F323283

General Info

Members Datasets Scaffolds Average Seq Length
212 172 424 466

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0082439|Ga0496103_0082439_704_2011
Length 426
Sequence MDLTRKQLTNQEPSPGGIGGPMNRFANVGAFPTADMRVVVRPNFDTLYSSGWLDLTKEPMVVSVPDTGGRYYLLPMLDMWTDVFASPGWRTTGTEAGTFLVTPXXXRPDLRDRFIEEFKLPANTQRIDAPTFYVWIIGRTKTDGPADYDAVHKIQAGYKITPLSQWSKAPEELKATIDPGVDMKTPPKAQVDSMPADMFFACAAELLKLQPPHITDQPIIARLKRIGFEVGKSFDLGHADPAVQKGLASAPEDAQKLMAWKVQSLARIANGWSMNTDTMGVYGNFYLKRAIVTQLGLGANLPEDAIYPLNLGANDYVLHFDKAKTPPVNAFWSVTLYDTQGFQVANPLNRFAVSSWMPFEYNPDGSLDLYFQNESPGADKEANWLPAPKGPYNLTMRLYAPKAEALTGKWNPPPVARALTVPAAAQ

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
149 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
150 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
151 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
152 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
153 2511231008 Pseudomonas sp. GM21 Isolate Nodule
154 2511231012 Pseudomonas sp. GM33 Isolate Nodule
155 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
156 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
157 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
158 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
159 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
160 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
161 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
162 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
163 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
164 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
165 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
166 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
167 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
168 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
169 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
170 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
171 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
172 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.62
Metatranscriptomes 0.47
Isolates 9.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.85
Nodule 6.6
Rhizoplane 5.19
Rhizosphere 65.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0082439 3300048906 Bacteria 2024
2 JGI25153J46596_10015319 3300003215 Bacteria 3129
3 rootH1_10102683 3300003316 Bacteria 3814
4 Ga0070680_100059864 3300005336 Bacteria 3117
5 Ga0070673_100015118 3300005364 Bacteria 5407
6 Ga0070688_100014514 3300005365 Bacteria 4465
7 Ga0070667_100045893 3300005367 Bacteria 3675
8 Ga0070709_10005822 3300005434 Bacteria 6681
9 Ga0070713_100005499 3300005436 Bacteria 8674
10 Ga0070705_100070782 3300005440 Bacteria 2107
11 Ga0070662_100073819 3300005457 Bacteria 2521
12 Ga0070681_10024758 3300005458 Bacteria 6038
13 Ga0070699_100083725 3300005518 Bacteria 2783
14 Ga0070679_100013572 3300005530 Bacteria 7806
15 Ga0070672_100048056 3300005543 Bacteria 3314
16 Ga0070665_100114438 3300005548 Bacteria 2700
17 Ga0070665_100173719 3300005548 Bacteria 2155
18 Ga0068855_100041450 3300005563 Bacteria 5456
19 Ga0068855_100098719 3300005563 Bacteria 3364
20 Ga0068858_100086776 3300005842 Bacteria 2911
21 Ga0068862_100253842 3300005844 Bacteria 1603
22 Ga0081455_10010099 3300005937 Bacteria 9624
23 Ga0081455_10106360 3300005937 Bacteria 2239
24 Ga0081540_1000112 3300005983 Bacteria 86810
25 Ga0081540_1026833 3300005983 Bacteria 3277
26 Ga0081540_1029147 3300005983 Bacteria 3082
27 Ga0081540_1054017 3300005983 Bacteria 1966
28 Ga0081540_1055116 3300005983 Bacteria 1938
29 Ga0070717_10010843 3300006028 Bacteria 6897
30 Ga0075365_10015972 3300006038 Bacteria 4553
31 Ga0075363_100045050 3300006048 Bacteria 2338
32 Ga0070716_100086626 3300006173 Bacteria 1884
33 Ga0070712_100037016 3300006175 Bacteria 3323
34 Ga0075367_10038690 3300006178 Bacteria 2777
35 Ga0075366_10023810 3300006195 Bacteria 3568
36 Ga0075370_10030402 3300006353 Bacteria 3013
37 Ga0075370_10070607 3300006353 Bacteria 1997
38 Ga0075431_100056390 3300006847 Bacteria 4053
39 Ga0075429_100068631 3300006880 Bacteria 3086
40 Ga0099795_10001985 3300007788 Bacteria 4663
41 Ga0105251_10018151 3300009011 Bacteria 3749
42 Ga0105240_10213112 3300009093 Bacteria 2255
43 Ga0111539_10403838 3300009094 Bacteria 1591
44 Ga0114129_10240303 3300009147 Bacteria 2435
45 Ga0114129_10324271 3300009147 Bacteria 2047
46 Ga0105248_10157470 3300009177 Bacteria 2563
47 Ga0105237_10017535 3300009545 Bacteria 7421
48 Ga0105237_10081111 3300009545 Bacteria 3234
49 Ga0105238_10182580 3300009551 Bacteria 2075
50 Ga0105249_10125215 3300009553 Bacteria 2446
51 Ga0099796_10000949 3300010159 Bacteria 5410
52 Ga0105239_10121638 3300010375 Bacteria 2899
53 Ga0105239_10157170 3300010375 Bacteria 2540
54 Ga0105239_10180138 3300010375 Bacteria 2364
55 Ga0105246_10026314 3300011119 Bacteria 3799
56 Ga0157369_10015770 3300013105 Bacteria 8515
57 Ga0157378_10075284 3300013297 Bacteria 3039
58 Ga0157375_10043536 3300013308 Bacteria 4355
59 Ga0157380_10142048 3300014326 Bacteria 2064
60 Ga0157379_10188176 3300014968 Bacteria 1866
61 Ga0209455_1009449 3300025272 Bacteria 2562
62 Ga0209758_1005256 3300025297 Bacteria 10128
63 Ga0207697_10056131 3300025315 Bacteria 1633
64 Ga0207680_10049983 3300025903 Bacteria 2492
65 Ga0207647_10002405 3300025904 Bacteria 14208
66 Ga0207647_10093430 3300025904 Bacteria 1792
67 Ga0207647_10104600 3300025904 Bacteria 1678
68 Ga0207699_10009585 3300025906 Bacteria 4829
69 Ga0207699_10029844 3300025906 Bacteria 3045
70 Ga0207707_10001660 3300025912 Bacteria 20546
71 Ga0207671_10139139 3300025914 Bacteria 1869
72 Ga0207693_10179632 3300025915 Bacteria 1665
73 Ga0207652_10011572 3300025921 Bacteria 7115
74 Ga0207694_10073239 3300025924 Bacteria 2679
75 Ga0207700_10003637 3300025928 Bacteria 8990
76 Ga0207700_10067257 3300025928 Bacteria 2742
77 Ga0207706_10022098 3300025933 Bacteria 5709
78 Ga0207689_10020289 3300025942 Bacteria 5596
79 Ga0207668_10017814 3300025972 Bacteria 4457
80 Ga0207658_10176682 3300025986 Bacteria 1764
81 Ga0207708_10009686 3300026075 Bacteria 7147
82 Ga0207641_10096476 3300026088 Bacteria 2597
83 Ga0207674_10120099 3300026116 Bacteria 2596
84 Ga0207675_100013601 3300026118 Bacteria 7597
85 Ga0207683_10008827 3300026121 Bacteria 8596
86 Ga0268266_10005448 3300028379 Bacteria 11859
87 Ga0265760_10005928 3300031090 Bacteria 3492
88 Ga0265325_10029708 3300031241 Bacteria 2936
89 Ga0307509_10002790 3300031507 Bacteria 27716
90 Ga0307509_10144237 3300031507 Bacteria 2310
91 Ga0307508_10058652 3300031616 Bacteria 3406
92 Ga0307516_10000173 3300031730 Bacteria 82288
93 Ga0307416_100223274 3300032002 Bacteria 1809
94 Ga0307415_100029572 3300032126 Bacteria 3504
95 Ga0307510_10043861 3300033180 Bacteria 4855
96 Ga0307510_10079896 3300033180 Bacteria 3184
97 Ga0315911_1000012 3300033442 Bacteria 248988
98 Ga0373936_0076265 3300035113 Bacteria 1389
99 Ga0373955_0011427 3300035172 Bacteria 4231
100 Ga0373927_0003503 3300035695 Bacteria 11234
101 Ga0373927_0012027 3300035695 Bacteria 5757
102 Ga0373927_0072842 3300035695 Bacteria 2224
103 Ga0373947_0011004 3300035725 Bacteria 5189
104 Ga0373937_0116085 3300036401 Bacteria 2493
105 Ga0373937_0226824 3300036401 Bacteria 1759
106 Ga0373925_0089874 3300037068 Bacteria 2347
107 Ga0395900_0157676 3300037418 Bacteria 2318
108 Ga0439453_0002759 3300041408 Bacteria 2459
109 Ga0451851_0073345 3300041507 Bacteria 1593
110 Ga0466967_0078923 3300045976 Bacteria 2966
111 Ga0495592_0106667 3300046454 Bacteria 1988
112 Ga0495603_0000980 3300046455 Bacteria 16456
113 Ga0495638_0068950 3300046460 Bacteria 2167
114 Ga0495580_0005267 3300046472 Bacteria 10742
115 Ga0495582_0003611 3300046473 Bacteria 8716
116 Ga0495662_0001134 3300046476 Bacteria 13133
117 Ga0495594_0004189 3300046499 Bacteria 7405
118 Ga0495610_0035638 3300046512 Bacteria 2552
119 Ga0495610_0072770 3300046512 Bacteria 1599
120 Ga0495628_0021511 3300046516 Bacteria 5304
121 Ga0495643_0004079 3300046522 Bacteria 10400
122 Ga0495644_0025940 3300046523 Bacteria 2224
123 Ga0495665_0000574 3300046531 Bacteria 18692
124 Ga0495645_0004496 3300046543 Bacteria 9511
125 Ga0495622_0066794 3300046557 Bacteria 1662
126 Ga0495633_0026616 3300046558 Bacteria 2837
127 Ga0495668_0023053 3300046616 Bacteria 3554
128 Ga0495634_0025255 3300046642 Bacteria 4160
129 Ga0495625_0051764 3300046660 Bacteria 2943
130 Ga0495635_0005641 3300046663 Bacteria 8719
131 Ga0495588_0004042 3300046674 Bacteria 6449
132 Ga0495588_0006056 3300046674 Bacteria 5426
133 Ga0495669_0063929 3300046684 Bacteria 1670
134 Ga0495687_011602 3300047443 Bacteria 4723
135 Ga0495593_0008257 3300047673 Bacteria 6059
136 Ga0495626_0057520 3300048091 Bacteria 1779
137 Ga0496103_0037942 3300048906 Bacteria 2954
138 Ga0496105_0048649 3300048908 Bacteria 3500
139 Ga0496108_0050131 3300048911 Bacteria 3494
140 Ga0496108_0079622 3300048911 Bacteria 2774
141 Ga0496109_0054879 3300048912 Bacteria 3634
142 Ga0496109_0072067 3300048912 Bacteria 3173
143 Ga0496109_0152509 3300048912 Bacteria 2164
144 Ga0496110_0005091 3300048913 Bacteria 10267
145 Ga0496111_0004778 3300048914 Bacteria 8595
146 Ga0496112_0021947 3300048915 Bacteria 6076
147 Ga0496118_0028471 3300048921 Bacteria 4704
148 Ga0496118_0030485 3300048921 Bacteria 4500
149 Ga0496121_0018405 3300048924 Bacteria 7043
150 Ga0496121_0095800 3300048924 Bacteria 2305
151 Ga0496126_0003482 3300048929 Bacteria 19864
152 Ga0496126_0005900 3300048929 Bacteria 13814
153 Ga0496126_0009574 3300048929 Bacteria 10276
154 Ga0496126_0013365 3300048929 Bacteria 8355
155 Ga0496126_0021238 3300048929 Bacteria 6346
156 Ga0496126_0083997 3300048929 Bacteria 2809
157 Ga0496126_0096889 3300048929 Bacteria 2586
158 Ga0501039_0024795 3300049575 Bacteria 4607
159 Ga0501046_0080526 3300049580 Bacteria 2517
160 Ga0501048_0091940 3300049582 Bacteria 2140
161 Ga0501048_0112380 3300049582 Bacteria 1924
162 Ga0501067_0005403 3300049583 Bacteria 7096
163 Ga0501070_0165614 3300049586 Bacteria 1822
164 Ga0501071_0034180 3300049587 Bacteria 3617
165 Ga0501238_004863 3300049671 Bacteria 1690
166 Ga0501081_0049963 3300049743 Bacteria 2880
167 Ga0501081_0054915 3300049743 Bacteria 2752
168 Ga0501081_0069396 3300049743 Bacteria 2455
169 Ga0501045_0025356 3300049824 Bacteria 4262
170 nmdc:mga03n38_8552_c1 3300050490 Bacteria 3680
171 nmdc:mga0k408_19000_c1 3300050493 Bacteria 3837
172 nmdc:mga05p37_201681_c1 3300050507 Bacteria 2409
173 nmdc:mga05p37_320179_c1 3300050507 Bacteria 1836
174 nmdc:mga09592_148318_c1 3300050508 Bacteria 2023
175 nmdc:mga0qj67_26388_c1 3300050509 Bacteria 4498
176 nmdc:mga06r32_6619_c1 3300050510 Bacteria 10413
177 nmdc:mga0n895_29619_c1 3300050512 Bacteria 5224
178 nmdc:mga0rr50_295966_c1 3300050513 Bacteria 1353
179 nmdc:mga0a205_159469_c1 3300050515 Bacteria 2153
180 nmdc:mga0sz30_5739_c1 3300050516 Bacteria 3505
181 Ga0500635_0012731 3300053080 Bacteria 2425
182 Ga0500651_0030238 3300053093 Bacteria 3407
183 Ga0500554_009831 3300053102 Bacteria 2304
184 Ga0500562_001537 3300053108 Bacteria 5709
185 Ga0500595_004968 3300053119 Bacteria 5873
186 Ga0500658_0003785 3300053134 Bacteria 5697
187 Ga0500622_0000266 3300053156 Bacteria 53524
188 Ga0500622_0017481 3300053156 Bacteria 3815
189 Ga0500634_0077533 3300053161 Bacteria 1722
190 Ga0500637_0011155 3300053178 Bacteria 4633
191 Ga0500599_000185 3300053736 Bacteria 5775
192 2510898123 2510461076 Bacteria 8618824
193 2511276098 2511231008 Bacteria 6624100
194 2511303892 2511231012 Bacteria 6738011
195 2513646673 2513237095 Bacteria 8976980
196 2513675273 2513237098 Bacteria 9902361
197 2513888491 2513237141 Bacteria 8496279
198 2514023725 2513237162 Bacteria 7468464
199 2515638450 2515154113 Bacteria 7807172
200 2515645641 2515154114 Bacteria 7848616
201 2515661446 2515154116 Bacteria 7552979
202 2517039460 2516653077 Bacteria 7555578
203 2524469127 2524023210 Bacteria 9029266
204 2776261740 2775506901 Bacteria 9631051
205 2824656557 2824653114 Bacteria 8493680
206 2840764842 2840764183 Bacteria 6358399
207 2888383346 2888378607 Bacteria 9652610
208 2888391861 2888388044 Bacteria 7304136
209 2903771452 2903768456 Bacteria 9749579
210 2939670204 2939669807 Bacteria 5028511
211 2941506974 2941499720 Bacteria 7599444
212 2941535936 2941531003 Bacteria 7653939
213 Ga0496103_0082439
214 JGI25153J46596_10015319
215 rootH1_10102683
216 Ga0070680_100059864
217 Ga0070673_100015118
218 Ga0070688_100014514
219 Ga0070667_100045893
220 Ga0070709_10005822
221 Ga0070713_100005499
222 Ga0070705_100070782
223 Ga0070662_100073819
224 Ga0070681_10024758
225 Ga0070699_100083725
226 Ga0070679_100013572
227 Ga0070672_100048056
228 Ga0070665_100114438
229 Ga0070665_100173719
230 Ga0068855_100041450
231 Ga0068855_100098719
232 Ga0068858_100086776
233 Ga0068862_100253842
234 Ga0081455_10010099
235 Ga0081455_10106360
236 Ga0081540_1000112
237 Ga0081540_1026833
238 Ga0081540_1029147
239 Ga0081540_1054017
240 Ga0081540_1055116
241 Ga0070717_10010843
242 Ga0075365_10015972
243 Ga0075363_100045050
244 Ga0070716_100086626
245 Ga0070712_100037016
246 Ga0075367_10038690
247 Ga0075366_10023810
248 Ga0075370_10030402
249 Ga0075370_10070607
250 Ga0075431_100056390
251 Ga0075429_100068631
252 Ga0099795_10001985
253 Ga0105251_10018151
254 Ga0105240_10213112
255 Ga0111539_10403838
256 Ga0114129_10240303
257 Ga0114129_10324271
258 Ga0105248_10157470
259 Ga0105237_10017535
260 Ga0105237_10081111
261 Ga0105238_10182580
262 Ga0105249_10125215
263 Ga0099796_10000949
264 Ga0105239_10121638
265 Ga0105239_10157170
266 Ga0105239_10180138
267 Ga0105246_10026314
268 Ga0157369_10015770
269 Ga0157378_10075284
270 Ga0157375_10043536
271 Ga0157380_10142048
272 Ga0157379_10188176
273 Ga0209455_1009449
274 Ga0209758_1005256
275 Ga0207697_10056131
276 Ga0207680_10049983
277 Ga0207647_10002405
278 Ga0207647_10093430
279 Ga0207647_10104600
280 Ga0207699_10009585
281 Ga0207699_10029844
282 Ga0207707_10001660
283 Ga0207671_10139139
284 Ga0207693_10179632
285 Ga0207652_10011572
286 Ga0207694_10073239
287 Ga0207700_10003637
288 Ga0207700_10067257
289 Ga0207706_10022098
290 Ga0207689_10020289
291 Ga0207668_10017814
292 Ga0207658_10176682
293 Ga0207708_10009686
294 Ga0207641_10096476
295 Ga0207674_10120099
296 Ga0207675_100013601
297 Ga0207683_10008827
298 Ga0268266_10005448
299 Ga0265760_10005928
300 Ga0265325_10029708
301 Ga0307509_10002790
302 Ga0307509_10144237
303 Ga0307508_10058652
304 Ga0307516_10000173
305 Ga0307416_100223274
306 Ga0307415_100029572
307 Ga0307510_10043861
308 Ga0307510_10079896
309 Ga0315911_1000012
310 Ga0373936_0076265
311 Ga0373955_0011427
312 Ga0373927_0003503
313 Ga0373927_0012027
314 Ga0373927_0072842
315 Ga0373947_0011004
316 Ga0373937_0116085
317 Ga0373937_0226824
318 Ga0373925_0089874
319 Ga0395900_0157676
320 Ga0439453_0002759
321 Ga0451851_0073345
322 Ga0466967_0078923
323 Ga0495592_0106667
324 Ga0495603_0000980
325 Ga0495638_0068950
326 Ga0495580_0005267
327 Ga0495582_0003611
328 Ga0495662_0001134
329 Ga0495594_0004189
330 Ga0495610_0035638
331 Ga0495610_0072770
332 Ga0495628_0021511
333 Ga0495643_0004079
334 Ga0495644_0025940
335 Ga0495665_0000574
336 Ga0495645_0004496
337 Ga0495622_0066794
338 Ga0495633_0026616
339 Ga0495668_0023053
340 Ga0495634_0025255
341 Ga0495625_0051764
342 Ga0495635_0005641
343 Ga0495588_0004042
344 Ga0495588_0006056
345 Ga0495669_0063929
346 Ga0495687_011602
347 Ga0495593_0008257
348 Ga0495626_0057520
349 Ga0496103_0037942
350 Ga0496105_0048649
351 Ga0496108_0050131
352 Ga0496108_0079622
353 Ga0496109_0054879
354 Ga0496109_0072067
355 Ga0496109_0152509
356 Ga0496110_0005091
357 Ga0496111_0004778
358 Ga0496112_0021947
359 Ga0496118_0028471
360 Ga0496118_0030485
361 Ga0496121_0018405
362 Ga0496121_0095800
363 Ga0496126_0003482
364 Ga0496126_0005900
365 Ga0496126_0009574
366 Ga0496126_0013365
367 Ga0496126_0021238
368 Ga0496126_0083997
369 Ga0496126_0096889
370 Ga0501039_0024795
371 Ga0501046_0080526
372 Ga0501048_0091940
373 Ga0501048_0112380
374 Ga0501067_0005403
375 Ga0501070_0165614
376 Ga0501071_0034180
377 Ga0501238_004863
378 Ga0501081_0049963
379 Ga0501081_0054915
380 Ga0501081_0069396
381 Ga0501045_0025356
382 nmdc:mga03n38_8552_c1
383 nmdc:mga0k408_19000_c1
384 nmdc:mga05p37_201681_c1
385 nmdc:mga05p37_320179_c1
386 nmdc:mga09592_148318_c1
387 nmdc:mga0qj67_26388_c1
388 nmdc:mga06r32_6619_c1
389 nmdc:mga0n895_29619_c1
390 nmdc:mga0rr50_295966_c1
391 nmdc:mga0a205_159469_c1
392 nmdc:mga0sz30_5739_c1
393 Ga0500635_0012731
394 Ga0500651_0030238
395 Ga0500554_009831
396 Ga0500562_001537
397 Ga0500595_004968
398 Ga0500658_0003785
399 Ga0500622_0000266
400 Ga0500622_0017481
401 Ga0500634_0077533
402 Ga0500637_0011155
403 Ga0500599_000185
404 2510898123
405 2511276098
406 2511303892
407 2513646673
408 2513675273
409 2513888491
410 2514023725
411 2515638450
412 2515645641
413 2515661446
414 2517039460
415 2524469127
416 2776261740
417 2824656557
418 2840764842
419 2888383346
420 2888391861
421 2903771452
422 2939670204
423 2941506974
424 2941535936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06863

DUF1254

Protein of unknown function (DUF1254)

22

162

0.97

PF06742

DUF1214

Protein of unknown function (DUF1214)

303

403

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.6938 32 471
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.6572 32 471
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6548 35 472
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6521 35 472
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6518 35 472
ID Description Score Start End Superfamily
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8126 352 472 2.60.120.1600
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8001 352 472 2.60.120.1600
2p3yA02 Mainly Alpha;Orthogonal Bundle;VPA0735-like fold;VPA0735-like domain 0.7753 240 310 1.10.3360.10
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.7298 315 471 2.60.120.600
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.6716 315 471 2.60.120.600
ID Description Score Start End GO Terms
AF-A0A1B9RB08-F1-model_v4 deleted 0.9559 356 471
AF-A0A640T6Y8-F1-model_v4 DUF1214 domain-containing protein 0.9442 361 471
AF-A0A7C7S7A0-F1-model_v4 deleted 0.9435 362 472
AF-A0A109LEV8-F1-model_v4 DUF1214 domain-containing protein 0.9411 348 472
AF-A0A1G7JEH3-F1-model_v4 DUF1214 domain-containing protein 0.9375 349 473

Map