F323219

General Info

Members Datasets Scaffolds Average Seq Length
212 168 424 157

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0000795|Ga0495594_0000795_11938_12483
Length 181
Sequence LARIFRPRDGRFALQHNGDVNLIGETMDTSNVKAVPEGMHSVTPHLVCAGAADAIEFYKRAFGADEVMRLPGPDGKLGHAMIRIGDSMVMLADEFPQWESLGPLALKGSPVTLHLSVPNVDQVYERALAAGAQVRMPLADMFWGDRYGIVEDPFGHRWSIATHIRDVSPEEMAAEMAKACA

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
162 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
163 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
164 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
165 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
166 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
167 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
168 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.75
Metatranscriptomes 0.47
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 0.47
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0000795 3300046499 Bacteria 16287
2 Ga0070683_100117666 3300005329 Bacteria 2509
3 Ga0068869_100977114 3300005334 Bacteria 736
4 Ga0070666_10173409 3300005335 Bacteria 1511
5 Ga0070689_100001566 3300005340 Bacteria 14579
6 Ga0070689_100047613 3300005340 Bacteria 3306
7 Ga0070692_10901117 3300005345 Bacteria 611
8 Ga0070668_100208445 3300005347 Bacteria 1607
9 Ga0070669_100042285 3300005353 Bacteria 3315
10 Ga0070675_100876877 3300005354 Bacteria 822
11 Ga0070671_100118942 3300005355 Bacteria 2223
12 Ga0070673_100060051 3300005364 Bacteria 3011
13 Ga0070673_101284185 3300005364 Bacteria 687
14 Ga0070659_100074878 3300005366 Bacteria 2698
15 Ga0070659_100467470 3300005366 Bacteria 1072
16 Ga0070667_100223179 3300005367 Bacteria 1678
17 Ga0070667_100291539 3300005367 Bacteria 1467
18 Ga0070714_100944976 3300005435 Bacteria 838
19 Ga0070701_10530333 3300005438 Bacteria 769
20 Ga0070705_100204689 3300005440 Bacteria 1356
21 Ga0070700_100411419 3300005441 Bacteria 1020
22 Ga0070694_100025319 3300005444 Bacteria 3838
23 Ga0070662_100369353 3300005457 Bacteria 1179
24 Ga0070685_10733790 3300005466 Bacteria 723
25 Ga0070698_100022573 3300005471 Bacteria 6582
26 Ga0070672_100031238 3300005543 Bacteria 4007
27 Ga0070686_100544174 3300005544 Bacteria 907
28 Ga0070695_100101579 3300005545 Bacteria 1938
29 Ga0070695_100515338 3300005545 Bacteria 927
30 Ga0070696_100272842 3300005546 Bacteria 1287
31 Ga0070704_100214863 3300005549 Bacteria 1560
32 Ga0070702_100916988 3300005615 Unclassified 687
33 Ga0068859_100328010 3300005617 Bacteria 1625
34 Ga0068859_100491383 3300005617 Unclassified 1323
35 Ga0068864_101582200 3300005618 Bacteria 659
36 Ga0068862_100213999 3300005844 Bacteria 1742
37 Ga0081455_10035626 3300005937 Bacteria 4444
38 Ga0081455_10139435 3300005937 Bacteria 1885
39 Ga0075428_100263447 3300006844 Bacteria 1856
40 Ga0075430_100113542 3300006846 Bacteria 2258
41 Ga0075431_100320319 3300006847 Bacteria 1564
42 Ga0075431_100646311 3300006847 Bacteria 1038
43 Ga0075436_100052830 3300006914 Bacteria 2805
44 Ga0097620_100327958 3300006931 Bacteria 1625
45 Ga0097620_100491365 3300006931 Unclassified 1323
46 Ga0105240_10022070 3300009093 Bacteria 8449
47 Ga0111539_10395262 3300009094 Bacteria 1610
48 Ga0105248_10003918 3300009177 Bacteria 16461
49 Ga0105248_10354820 3300009177 Bacteria 1651
50 Ga0157373_10320746 3300013100 Unclassified 1102
51 Ga0157378_12061753 3300013297 Bacteria 621
52 Ga0163162_10116770 3300013306 Bacteria 2769
53 Ga0157375_10075657 3300013308 Bacteria 3392
54 Ga0163163_10000025 3300014325 Bacteria 182686
55 Ga0157380_10427635 3300014326 Bacteria 1265
56 Ga0157376_10211730 3300014969 Bacteria 1790
57 Ga0207680_10154465 3300025903 Bacteria 1533
58 Ga0207699_11084401 3300025906 Bacteria 593
59 Ga0207645_10333319 3300025907 Bacteria 1014
60 Ga0207695_10025277 3300025913 Bacteria 6653
61 Ga0207681_10026308 3300025923 Bacteria 3752
62 Ga0207644_10485887 3300025931 Bacteria 1017
63 Ga0207690_10150010 3300025932 Bacteria 1727
64 Ga0207690_10312062 3300025932 Bacteria 1234
65 Ga0207706_10261011 3300025933 Bacteria 1512
66 Ga0207670_10001448 3300025936 Bacteria 12474
67 Ga0207670_10144572 3300025936 Bacteria 1757
68 Ga0207670_11419733 3300025936 Bacteria 589
69 Ga0207691_10005645 3300025940 Bacteria 12094
70 Ga0207691_10719963 3300025940 Bacteria 841
71 Ga0207711_10012724 3300025941 Bacteria 6988
72 Ga0207689_11069257 3300025942 Bacteria 680
73 Ga0207661_10390261 3300025944 Bacteria 1261
74 Ga0207651_11037940 3300025960 Bacteria 733
75 Ga0207641_10416720 3300026088 Bacteria 1292
76 Ga0207641_10782955 3300026088 Bacteria 943
77 Ga0207648_10246899 3300026089 Bacteria 1591
78 Ga0207676_11245487 3300026095 Bacteria 738
79 Ga0209996_1043061 3300027395 Bacteria 674
80 Ga0209971_1003430 3300027682 Bacteria 3761
81 Ga0209974_10052129 3300027876 Bacteria 1377
82 Ga0268264_10252990 3300028381 Bacteria 1637
83 Ga0307515_10026887 3300028794 Bacteria 9869
84 Ga0307515_10284241 3300028794 Bacteria 1358
85 Ga0265325_10417911 3300031241 Bacteria 586
86 Ga0307513_10444119 3300031456 Bacteria 1023
87 Ga0307408_100070684 3300031548 Bacteria 2578
88 Ga0265313_10227438 3300031595 Bacteria 767
89 Ga0265314_10121839 3300031711 Bacteria 1640
90 Ga0307405_10209730 3300031731 Bacteria 1421
91 Ga0307413_10332578 3300031824 Bacteria 1165
92 Ga0307409_100103103 3300031995 Bacteria 2372
93 Ga0307409_100228331 3300031995 Bacteria 1685
94 Ga0307409_100676770 3300031995 Bacteria 1029
95 Ga0307416_100137155 3300032002 Bacteria 2216
96 Ga0307411_10568277 3300032005 Unclassified 970
97 Ga0307411_11316955 3300032005 Bacteria 659
98 Ga0373954_0000006 3300035118 Bacteria 98573
99 Ga0373956_0069587 3300035119 Unclassified 1604
100 Ga0373957_0124546 3300035120 Unclassified 1045
101 Ga0373924_0012927 3300035410 Bacteria 3128
102 Ga0373933_0025289 3300035724 Bacteria 3404
103 Ga0373933_0065853 3300035724 Bacteria 2194
104 Ga0373947_1083981 3300035725 Bacteria 546
105 Ga0373937_0000595 3300036401 Bacteria 32029
106 Ga0373937_0010248 3300036401 Bacteria 8179
107 Ga0395900_0394212 3300037418 Bacteria 1350
108 Ga0395900_0438429 3300037418 Bacteria 1264
109 Ga0395898_0142302 3300037466 Bacteria 2296
110 Ga0450899_026610 3300042135 Bacteria 693
111 Ga0450906_039672 3300042145 Bacteria 831
112 Ga0451577_0000330 3300042876 Bacteria 88084
113 Ga0451577_0200841 3300042876 Bacteria 1800
114 Ga0451577_0617230 3300042876 Bacteria 984
115 Ga0453683_0639796 3300044673 Bacteria 695
116 Ga0466964_0018312 3300044706 Bacteria 2687
117 Ga0453684_0001016 3300044712 Bacteria 90387
118 Ga0466970_0054654 3300044765 Bacteria 2132
119 Ga0451576_0008378 3300045051 Bacteria 12140
120 Ga0451576_0187992 3300045051 Bacteria 2157
121 Ga0451576_0716069 3300045051 Archaea 1051
122 Ga0495603_0095245 3300046455 Bacteria 1739
123 Ga0495651_0448170 3300046462 Unclassified 834
124 Ga0495650_0000097 3300046471 Bacteria 216051
125 Ga0495582_0004822 3300046473 Bacteria 7568
126 Ga0495582_0023965 3300046473 Bacteria 3337
127 Ga0495584_0009020 3300046491 Bacteria 5153
128 Ga0495584_0013542 3300046491 Bacteria 4163
129 Ga0495585_0000070 3300046492 Bacteria 106156
130 Ga0495585_0024438 3300046492 Bacteria 3464
131 Ga0495594_0316885 3300046499 Bacteria 888
132 Ga0495583_0184638 3300046506 Bacteria 852
133 Ga0495606_0033205 3300046507 Bacteria 3562
134 Ga0495606_0051692 3300046507 Bacteria 2678
135 Ga0495644_0032959 3300046523 Bacteria 1958
136 Ga0495666_0001472 3300046526 Bacteria 11492
137 Ga0495666_0008436 3300046526 Bacteria 5168
138 Ga0495666_0066281 3300046526 Bacteria 1721
139 Ga0495652_0193882 3300046529 Bacteria 1548
140 Ga0495586_0044514 3300046535 Bacteria 2391
141 Ga0495587_0037760 3300046536 Bacteria 2898
142 Ga0495587_0211544 3300046536 Unclassified 1095
143 Ga0495587_0351821 3300046536 Bacteria 821
144 Ga0495598_0255913 3300046537 Bacteria 650
145 Ga0495597_0000354 3300046542 Bacteria 40920
146 Ga0495622_0034609 3300046557 Bacteria 2356
147 Ga0495622_0049187 3300046557 Bacteria 1957
148 Ga0495656_0222182 3300046615 Bacteria 945
149 Ga0495656_0489279 3300046615 Bacteria 651
150 Ga0495668_0033425 3300046616 Bacteria 2890
151 Ga0495668_0062433 3300046616 Bacteria 2053
152 Ga0495634_0094362 3300046642 Bacteria 1939
153 Ga0495611_0010133 3300046648 Bacteria 3988
154 Ga0495611_0070536 3300046648 Bacteria 1597
155 Ga0495625_0012556 3300046660 Bacteria 6858
156 Ga0495635_0204933 3300046663 Bacteria 1337
157 Ga0495588_0083314 3300046674 Bacteria 1670
158 Ga0495623_0097107 3300046679 Bacteria 1799
159 Ga0495623_0215980 3300046679 Bacteria 1095
160 Ga0495646_0284050 3300046680 Bacteria 879
161 Ga0495669_0063039 3300046684 Bacteria 1681
162 Ga0495669_0475044 3300046684 Bacteria 607
163 Ga0495624_0462897 3300046690 Bacteria 759
164 Ga0495670_0021689 3300046691 Bacteria 3169
165 Ga0495589_0210167 3300046794 Bacteria 916
166 Ga0495581_0002745 3300047315 Bacteria 10043
167 Ga0495604_0589861 3300047317 Bacteria 713
168 Ga0495636_0012847 3300047318 Bacteria 3318
169 Ga0495674_0089156 3300047319 Bacteria 2637
170 Ga0495674_0862494 3300047319 Bacteria 701
171 Ga0495672_0000920 3300047320 Bacteria 30767
172 Ga0495672_0056867 3300047320 Bacteria 2274
173 Ga0495676_0046398 3300047321 Bacteria 3526
174 Ga0495680_0774808 3300047322 Bacteria 628
175 Ga0495681_0058236 3300047470 Bacteria 1791
176 Ga0495593_0009619 3300047673 Bacteria 5611
177 Ga0495602_0043690 3300048088 Bacteria 4071
178 Ga0495614_0371505 3300048089 Bacteria 669
179 Ga0496115_0012507 3300048918 Bacteria 6390
180 Ga0501315_016813 3300049531 Bacteria 950
181 Ga0501031_0043864 3300049568 Bacteria 2918
182 Ga0501032_0185747 3300049569 Bacteria 1360
183 Ga0501034_0047683 3300049571 Bacteria 4325
184 Ga0501034_0874744 3300049571 Bacteria 788
185 Ga0501037_0287333 3300049573 Bacteria 1145
186 Ga0501039_0645475 3300049575 Bacteria 829
187 Ga0501040_0183551 3300049576 Bacteria 1483
188 Ga0501041_0287326 3300049577 Bacteria 1035
189 Ga0501042_0096961 3300049578 Bacteria 2119
190 Ga0501071_0694688 3300049587 Bacteria 783
191 Ga0501072_0637449 3300049588 Bacteria 839
192 Ga0501076_0103639 3300049592 Bacteria 2295
193 Ga0501222_032439 3300049662 Bacteria 721
194 Ga0501080_0759948 3300049742 Bacteria 852
195 Ga0501083_0997703 3300049744 Bacteria 545
196 Ga0501045_0123724 3300049824 Bacteria 1921
197 nmdc:mga0qj67_217566_c1 3300050509 Bacteria 1551
198 nmdc:mga0n895_1204129_c1 3300050512 Bacteria 731
199 Ga0495619_0439196 3300053085 Unclassified 900
200 Ga0500578_0020316 3300053086 Bacteria 4269
201 Ga0500622_0094505 3300053156 Bacteria 1479
202 Ga0500645_002236 3300053730 Bacteria 8822
203 Ga0501084_0410019 3300054114 Bacteria 1145
204 Ga0530510_0389161 3300061734 Bacteria 1050
205 2587757688 2585428062 Bacteria 6842168
206 2746091876 2744054900 Bacteria 8399525
207 2746096025 2744054901 Bacteria 8397047
208 2808981218 2808606386 Bacteria 4471946
209 2809035455 2808606395 Bacteria 6020352
210 2809131728 2808606415 Bacteria 4576710
211 2809151460 2808606419 Bacteria 4576925
212 2852620944 2852618963 Bacteria 4577824
213 Ga0495594_0000795
214 Ga0070683_100117666
215 Ga0068869_100977114
216 Ga0070666_10173409
217 Ga0070689_100001566
218 Ga0070689_100047613
219 Ga0070692_10901117
220 Ga0070668_100208445
221 Ga0070669_100042285
222 Ga0070675_100876877
223 Ga0070671_100118942
224 Ga0070673_100060051
225 Ga0070673_101284185
226 Ga0070659_100074878
227 Ga0070659_100467470
228 Ga0070667_100223179
229 Ga0070667_100291539
230 Ga0070714_100944976
231 Ga0070701_10530333
232 Ga0070705_100204689
233 Ga0070700_100411419
234 Ga0070694_100025319
235 Ga0070662_100369353
236 Ga0070685_10733790
237 Ga0070698_100022573
238 Ga0070672_100031238
239 Ga0070686_100544174
240 Ga0070695_100101579
241 Ga0070695_100515338
242 Ga0070696_100272842
243 Ga0070704_100214863
244 Ga0070702_100916988
245 Ga0068859_100328010
246 Ga0068859_100491383
247 Ga0068864_101582200
248 Ga0068862_100213999
249 Ga0081455_10035626
250 Ga0081455_10139435
251 Ga0075428_100263447
252 Ga0075430_100113542
253 Ga0075431_100320319
254 Ga0075431_100646311
255 Ga0075436_100052830
256 Ga0097620_100327958
257 Ga0097620_100491365
258 Ga0105240_10022070
259 Ga0111539_10395262
260 Ga0105248_10003918
261 Ga0105248_10354820
262 Ga0157373_10320746
263 Ga0157378_12061753
264 Ga0163162_10116770
265 Ga0157375_10075657
266 Ga0163163_10000025
267 Ga0157380_10427635
268 Ga0157376_10211730
269 Ga0207680_10154465
270 Ga0207699_11084401
271 Ga0207645_10333319
272 Ga0207695_10025277
273 Ga0207681_10026308
274 Ga0207644_10485887
275 Ga0207690_10150010
276 Ga0207690_10312062
277 Ga0207706_10261011
278 Ga0207670_10001448
279 Ga0207670_10144572
280 Ga0207670_11419733
281 Ga0207691_10005645
282 Ga0207691_10719963
283 Ga0207711_10012724
284 Ga0207689_11069257
285 Ga0207661_10390261
286 Ga0207651_11037940
287 Ga0207641_10416720
288 Ga0207641_10782955
289 Ga0207648_10246899
290 Ga0207676_11245487
291 Ga0209996_1043061
292 Ga0209971_1003430
293 Ga0209974_10052129
294 Ga0268264_10252990
295 Ga0307515_10026887
296 Ga0307515_10284241
297 Ga0265325_10417911
298 Ga0307513_10444119
299 Ga0307408_100070684
300 Ga0265313_10227438
301 Ga0265314_10121839
302 Ga0307405_10209730
303 Ga0307413_10332578
304 Ga0307409_100103103
305 Ga0307409_100228331
306 Ga0307409_100676770
307 Ga0307416_100137155
308 Ga0307411_10568277
309 Ga0307411_11316955
310 Ga0373954_0000006
311 Ga0373956_0069587
312 Ga0373957_0124546
313 Ga0373924_0012927
314 Ga0373933_0025289
315 Ga0373933_0065853
316 Ga0373947_1083981
317 Ga0373937_0000595
318 Ga0373937_0010248
319 Ga0395900_0394212
320 Ga0395900_0438429
321 Ga0395898_0142302
322 Ga0450899_026610
323 Ga0450906_039672
324 Ga0451577_0000330
325 Ga0451577_0200841
326 Ga0451577_0617230
327 Ga0453683_0639796
328 Ga0466964_0018312
329 Ga0453684_0001016
330 Ga0466970_0054654
331 Ga0451576_0008378
332 Ga0451576_0187992
333 Ga0451576_0716069
334 Ga0495603_0095245
335 Ga0495651_0448170
336 Ga0495650_0000097
337 Ga0495582_0004822
338 Ga0495582_0023965
339 Ga0495584_0009020
340 Ga0495584_0013542
341 Ga0495585_0000070
342 Ga0495585_0024438
343 Ga0495594_0316885
344 Ga0495583_0184638
345 Ga0495606_0033205
346 Ga0495606_0051692
347 Ga0495644_0032959
348 Ga0495666_0001472
349 Ga0495666_0008436
350 Ga0495666_0066281
351 Ga0495652_0193882
352 Ga0495586_0044514
353 Ga0495587_0037760
354 Ga0495587_0211544
355 Ga0495587_0351821
356 Ga0495598_0255913
357 Ga0495597_0000354
358 Ga0495622_0034609
359 Ga0495622_0049187
360 Ga0495656_0222182
361 Ga0495656_0489279
362 Ga0495668_0033425
363 Ga0495668_0062433
364 Ga0495634_0094362
365 Ga0495611_0010133
366 Ga0495611_0070536
367 Ga0495625_0012556
368 Ga0495635_0204933
369 Ga0495588_0083314
370 Ga0495623_0097107
371 Ga0495623_0215980
372 Ga0495646_0284050
373 Ga0495669_0063039
374 Ga0495669_0475044
375 Ga0495624_0462897
376 Ga0495670_0021689
377 Ga0495589_0210167
378 Ga0495581_0002745
379 Ga0495604_0589861
380 Ga0495636_0012847
381 Ga0495674_0089156
382 Ga0495674_0862494
383 Ga0495672_0000920
384 Ga0495672_0056867
385 Ga0495676_0046398
386 Ga0495680_0774808
387 Ga0495681_0058236
388 Ga0495593_0009619
389 Ga0495602_0043690
390 Ga0495614_0371505
391 Ga0496115_0012507
392 Ga0501315_016813
393 Ga0501031_0043864
394 Ga0501032_0185747
395 Ga0501034_0047683
396 Ga0501034_0874744
397 Ga0501037_0287333
398 Ga0501039_0645475
399 Ga0501040_0183551
400 Ga0501041_0287326
401 Ga0501042_0096961
402 Ga0501071_0694688
403 Ga0501072_0637449
404 Ga0501076_0103639
405 Ga0501222_032439
406 Ga0501080_0759948
407 Ga0501083_0997703
408 Ga0501045_0123724
409 nmdc:mga0qj67_217566_c1
410 nmdc:mga0n895_1204129_c1
411 Ga0495619_0439196
412 Ga0500578_0020316
413 Ga0500622_0094505
414 Ga0500645_002236
415 Ga0501084_0410019
416 Ga0530510_0389161
417 2587757688
418 2746091876
419 2746096025
420 2808981218
421 2809035455
422 2809131728
423 2809151460
424 2852620944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

160

0.94

PF22656

At5g48480-like_N

Glyoxalase At5g48480-like, N-terminal domain

45

93

0.87

PF18029

Glyoxalase_6

Glyoxalase-like domain

41

161

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8181 14 136
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.804 15 138
2i7r-assembly1.cif.gz_B conserved domain protein 0.8031 13 137
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8013 13 135
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8009 14 138
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9757 84 150 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9481 84 150 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8753 85 134 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8633 83 138 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.85 83 138 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4V6NEX3-F1-model_v4 deleted 0.9939 7 154
AF-A0A2S9QFE1-F1-model_v4 Glyoxalase 0.9937 6 154
AF-A0A4U0H4P3-F1-model_v4 VOC family protein 0.9926 4 152
AF-C4I1M8-F1-model_v4 deleted 0.9919 4 152
AF-B1N1Z5-F1-model_v4 deleted 0.9919 16 152

Map