174
328 Ga0495630_0940211
329 Ga0495652_0127042
330 Ga0495652_0678445
331 Ga0495652_0815047
332 Ga0495665_0058288
333 Ga0495587_0035735
334 Ga0495587_0508536
335 Ga0495645_0312067
336 Ga0495667_0189421
337 Ga0495667_0232401
338 Ga0495667_0235345
339 Ga0495667_0290011
340 Ga0495634_0602610
341 Ga0495634_0697388
342 Ga0495635_0282078
343 Ga0495635_0318193
344 Ga0495635_0584020
345 Ga0495657_0013552
346 Ga0495657_0338002
347 Ga0495623_0531474
348 Ga0495646_0447209
349 Ga0495647_0071969
350 Ga0495658_0000307
351 Ga0495658_0088718
352 Ga0495658_0358908
353 Ga0495658_0486762
354 Ga0495624_0019723
355 Ga0495600_0000779
356 Ga0495600_0615466
357 Ga0495581_0134923
358 Ga0495604_0387158
359 Ga0495604_0461797
360 Ga0495604_0855678
361 Ga0495676_0013154
362 Ga0495676_0157515
363 Ga0495676_0209047
364 Ga0495680_0215508
365 Ga0495680_0336128
366 Ga0495680_0815463
367 Ga0495684_0303297
368 Ga0495593_0653070
369 Ga0495602_0268851
370 Ga0496100_0114030
371 Ga0496100_0490321
372 Ga0496102_0600060
373 Ga0496104_0162884
374 Ga0496104_1063958
375 Ga0496105_0128354
376 Ga0496105_0253255
377 Ga0496105_1082720
378 Ga0496106_0614647
379 Ga0496107_0039844
380 Ga0496108_0080940
381 Ga0496109_0566893
382 Ga0496110_0129787
383 Ga0496110_1017287
384 Ga0496112_0102768
385 Ga0496113_0627899
386 Ga0496114_0302912
387 Ga0496115_0005261
388 Ga0501036_0121396
389 Ga0501039_0502167
390 Ga0501041_0529700
391 Ga0501042_0370914
392 Ga0501043_0715042
393 Ga0501046_0163562
394 Ga0501067_0000814
395 Ga0501067_0084482
396 Ga0501068_0000272
397 Ga0501068_0574743
398 Ga0501069_0000097
399 Ga0501072_0340723
400 Ga0501075_0026420
401 Ga0501075_0611194
402 Ga0501076_0043562
403 Ga0501081_0859860
404 Ga0501045_0071697
405 nmdc:mga05p37_1638279_c1
406 nmdc:mga05p37_1839499_c1
407 nmdc:mga05p37_515585_c1
408 nmdc:mga05p37_936150_c1
409 nmdc:mga06r32_791671_c1
410 nmdc:mga08x19_110133_c1
411 Ga0495601_0292264
412 Ga0495601_0747321
413 Ga0495595_0179353
414 Ga0495595_0254439
415 Ga0495595_0503814
416 Ga0495619_0006661
417 Ga0495619_0545305
418 Ga0495619_0635773
419 Ga0500566_0428195
420 Ga0501084_0199957
421 Ga0587094_084856
422 Ga0587101_079028
423 Ga0587079_105611
424 Ga0587111_0132129
425 Ga0501082_0105252
426 Ga0530510_0200990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

66

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9067 23 115
7zvy-assembly1.cif.gz_G thermococcus kadokarensis phosphomannose isomerase 0.9024 38 116
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.901 7 118
7zvm-assembly1.cif.gz_A-2 thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a 0.8999 22 113
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8969 6 113
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9431 33 113 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9245 21 112 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9134 23 115 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8969 6 113 2.60.120.10
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8965 16 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A317ILE3-F1-model_v4 Cupin type-2 domain-containing protein 0.962 2 156
AF-A0A317ILE3-F1-model_v4 Cupin type-2 domain-containing protein 0.9559 2 156
AF-A0A517T6J1-F1-model_v4 Quercetin 2,3-dioxygenase (EC 1.13.11.24) 0.9469 6 149 GO:0008127
AF-A0A7W9DPF1-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9412 5 154 GO:0051213
AF-A0A858SZ62-F1-model_v4 Cupin domain-containing protein 0.9401 34 154

Map