F323480

General Info

Members Datasets Scaffolds Average Seq Length
212 173 194 583

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876812798
Length 667
Sequence APETVAAIVAAHRAATMTPAQTIARFYQRIRAYNDPAVFISLRDEKEALADAEALASKDAASLPLLGVPVAVKDNIDAQGLPTTAACPAFSYSPAQDSTAVAKLRAAGAIIIGKTNLDQFATGLVGVRSPYGIPVNPIRADLIPGGSSSGSAVAVSAGLVPLALGTDTAGSGRVPAMLNNIVGLKPSLGLISNAGLVPACRTLDCISVFSLTVDDAMTALAAMAGPDGADPFSRDMPLGAVSAFPEKLRLGVPRNGQLIFFGDRAAEKAYGEALERWTSLGATLVEFDLEPLYETARLLYEGPWVAERYLVIRDLLASSPDSIHPVTREITAAGARLTAADTFASLYRLGGXXXXXXXXXXXXRLQALRRVAERAFANLDAMVLPTAPTAYSTAQVLANPVELNSRLGTYTNFVNLLDLCGLALPAAMRADGVPFGITLLAPAGRDAALASIGRVFHADTKLKMGAKGLTQPALAPLPAGTSNDEITIAVVGAHLSGMALNGELQVLGGRLLEEATTAPDYKLYALDTTPPKPGMLRVDTGAGSSIKLELWALSAAAFGKFVAAIPPPLGIGTIRLADGRGVKGFVVEPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGARSWRRRWGCNRHCERSEAIHLSTRAERWIASSLRSLAQTLRVCRRQ

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
6 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
7 2791355265 Rhizobium sp. H4 Isolate Nodule
8 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
9 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
10 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
11 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
12 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
13 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
14 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
15 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
16 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
173 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.51
Metatranscriptomes 0
Isolates 8.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 12.26
Nodule 3.77
Rhizoplane 13.21
Rhizosphere 62.74
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1004158 3300003771 Bacteria 8810
2 Ga0055524_1000035 3300003775 Bacteria 174636
3 Ga0065165_1000641 3300005262 Bacteria 50686
4 Ga0070682_100048462 3300005337 Bacteria 2645
5 Ga0070668_100005946 3300005347 Bacteria 9046
6 Ga0070668_100036471 3300005347 Bacteria 3752
7 Ga0070671_100120102 3300005355 Bacteria 2211
8 Ga0070667_100145056 3300005367 Bacteria 2081
9 Ga0070709_10024353 3300005434 Bacteria 3562
10 Ga0070713_100007472 3300005436 Bacteria 7674
11 Ga0070710_10000025 3300005437 Bacteria 75412
12 Ga0070710_10052774 3300005437 Bacteria 2287
13 Ga0070678_100029307 3300005456 Bacteria 3767
14 Ga0068867_100021478 3300005459 Bacteria 4606
15 Ga0068853_100043880 3300005539 Bacteria 3826
16 Ga0070672_100051569 3300005543 Bacteria 3209
17 Ga0070665_100178059 3300005548 Bacteria 2127
18 Ga0070702_100009178 3300005615 Bacteria 4828
19 Ga0068861_100037565 3300005719 Bacteria 3600
20 Ga0068860_100016163 3300005843 Bacteria 7281
21 Ga0068860_100043204 3300005843 Bacteria 4301
22 Ga0068862_100000488 3300005844 Bacteria 42364
23 Ga0081540_1004494 3300005983 Bacteria 10596
24 Ga0070717_10006987 3300006028 Bacteria 8350
25 Ga0070717_10024280 3300006028 Bacteria 4812
26 Ga0075365_10048809 3300006038 Bacteria 2787
27 Ga0075368_10002767 3300006042 Bacteria 5789
28 Ga0075363_100021594 3300006048 Bacteria 3245
29 Ga0075364_10006580 3300006051 Bacteria 6839
30 Ga0070712_100019869 3300006175 Bacteria 4391
31 Ga0075362_10022402 3300006177 Bacteria 2662
32 Ga0075367_10047509 3300006178 Bacteria 2525
33 Ga0068865_100049332 3300006881 Bacteria 2901
34 Ga0105251_10019987 3300009011 Bacteria 3524
35 Ga0105240_10000557 3300009093 Bacteria 69103
36 Ga0105247_10029406 3300009101 Bacteria 3329
37 Ga0105247_10039814 3300009101 Bacteria 2872
38 Ga0105248_10200690 3300009177 Bacteria 2247
39 Ga0105249_10000621 3300009553 Bacteria 32317
40 Ga0105239_10115318 3300010375 Bacteria 2980
41 Ga0105239_10135320 3300010375 Bacteria 2743
42 Ga0171462_1010 3300013250 Bacteria 310590
43 Ga0157372_10043623 3300013307 Bacteria 4966
44 Ga0157379_10008726 3300014968 Bacteria 8833
45 Ga0213876_10027721 3300021384 Bacteria 2987
46 Ga0209130_1000648 3300025284 Bacteria 32278
47 Ga0209675_1000347 3300025291 Bacteria 40287
48 Ga0209025_1001887 3300025294 Bacteria 24479
49 Ga0209564_1000049 3300025295 Bacteria 362075
50 Ga0209256_1000014 3300025299 Bacteria 687409
51 Ga0209256_1000128 3300025299 Bacteria 163833
52 Ga0207692_10002203 3300025898 Bacteria 7455
53 Ga0207710_10014545 3300025900 Bacteria 3321
54 Ga0207699_10005532 3300025906 Bacteria 6058
55 Ga0207693_10003450 3300025915 Bacteria 13491
56 Ga0207657_10005108 3300025919 Bacteria 13749
57 Ga0207650_10008938 3300025925 Bacteria 6846
58 Ga0207700_10002201 3300025928 Bacteria 11181
59 Ga0207709_10020745 3300025935 Bacteria 3711
60 Ga0207691_10070043 3300025940 Bacteria 3167
61 Ga0207691_10071549 3300025940 Bacteria 3129
62 Ga0207711_10015340 3300025941 Bacteria 6360
63 Ga0207711_10053695 3300025941 Bacteria 3456
64 Ga0207689_10032962 3300025942 Bacteria 4306
65 Ga0207712_10006466 3300025961 Bacteria 7387
66 Ga0207668_10008920 3300025972 Bacteria 5998
67 Ga0207658_10019645 3300025986 Bacteria 4673
68 Ga0207658_10112214 3300025986 Bacteria 2157
69 Ga0207708_10036238 3300026075 Bacteria 3755
70 Ga0207708_10062898 3300026075 Bacteria 2835
71 Ga0207641_10033548 3300026088 Bacteria 4264
72 Ga0207648_10024638 3300026089 Bacteria 5367
73 Ga0207676_10052144 3300026095 Bacteria 3196
74 Ga0207683_10014763 3300026121 Bacteria 6649
75 Ga0207683_10025283 3300026121 Bacteria 5121
76 Ga0207698_10065539 3300026142 Bacteria 2853
77 Ga0268265_10002686 3300028380 Bacteria 13187
78 Ga0268264_10042075 3300028381 Bacteria 3781
79 Ga0268264_10064385 3300028381 Bacteria 3085
80 Ga0265318_10006822 3300028577 Bacteria 5221
81 Ga0314311_1253135 3300030733 Bacteria 3975
82 Ga0265314_10002061 3300031711 Bacteria 21230
83 Ga0265314_10095061 3300031711 Bacteria 1930
84 Ga0373934_0007537 3300035086 Bacteria 4041
85 Ga0373953_0001610 3300035117 Bacteria 6605
86 Ga0373924_0019510 3300035410 Bacteria 2627
87 Ga0373935_0076073 3300035692 Bacteria 2173
88 Ga0395900_0074104 3300037418 Bacteria 3500
89 Ga0395905_0000453 3300037471 Bacteria 57443
90 Ga0395905_0007890 3300037471 Bacteria 10532
91 Ga0395901_0054736 3300038443 Bacteria 4147
92 Ga0436365_0203290 3300039437 Bacteria 5068
93 Ga0436365_0366968 3300039437 Bacteria 6977
94 Ga0439465_0020220 3300041413 Bacteria 2084
95 Ga0451807_1800178 3300041486 Bacteria 5044
96 Ga0466972_0014406 3300044658 Bacteria 3960
97 Ga0466960_0004103 3300044901 Bacteria 5663
98 Ga0451576_0039256 3300045051 Bacteria 5011
99 Ga0451576_0126865 3300045051 Bacteria 2659
100 Ga0495592_0042647 3300046454 Bacteria 3397
101 Ga0495603_0015481 3300046455 Bacteria 4616
102 Ga0495629_0002814 3300046459 Bacteria 13270
103 Ga0495641_0009282 3300046461 Bacteria 5862
104 Ga0495651_0106440 3300046462 Bacteria 2079
105 Ga0495653_0030013 3300046463 Bacteria 4334
106 Ga0495662_0001259 3300046476 Bacteria 12503
107 Ga0495662_0033177 3300046476 Bacteria 2495
108 Ga0495664_0033930 3300046477 Bacteria 3000
109 Ga0495606_0007495 3300046507 Bacteria 9744
110 Ga0495608_0039957 3300046511 Bacteria 3143
111 Ga0495618_0036974 3300046514 Bacteria 3064
112 Ga0495630_0018498 3300046517 Bacteria 5119
113 Ga0495632_0042019 3300046519 Bacteria 2293
114 Ga0495640_0041219 3300046533 Bacteria 3228
115 Ga0495640_0071428 3300046533 Bacteria 2329
116 Ga0495586_0030878 3300046535 Bacteria 2868
117 Ga0495587_0028498 3300046536 Bacteria 3395
118 Ga0495645_0055855 3300046543 Bacteria 2866
119 Ga0495633_0019365 3300046558 Bacteria 3444
120 Ga0495667_0033732 3300046559 Bacteria 3425
121 Ga0495656_0024722 3300046615 Bacteria 2375
122 Ga0495634_0040904 3300046642 Bacteria 3149
123 Ga0495635_0044766 3300046663 Bacteria 3052
124 Ga0495657_0102606 3300046675 Bacteria 1820
125 Ga0495599_0032677 3300046678 Bacteria 3267
126 Ga0495623_0014745 3300046679 Bacteria 5052
127 Ga0495646_0004450 3300046680 Bacteria 8828
128 Ga0495658_0001217 3300046683 Bacteria 13511
129 Ga0495669_0005728 3300046684 Bacteria 5181
130 Ga0495600_0016256 3300046809 Bacteria 4719
131 Ga0495600_0018851 3300046809 Bacteria 4402
132 Ga0495604_0028530 3300047317 Bacteria 4440
133 Ga0495674_0049974 3300047319 Bacteria 3691
134 Ga0495680_0029701 3300047322 Bacteria 4474
135 Ga0495680_0033262 3300047322 Bacteria 4176
136 Ga0495684_0071572 3300047471 Bacteria 2634
137 Ga0495684_0103767 3300047471 Bacteria 2149
138 Ga0495593_0013555 3300047673 Bacteria 4647
139 Ga0495602_0071852 3300048088 Bacteria 2953
140 Ga0496100_0009437 3300048903 Bacteria 5484
141 Ga0496102_0008445 3300048905 Bacteria 8828
142 Ga0496102_0081944 3300048905 Bacteria 2975
143 Ga0496102_0084110 3300048905 Bacteria 2936
144 Ga0496103_0050315 3300048906 Bacteria 2577
145 Ga0496104_0028802 3300048907 Bacteria 5147
146 Ga0496105_0032628 3300048908 Bacteria 4274
147 Ga0496105_0067879 3300048908 Bacteria 2945
148 Ga0496105_0132695 3300048908 Bacteria 2052
149 Ga0496106_0005300 3300048909 Bacteria 9553
150 Ga0496106_0064594 3300048909 Bacteria 2785
151 Ga0496107_0031204 3300048910 Bacteria 3800
152 Ga0496107_0061948 3300048910 Bacteria 2709
153 Ga0496107_0131234 3300048910 Bacteria 1850
154 Ga0496108_0035678 3300048911 Bacteria 4134
155 Ga0496109_0022401 3300048912 Bacteria 5594
156 Ga0496109_0044712 3300048912 Bacteria 4018
157 Ga0496109_0063889 3300048912 Bacteria 3367
158 Ga0496110_0077324 3300048913 Bacteria 2960
159 Ga0496111_0025340 3300048914 Bacteria 4185
160 Ga0496112_0028155 3300048915 Bacteria 5421
161 Ga0496113_0021477 3300048916 Bacteria 4554
162 Ga0496113_0043995 3300048916 Bacteria 3306
163 Ga0496114_0001228 3300048917 Bacteria 19391
164 Ga0496114_0081659 3300048917 Bacteria 2731
165 Ga0496115_0003927 3300048918 Bacteria 10712
166 Ga0496115_0068874 3300048918 Bacteria 2865
167 Ga0496119_0001342 3300048922 Bacteria 30120
168 Ga0496121_0004421 3300048924 Bacteria 18927
169 Ga0496121_0038937 3300048924 Bacteria 4200
170 Ga0496122_0001850 3300048925 Bacteria 32258
171 Ga0496122_0020057 3300048925 Bacteria 6069
172 Ga0496123_0000498 3300048926 Bacteria 68151
173 Ga0496124_0000543 3300048927 Bacteria 63823
174 Ga0496126_0001119 3300048929 Bacteria 44895
175 Ga0496126_0025828 3300048929 Bacteria 5643
176 Ga0501033_0005997 3300049570 Bacteria 9534
177 Ga0501035_0008404 3300049822 Bacteria 9612
178 Ga0501035_0089620 3300049822 Bacteria 2709
179 nmdc:mga03683_13432_c1 3300050489 Bacteria 3014
180 nmdc:mga05p37_68897_c1 3300050507 Bacteria 4351
181 Ga0495601_0023894 3300053077 Bacteria 3759
182 Ga0495595_0007096 3300053084 Bacteria 4578
183 Ga0495619_0031860 3300053085 Bacteria 3417
184 Ga0500641_0006250 3300053096 Bacteria 4226
185 Ga0500556_0000048 3300053104 Bacteria 123558
186 Ga0500593_000599 3300053117 Bacteria 13837
187 Ga0500595_001771 3300053119 Bacteria 11236
188 Ga0500595_015200 3300053119 Bacteria 2893
189 Ga0500652_000625 3300053131 Bacteria 12133
190 Ga0500568_0000005 3300053139 Bacteria 614296
191 Ga0500616_0000283 3300053153 Bacteria 74456
192 Ga0500636_0000970 3300053177 Bacteria 15430
193 Ga0500645_019636 3300053730 Bacteria 2101
194 Ga0530510_0028673 3300061734 Bacteria 3992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0102606 Ga0495657_0102606_80_1567 489
2 3300048914 Ga0496111_0025340 Ga0496111_0025340_1209_2933 526
3 3300053730 Ga0500645_019636 Ga0500645_019636_11_1618 529
4 3300048929 Ga0496126_0001119 Ga0496126_0001119_23805_25496 531
5 3300005437 Ga0070710_10000025 Ga0070710_1000002510 537
6 3300025898 Ga0207692_10002203 Ga0207692_100022033 537
7 3300044658 Ga0466972_0014406 Ga0466972_0014406_278_1960 538
8 3300044901 Ga0466960_0004103 Ga0466960_0004103_2825_4507 538
9 iso_pu_bacteria 2837268691 2837270339 541
10 3300005347 Ga0070668_100005946 Ga0070668_1000059462 545
11 3300005367 Ga0070667_100145056 Ga0070667_1001450562 545
12 3300005843 Ga0068860_100016163 Ga0068860_1000161637 545
13 3300005844 Ga0068862_100000488 Ga0068862_10000048839 545
14 3300009553 Ga0105249_10000621 Ga0105249_100006213 545
15 3300025961 Ga0207712_10006466 Ga0207712_100064666 545
16 3300025972 Ga0207668_10008920 Ga0207668_100089207 545
17 3300025986 Ga0207658_10019645 Ga0207658_100196455 545
18 3300028380 Ga0268265_10002686 Ga0268265_100026866 545
19 3300028381 Ga0268264_10064385 Ga0268264_100643852 545
20 3300030733 Ga0314311_1253135 Ga0314311_12531354 546
21 3300041486 Ga0451807_1800178 Ga0451807_1800178_2828_4567 547
22 iso_pu_bacteria 2919042368 2919044243 547
23 iso_pu_bacteria 2984551494 2984552450 547
24 3300037471 Ga0395905_0007890 Ga0395905_0007890_323_2026 548
25 iso_pu_bacteria 2904430863 2904432022 552
26 3300037471 Ga0395905_0000453 Ga0395905_0000453_4537_6300 555
27 3300053119 Ga0500595_015200 Ga0500595_015200_24_1712 556
28 3300035086 Ga0373934_0007537 Ga0373934_0007537_740_2488 557
29 3300037418 Ga0395900_0074104 Ga0395900_0074104_1450_3186 557
30 3300038443 Ga0395901_0054736 Ga0395901_0054736_1233_2969 557
31 3300046511 Ga0495608_0039957 Ga0495608_0039957_902_2650 557
32 3300047322 Ga0495680_0029701 Ga0495680_0029701_1923_3671 557
33 3300046507 Ga0495606_0007495 Ga0495606_0007495_2065_3807 559
34 3300048917 Ga0496114_0081659 Ga0496114_0081659_598_2340 559
35 3300053177 Ga0500636_0000970 Ga0500636_0000970_5758_7557 559
36 3300031711 Ga0265314_10002061 Ga0265314_100020618 560
37 3300046476 Ga0495662_0001259 Ga0495662_0001259_4188_5987 560
38 3300046809 Ga0495600_0018851 Ga0495600_0018851_2529_4328 560
39 3300048912 Ga0496109_0063889 Ga0496109_0063889_139_1992 560
40 3300046459 Ga0495629_0002814 Ga0495629_0002814_9236_11062 561
41 3300046461 Ga0495641_0009282 Ga0495641_0009282_2311_4137 561
42 3300046683 Ga0495658_0001217 Ga0495658_0001217_4857_6683 561
43 3300047322 Ga0495680_0033262 Ga0495680_0033262_625_2451 561
44 3300047673 Ga0495593_0013555 Ga0495593_0013555_2422_4302 561
45 3300048910 Ga0496107_0131234 Ga0496107_0131234_60_1811 561
46 3300006051 Ga0075364_10006580 Ga0075364_100065806 562
47 3300006178 Ga0075367_10047509 Ga0075367_100475091 562
48 3300025299 Ga0209256_1000128 Ga0209256_100012895 562
49 3300005337 Ga0070682_100048462 Ga0070682_1000484622 563
50 3300005355 Ga0070671_100120102 Ga0070671_1001201022 563
51 3300005434 Ga0070709_10024353 Ga0070709_100243532 563
52 3300005437 Ga0070710_10052774 Ga0070710_100527742 563
53 3300005548 Ga0070665_100178059 Ga0070665_1001780592 563
54 3300006028 Ga0070717_10024280 Ga0070717_100242802 563
55 3300006175 Ga0070712_100019869 Ga0070712_1000198693 563
56 3300009011 Ga0105251_10019987 Ga0105251_100199872 563
57 3300009177 Ga0105248_10200690 Ga0105248_102006902 563
58 3300010375 Ga0105239_10135320 Ga0105239_101353202 563
59 3300025906 Ga0207699_10005532 Ga0207699_100055323 563
60 3300025915 Ga0207693_10003450 Ga0207693_100034502 563
61 3300025925 Ga0207650_10008938 Ga0207650_100089382 563
62 3300025928 Ga0207700_10002201 Ga0207700_100022013 563
63 3300025941 Ga0207711_10015340 Ga0207711_100153405 563
64 3300025942 Ga0207689_10032962 Ga0207689_100329622 563
65 3300026075 Ga0207708_10062898 Ga0207708_100628982 563
66 3300026088 Ga0207641_10033548 Ga0207641_100335483 563
67 3300026095 Ga0207676_10052144 Ga0207676_100521442 563
68 3300035692 Ga0373935_0076073 Ga0373935_0076073_244_2124 563
69 3300048903 Ga0496100_0009437 Ga0496100_0009437_3382_5208 563
70 3300048905 Ga0496102_0081944 Ga0496102_0081944_805_2631 563
71 3300048905 Ga0496102_0084110 Ga0496102_0084110_806_2632 563
72 3300048906 Ga0496103_0050315 Ga0496103_0050315_20_1846 563
73 3300048907 Ga0496104_0028802 Ga0496104_0028802_1700_3526 563
74 3300048908 Ga0496105_0032628 Ga0496105_0032628_805_2631 563
75 3300048908 Ga0496105_0132695 Ga0496105_0132695_20_1846 563
76 3300048909 Ga0496106_0005300 Ga0496106_0005300_107_1894 563
77 3300048910 Ga0496107_0031204 Ga0496107_0031204_1617_3443 563
78 3300048911 Ga0496108_0035678 Ga0496108_0035678_1032_2858 563
79 3300048912 Ga0496109_0022401 Ga0496109_0022401_3749_5575 563
80 3300048913 Ga0496110_0077324 Ga0496110_0077324_173_1999 563
81 3300048915 Ga0496112_0028155 Ga0496112_0028155_2736_4562 563
82 3300048916 Ga0496113_0021477 Ga0496113_0021477_1029_2855 563
83 3300048917 Ga0496114_0001228 Ga0496114_0001228_457_2283 563
84 3300048918 Ga0496115_0003927 Ga0496115_0003927_4526_6352 563
85 3300049822 Ga0501035_0089620 Ga0501035_0089620_811_2535 563
86 3300053096 Ga0500641_0006250 Ga0500641_0006250_1296_3026 564
87 3300006177 Ga0075362_10022402 Ga0075362_100224022 566
88 3300028577 Ga0265318_10006822 Ga0265318_100068222 566
89 3300031711 Ga0265314_10095061 Ga0265314_100950612 566
90 3300050489 nmdc:mga03683_13432_c1 nmdc:mga03683_13432_c1_740_2512 566
91 3300005459 Ga0068867_100021478 Ga0068867_1000214782 568
92 3300005539 Ga0068853_100043880 Ga0068853_1000438802 568
93 3300005543 Ga0070672_100051569 Ga0070672_1000515693 568
94 3300013307 Ga0157372_10043623 Ga0157372_100436234 568
95 3300025919 Ga0207657_10005108 Ga0207657_100051089 568
96 3300026089 Ga0207648_10024638 Ga0207648_100246382 568
97 3300026142 Ga0207698_10065539 Ga0207698_100655391 568
98 3300048927 Ga0496124_0000543 Ga0496124_0000543_9690_11513 569
99 3300048925 Ga0496122_0001850 Ga0496122_0001850_11374_13104 570
100 3300048926 Ga0496123_0000498 Ga0496123_0000498_38643_40373 570
101 3300045051 Ga0451576_0126865 Ga0451576_0126865_183_1958 571
102 3300035117 Ga0373953_0001610 Ga0373953_0001610_1472_3268 572
103 3300035410 Ga0373924_0019510 Ga0373924_0019510_254_2050 572
104 3300046454 Ga0495592_0042647 Ga0495592_0042647_701_2497 572
105 3300046463 Ga0495653_0030013 Ga0495653_0030013_1236_3032 572
106 3300046476 Ga0495662_0033177 Ga0495662_0033177_32_1828 572
107 3300046477 Ga0495664_0033930 Ga0495664_0033930_953_2749 572
108 3300046514 Ga0495618_0036974 Ga0495618_0036974_1084_2880 572
109 3300046517 Ga0495630_0018498 Ga0495630_0018498_771_2567 572
110 3300046533 Ga0495640_0071428 Ga0495640_0071428_78_1874 572
111 3300046535 Ga0495586_0030878 Ga0495586_0030878_345_2141 572
112 3300046536 Ga0495587_0028498 Ga0495587_0028498_595_2391 572
113 3300046543 Ga0495645_0055855 Ga0495645_0055855_823_2619 572
114 3300046559 Ga0495667_0033732 Ga0495667_0033732_546_2342 572
115 3300046642 Ga0495634_0040904 Ga0495634_0040904_163_1959 572
116 3300046663 Ga0495635_0044766 Ga0495635_0044766_564_2360 572
117 3300046678 Ga0495599_0032677 Ga0495599_0032677_78_1874 572
118 3300046679 Ga0495623_0014745 Ga0495623_0014745_2684_4480 572
119 3300046809 Ga0495600_0016256 Ga0495600_0016256_1560_3356 572
120 3300047317 Ga0495604_0028530 Ga0495604_0028530_964_2760 572
121 3300047319 Ga0495674_0049974 Ga0495674_0049974_1061_2857 572
122 3300047471 Ga0495684_0071572 Ga0495684_0071572_374_2170 572
123 3300048088 Ga0495602_0071852 Ga0495602_0071852_993_2789 572
124 3300005262 Ga0065165_1000641 Ga0065165_100064131 573
125 3300025284 Ga0209130_1000648 Ga0209130_100064811 573
126 3300025294 Ga0209025_1001887 Ga0209025_10018873 573
127 3300046533 Ga0495640_0041219 Ga0495640_0041219_28_1863 575
128 3300048925 Ga0496122_0020057 Ga0496122_0020057_344_2149 575
129 3300049570 Ga0501033_0005997 Ga0501033_0005997_2803_4596 575
130 3300049822 Ga0501035_0008404 Ga0501035_0008404_5045_6838 575
131 3300013250 Ga0171462_1010 Ga0171462_101046 576
132 3300005843 Ga0068860_100043204 Ga0068860_1000432044 578
133 3300028381 Ga0268264_10042075 Ga0268264_100420754 578
134 3300048924 Ga0496121_0004421 Ga0496121_0004421_5840_7672 578
135 3300005719 Ga0068861_100037565 Ga0068861_1000375652 579
136 3300006881 Ga0068865_100049332 Ga0068865_1000493322 579
137 3300010375 Ga0105239_10115318 Ga0105239_101153182 579
138 3300025935 Ga0207709_10020745 Ga0207709_100207452 579
139 3300025940 Ga0207691_10071549 Ga0207691_100715493 579
140 3300039437 Ga0436365_0366968 Ga0436365_0366968_1838_3598 579
141 3300046462 Ga0495651_0106440 Ga0495651_0106440_206_1966 579
142 3300046615 Ga0495656_0024722 Ga0495656_0024722_453_2249 579
143 3300046684 Ga0495669_0005728 Ga0495669_0005728_3037_4833 579
144 3300047471 Ga0495684_0103767 Ga0495684_0103767_264_2024 579
145 3300048908 Ga0496105_0067879 Ga0496105_0067879_463_2265 579
146 3300048909 Ga0496106_0064594 Ga0496106_0064594_547_2343 579
147 3300053077 Ga0495601_0023894 Ga0495601_0023894_158_1918 579
148 3300053084 Ga0495595_0007096 Ga0495595_0007096_1341_3101 579
149 3300053085 Ga0495619_0031860 Ga0495619_0031860_1168_2928 579
150 3300005456 Ga0070678_100029307 Ga0070678_1000293074 580
151 3300026121 Ga0207683_10025283 Ga0207683_100252834 580
152 3300021384 Ga0213876_10027721 Ga0213876_100277212 581
153 3300039437 Ga0436365_0203290 Ga0436365_0203290_440_2206 581
154 3300046558 Ga0495633_0019365 Ga0495633_0019365_101_1909 582
155 3300053117 Ga0500593_000599 Ga0500593_000599_10724_12511 582
156 3300053139 Ga0500568_0000005 Ga0500568_0000005_411245_413032 582
157 3300045051 Ga0451576_0039256 Ga0451576_0039256_1502_3331 583
158 iso_pu_bacteria 2643221591 2643966779 584
159 3300006038 Ga0075365_10048809 Ga0075365_100488091 585
160 3300006042 Ga0075368_10002767 Ga0075368_100027673 585
161 iso_pu_bacteria 2509276033 2509445356 585
162 iso_pu_bacteria 2513237088 2513599394 585
163 iso_pu_bacteria 2718217997 2719668372 585
164 iso_pu_bacteria 2721755823 2724112681 585
165 iso_pu_bacteria 2791355265 2793356015 585
166 iso_pu_bacteria 8056382006 8056382942 585
167 3300009093 Ga0105240_10000557 Ga0105240_1000055722 586
168 iso_pu_bacteria 2510917022 2511131287 586
169 3300009101 Ga0105247_10039814 Ga0105247_100398142 587
170 3300014968 Ga0157379_10008726 Ga0157379_100087263 587
171 3300005615 Ga0070702_100009178 Ga0070702_1000091783 589
172 3300009101 Ga0105247_10029406 Ga0105247_100294063 589
173 3300025900 Ga0207710_10014545 Ga0207710_100145453 589
174 3300025940 Ga0207691_10070043 Ga0207691_100700433 589
175 3300025941 Ga0207711_10053695 Ga0207711_100536952 589
176 3300025986 Ga0207658_10112214 Ga0207658_101122142 589
177 3300026121 Ga0207683_10014763 Ga0207683_100147633 589
178 3300046455 Ga0495603_0015481 Ga0495603_0015481_169_2022 589
179 3300048905 Ga0496102_0008445 Ga0496102_0008445_1619_3445 589
180 3300048910 Ga0496107_0061948 Ga0496107_0061948_358_2184 589
181 3300048916 Ga0496113_0043995 Ga0496113_0043995_653_2479 589
182 3300048918 Ga0496115_0068874 Ga0496115_0068874_130_1956 589
183 iso_pu_bacteria 2824617872 2824624786 590
184 iso_pu_bacteria 2876808645 2876812798 590
185 iso_pu_bacteria 2917554339 2917557152 590
186 3300005347 Ga0070668_100036471 Ga0070668_1000364713 591
187 3300005983 Ga0081540_1004494 Ga0081540_10044943 591
188 3300006028 Ga0070717_10006987 Ga0070717_100069873 591
189 3300026075 Ga0207708_10036238 Ga0207708_100362384 591
190 3300046519 Ga0495632_0042019 Ga0495632_0042019_122_1930 591
191 3300046680 Ga0495646_0004450 Ga0495646_0004450_6554_8353 591
192 3300048912 Ga0496109_0044712 Ga0496109_0044712_543_2351 591
193 3300048924 Ga0496121_0038937 Ga0496121_0038937_215_2023 591
194 3300048929 Ga0496126_0025828 Ga0496126_0025828_2214_4022 591
195 3300053119 Ga0500595_001771 Ga0500595_001771_2515_4374 591
196 3300053153 Ga0500616_0000283 Ga0500616_0000283_32883_34679 591
197 iso_pu_bacteria 2879110137 2879111641 591
198 3300006048 Ga0075363_100021594 Ga0075363_1000215942 592
199 3300053131 Ga0500652_000625 Ga0500652_000625_5673_7472 592
200 3300005436 Ga0070713_100007472 Ga0070713_1000074724 593
201 iso_pu_bacteria 2970524798 2970531067 593
202 3300050507 nmdc:mga05p37_68897_c1 nmdc:mga05p37_68897_c1_2424_4319 594
203 3300061734 Ga0530510_0028673 Ga0530510_0028673_779_2584 594
204 iso_pu_bacteria 8001845381 8001848995 594
205 3300048922 Ga0496119_0001342 Ga0496119_0001342_22344_24152 595
206 3300053104 Ga0500556_0000048 Ga0500556_0000048_29759_31567 595
207 3300003771 Ga0055526_1004158 Ga0055526_10041586 597
208 3300003775 Ga0055524_1000035 Ga0055524_100003563 597
209 3300025291 Ga0209675_1000347 Ga0209675_10003477 597
210 3300025295 Ga0209564_1000049 Ga0209564_10000497 597
211 3300025299 Ga0209256_1000014 Ga0209256_1000014632 597
212 3300041413 Ga0439465_0020220 Ga0439465_0020220_162_1976 597

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21986

AH_C

Allophanate hydrolase C-terminal domain

486

596

0.97

PF01425

Amidase

Amidase

21

450

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.962 1 434
4gyr-assembly1.cif.gz_B granulibacter bethesdensis allophanate hydrolase apo 0.9609 1 453
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.9494 463 587
4gyr-assembly1.cif.gz_B granulibacter bethesdensis allophanate hydrolase apo 0.9426 1 453
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.9325 1 434
ID Description Score Start End Superfamily
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9599 1 434 3.90.1300.10
4gyrA01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9503 1 453 3.90.1300.10
4issB03 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9474 462 589 3.10.490.10
5c5zB00 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9448 463 587 3.10.490.10
4gyrA01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9335 1 453 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A074YUG5-F1-model_v4 Allophanate hydrolase C-terminal domain-containing protein 0.9784 464 588
AF-A0A3D2PW16-F1-model_v4 Allophanate hydrolase C-terminal domain-containing protein 0.977 463 589
AF-A0A0P9RP51-F1-model_v4 Amidase family protein (Amidase protein) 0.9769 3 232 GO:0003824
AF-A0A4Q3XES7-F1-model_v4 Allophanate hydrolase 0.9762 460 558 GO:0016787
AF-A0A075T4Y4-F1-model_v4 Allophanate hydrolase 0.9732 124 414 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.62 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map