F323135

General Info

Members Datasets Scaffolds Average Seq Length
212 144 424 155

Family's Representative Sequence

Representative Sequence 3300041507|Ga0451851_0403661|Ga0451851_0403661_39_578
Length 179
Sequence MVAAMQATDAPDAESHPTRLDDPVDAAIVREVSRDARATLAEISKAVGLSVSAVQTRLRRLETRGVIVGYRAVLDAEAIGRPLSAFIEITPLDPAQPDNAPELLEHLTAIEACHSIAGDASYMLFARVATPRDLEALIRDIRQSASVNTRTTVVLQTFYEHRPIAPADESRASVRAAGG

Samples

Sample ID Description Type Environment
1 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
50 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
51 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
75 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
99 2643221553 Microbacterium sp. Root553 Isolate Unclassified
100 2643221566 Microbacterium sp. Root166 Isolate Unclassified
101 2643221597 Microbacterium sp. Root180 Isolate Unclassified
102 2643221630 Microbacterium sp. Root322 Isolate Unclassified
103 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
104 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
105 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
106 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
107 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
108 2773857759 Microbacterium sp. 1294 Isolate Unclassified
109 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
110 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
111 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
112 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
113 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
114 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
115 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
116 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
117 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
118 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
119 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
120 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
121 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
122 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
123 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
124 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
125 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
126 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
127 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
128 2919069694 Microbacterium sp. 1154 Isolate Unclassified
129 2919395869 Microbacterium resistens 2980 Isolate Unclassified
130 2920879853 Kocuria salina CV6 Isolate Unclassified
131 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
132 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
133 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
134 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
135 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
136 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
137 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
138 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
139 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
140 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
141 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
142 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
143 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
144 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.89
Metatranscriptomes 0.94
Isolates 22.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 7.55
Nodule 0
Rhizoplane 8.49
Rhizosphere 48.58
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451851_0403661 3300041507 Bacteria 631
2 JGI24740J21852_10023315 3300001979 Bacteria 2116
3 JGI25154J39366_1003022 3300002738 Bacteria 3822
4 Ga0006562J51391_1036808 3300003578 Bacteria 6673
5 Ga0070679_100429570 3300005530 Bacteria 1266
6 Ga0068853_101314436 3300005539 Bacteria 699
7 Ga0070665_100853756 3300005548 Bacteria 923
8 Ga0068856_100305027 3300005614 Bacteria 1610
9 Ga0068870_10970221 3300005840 Bacteria 604
10 Ga0075368_10086516 3300006042 Bacteria 1279
11 Ga0075363_100118663 3300006048 Bacteria 1476
12 Ga0075364_10007772 3300006051 Bacteria 6388
13 Ga0075364_10122399 3300006051 Bacteria 1742
14 Ga0075364_10304381 3300006051 Bacteria 1085
15 Ga0075370_10007264 3300006353 Bacteria 5637
16 Ga0105244_10049243 3300009036 Bacteria 2154
17 Ga0105243_11159453 3300009148 Bacteria 784
18 Ga0105237_10115351 3300009545 Bacteria 2679
19 Ga0105238_12315523 3300009551 Bacteria 572
20 Ga0157370_10256018 3300013104 Bacteria 1618
21 Ga0157370_10398007 3300013104 Bacteria 1268
22 Ga0157370_11845923 3300013104 Bacteria 542
23 Ga0157369_11018502 3300013105 Bacteria 848
24 Ga0171462_1001 3300013250 Bacteria 1135406
25 Ga0157374_11833844 3300013296 Bacteria 632
26 Ga0163162_10021945 3300013306 Bacteria 6290
27 Ga0157372_10513964 3300013307 Bacteria 1396
28 Ga0157375_11837118 3300013308 Bacteria 719
29 Ga0163163_10305867 3300014325 Bacteria 1642
30 Ga0163161_10853234 3300017792 Bacteria 769
31 Ga0209646_1000013 3300025246 Bacteria 565830
32 Ga0209646_1000014 3300025246 Bacteria 550484
33 Ga0207655_1038326 3300025728 Bacteria 2096
34 Ga0207671_10067491 3300025914 Bacteria 2663
35 Ga0207657_10321025 3300025919 Bacteria 1224
36 Ga0207709_10020550 3300025935 Bacteria 3727
37 Ga0207639_10393341 3300026041 Bacteria 1247
38 Ga0207702_10412431 3300026078 Bacteria 1305
39 Ga0268266_10311212 3300028379 Bacteria 1472
40 Ga0265760_10089937 3300031090 Bacteria 960
41 Ga0307405_10160698 3300031731 Bacteria 1591
42 Ga0307405_10612462 3300031731 Bacteria 890
43 Ga0307405_11050139 3300031731 Bacteria 698
44 Ga0307413_10443005 3300031824 Bacteria 1029
45 Ga0307410_10046488 3300031852 Bacteria 2896
46 Ga0307406_10000255 3300031901 Bacteria 32311
47 Ga0307406_10001987 3300031901 Bacteria 11179
48 Ga0307406_10080521 3300031901 Bacteria 2163
49 Ga0307406_10138627 3300031901 Bacteria 1718
50 Ga0307406_10567404 3300031901 Bacteria 931
51 Ga0307406_10676681 3300031901 Bacteria 859
52 Ga0307407_11225717 3300031903 Bacteria 587
53 Ga0307412_10044954 3300031911 Bacteria 2884
54 Ga0307409_100339064 3300031995 Bacteria 1414
55 Ga0307414_10028312 3300032004 Bacteria 3632
56 Ga0307414_10128972 3300032004 Bacteria 1960
57 Ga0307414_10328193 3300032004 Bacteria 1305
58 Ga0307414_10616784 3300032004 Bacteria 975
59 Ga0307414_11208618 3300032004 Bacteria 700
60 Ga0395899_0764639 3300037312 Bacteria 600
61 Ga0395900_0049304 3300037418 Bacteria 4338
62 Ga0395900_1077532 3300037418 Bacteria 721
63 Ga0395898_0471088 3300037466 Bacteria 1195
64 Ga0395898_0845365 3300037466 Bacteria 855
65 Ga0395905_0383329 3300037471 Bacteria 1300
66 Ga0395901_0505806 3300038443 Bacteria 1229
67 Ga0436362_1281140 3300039453 Bacteria 837
68 Ga0451807_0150166 3300041486 Bacteria 765
69 Ga0451837_1365824 3300041494 Bacteria 503
70 Ga0451853_1665172 3300041512 Bacteria 1193
71 Ga0451853_2182058 3300041512 Bacteria 1215
72 Ga0451853_3697299 3300041512 Bacteria 664
73 Ga0466972_0099006 3300044658 Bacteria 1380
74 Ga0466965_0119133 3300044683 Bacteria 1362
75 Ga0466968_0020919 3300044735 Bacteria 2645
76 Ga0466970_0000001 3300044765 Bacteria 252791
77 Ga0466970_0016288 3300044765 Bacteria 3830
78 Ga0466970_0183707 3300044765 Bacteria 1161
79 Ga0466970_0267651 3300044765 Bacteria 959
80 Ga0466957_1306358 3300044842 Bacteria 526
81 Ga0466960_0075830 3300044901 Bacteria 1683
82 Ga0466960_0219525 3300044901 Bacteria 1046
83 Ga0466958_0092441 3300045836 Bacteria 1873
84 Ga0466967_0365026 3300045976 Bacteria 1400
85 Ga0466967_0590861 3300045976 Bacteria 1095
86 Ga0495627_000468 3300046453 Bacteria 34839
87 Ga0495620_0162048 3300046515 Bacteria 869
88 Ga0495654_0041816 3300046530 Bacteria 2278
89 Ga0495625_0569648 3300046660 Bacteria 684
90 Ga0495681_0087316 3300047470 Bacteria 1383
91 Ga0496101_0299037 3300048904 Bacteria 1260
92 Ga0496104_0123681 3300048907 Bacteria 2483
93 Ga0496105_0109436 3300048908 Bacteria 2281
94 Ga0496105_0382087 3300048908 Bacteria 1120
95 Ga0496105_0766248 3300048908 Bacteria 736
96 Ga0496107_0018185 3300048910 Bacteria 4947
97 Ga0496109_0631309 3300048912 Bacteria 1008
98 Ga0496109_0794447 3300048912 Unclassified 884
99 Ga0496109_0970418 3300048912 Bacteria 788
100 Ga0496112_0017805 3300048915 Bacteria 6686
101 Ga0496114_0102309 3300048917 Bacteria 2447
102 Ga0496114_0125500 3300048917 Bacteria 2212
103 Ga0496114_0144141 3300048917 Bacteria 2064
104 Ga0496114_0280187 3300048917 Bacteria 1470
105 Ga0496114_0349147 3300048917 Bacteria 1308
106 Ga0496115_0372445 3300048918 Bacteria 1162
107 Ga0496115_0853157 3300048918 Bacteria 705
108 Ga0496117_0000070 3300048920 Bacteria 245027
109 Ga0496117_0002857 3300048920 Bacteria 20992
110 Ga0496118_0010710 3300048921 Bacteria 9041
111 Ga0496118_0056866 3300048921 Bacteria 2937
112 Ga0496119_0007599 3300048922 Bacteria 9724
113 Ga0496119_0008173 3300048922 Bacteria 9261
114 Ga0496119_0014465 3300048922 Bacteria 6173
115 Ga0496119_0038049 3300048922 Bacteria 3114
116 Ga0496119_0279225 3300048922 Bacteria 831
117 Ga0496119_0328382 3300048922 Bacteria 747
118 Ga0496119_0328726 3300048922 Bacteria 746
119 Ga0496119_0472981 3300048922 Bacteria 587
120 Ga0496120_0002811 3300048923 Bacteria 16821
121 Ga0496120_0087794 3300048923 Bacteria 1669
122 Ga0496121_0084050 3300048924 Bacteria 2511
123 Ga0496122_0000814 3300048925 Bacteria 59717
124 Ga0496122_0013256 3300048925 Bacteria 8082
125 Ga0496122_0015894 3300048925 Bacteria 7165
126 Ga0496122_0338525 3300048925 Bacteria 791
127 Ga0496123_0000009 3300048926 Bacteria 509486
128 Ga0496123_0009717 3300048926 Bacteria 8616
129 Ga0496124_0002146 3300048927 Bacteria 26489
130 Ga0496124_0003499 3300048927 Bacteria 19129
131 Ga0496124_0081703 3300048927 Bacteria 2655
132 Ga0496125_0000371 3300048928 Bacteria 84352
133 Ga0496125_0004163 3300048928 Bacteria 16860
134 Ga0496125_0008841 3300048928 Bacteria 10470
135 Ga0496125_0020884 3300048928 Bacteria 6128
136 Ga0496126_0047966 3300048929 Bacteria 3908
137 Ga0496126_0048235 3300048929 Bacteria 3894
138 Ga0496126_0081532 3300048929 Bacteria 2860
139 Ga0496126_0408101 3300048929 Bacteria 1100
140 Ga0501034_0000777 3300049571 Bacteria 47762
141 Ga0501034_0032916 3300049571 Bacteria 5264
142 Ga0501034_0042006 3300049571 Bacteria 4627
143 Ga0501034_0043185 3300049571 Bacteria 4563
144 Ga0501034_0274667 3300049571 Bacteria 1626
145 Ga0501034_0358089 3300049571 Bacteria 1386
146 Ga0501037_0337256 3300049573 Bacteria 1042
147 Ga0501037_0737631 3300049573 Bacteria 653
148 Ga0501038_0117648 3300049574 Bacteria 2195
149 Ga0501039_0130050 3300049575 Bacteria 1976
150 Ga0501039_1296382 3300049575 Bacteria 562
151 Ga0501070_0233810 3300049586 Bacteria 1506
152 Ga0501073_0676478 3300049589 Bacteria 712
153 Ga0501083_0895512 3300049744 Bacteria 577
154 Ga0501044_0536151 3300049823 Bacteria 1069
155 nmdc:mga00v17_240898_c1 3300050491 Bacteria 1173
156 nmdc:mga00v17_368578_c1 3300050491 Bacteria 934
157 nmdc:mga00v17_413205_c1 3300050491 Bacteria 876
158 nmdc:mga00v17_61052_c1 3300050491 Bacteria 2316
159 nmdc:mga0yw44_29133_c1 3300050492 Bacteria 3185
160 nmdc:mga0yw44_614945_c1 3300050492 Bacteria 738
161 nmdc:mga0yw44_839707_c1 3300050492 Bacteria 623
162 nmdc:mga04h51_57745_c1 3300050495 Bacteria 1321
163 nmdc:mga07m45_378131_c1 3300050496 Bacteria 822
164 Ga0500554_037508 3300053102 Bacteria 1470
165 Ga0501082_0053887 3300060353 Bacteria 3467
166 2643732644 2643221542 Bacteria 3563959
167 2643786275 2643221553 Bacteria 3544260
168 2643847726 2643221566 Bacteria 3460379
169 2643994756 2643221597 Bacteria 3347721
170 2644171447 2643221630 Bacteria 3601215
171 2644680972 2643221724 Bacteria 3593515
172 2730230595 2728369380 Bacteria 3620317
173 2747952448 2747842429 Bacteria 3914386
174 2758224914 2757320536 Bacteria 3629334
175 2774378961 2773857758 Bacteria 3592392
176 2774382837 2773857759 Bacteria 2963774
177 2774400836 2773857763 Bacteria 4180068
178 2808628824 2808606306 Bacteria 3608896
179 2808884721 2808606368 Bacteria 3174172
180 2809226193 2808606447 Bacteria 3572005
181 2812322039 2811994872 Bacteria 4121241
182 2833709829 2833709550 Bacteria 4008291
183 2852632451 2852632344 Bacteria 3463163
184 2852647653 2852646457 Bacteria 3408613
185 2852664002 2852663356 Bacteria 4090475
186 2857480689 2857479173 Bacteria 2469263
187 2857633438 2857632687 Bacteria 2448521
188 2857725934 2857723135 Bacteria 4217853
189 2870629340 2870628048 Bacteria 3696012
190 2870803718 2870801768 Bacteria 2710986
191 2870805669 2870804320 Bacteria 2552467
192 2873319581 2873314349 Bacteria 8512634
193 2904510423 2904509784 Bacteria 3520416
194 2906800394 2906799679 Bacteria 4031749
195 2908678359 2908678064 Bacteria 3482747
196 2919070683 2919069694 Bacteria 3622919
197 2919397148 2919395869 Bacteria 3704152
198 2920880547 2920879853 Bacteria 4216831
199 2945968819 2945968032 Bacteria 4111363
200 2946045277 2946041624 Bacteria 4191385
201 2946083970 2946080515 Bacteria 4310960
202 2974294912 2974294766 Bacteria 3767688
203 2974325287 2974324384 Bacteria 3750535
204 2977230256 2977228692 Bacteria 3450105
205 2977239058 2977236895 Bacteria 3569373
206 2977253026 2977251589 Bacteria 2952848
207 2977265452 2977264416 Bacteria 3750737
208 2984543157 2984542743 Bacteria 3569378
209 8004184467 8004182704 Bacteria 3391155
210 8016255243 8016254467 Bacteria 3797036
211 8045832117 8045830549 Bacteria 4444727
212 8055071836 8055066027 Bacteria 9479577
213 Ga0451851_0403661
214 JGI24740J21852_10023315
215 JGI25154J39366_1003022
216 Ga0006562J51391_1036808
217 Ga0070679_100429570
218 Ga0068853_101314436
219 Ga0070665_100853756
220 Ga0068856_100305027
221 Ga0068870_10970221
222 Ga0075368_10086516
223 Ga0075363_100118663
224 Ga0075364_10007772
225 Ga0075364_10122399
226 Ga0075364_10304381
227 Ga0075370_10007264
228 Ga0105244_10049243
229 Ga0105243_11159453
230 Ga0105237_10115351
231 Ga0105238_12315523
232 Ga0157370_10256018
233 Ga0157370_10398007
234 Ga0157370_11845923
235 Ga0157369_11018502
236 Ga0171462_1001
237 Ga0157374_11833844
238 Ga0163162_10021945
239 Ga0157372_10513964
240 Ga0157375_11837118
241 Ga0163163_10305867
242 Ga0163161_10853234
243 Ga0209646_1000013
244 Ga0209646_1000014
245 Ga0207655_1038326
246 Ga0207671_10067491
247 Ga0207657_10321025
248 Ga0207709_10020550
249 Ga0207639_10393341
250 Ga0207702_10412431
251 Ga0268266_10311212
252 Ga0265760_10089937
253 Ga0307405_10160698
254 Ga0307405_10612462
255 Ga0307405_11050139
256 Ga0307413_10443005
257 Ga0307410_10046488
258 Ga0307406_10000255
259 Ga0307406_10001987
260 Ga0307406_10080521
261 Ga0307406_10138627
262 Ga0307406_10567404
263 Ga0307406_10676681
264 Ga0307407_11225717
265 Ga0307412_10044954
266 Ga0307409_100339064
267 Ga0307414_10028312
268 Ga0307414_10128972
269 Ga0307414_10328193
270 Ga0307414_10616784
271 Ga0307414_11208618
272 Ga0395899_0764639
273 Ga0395900_0049304
274 Ga0395900_1077532
275 Ga0395898_0471088
276 Ga0395898_0845365
277 Ga0395905_0383329
278 Ga0395901_0505806
279 Ga0436362_1281140
280 Ga0451807_0150166
281 Ga0451837_1365824
282 Ga0451853_1665172
283 Ga0451853_2182058
284 Ga0451853_3697299
285 Ga0466972_0099006
286 Ga0466965_0119133
287 Ga0466968_0020919
288 Ga0466970_0000001
289 Ga0466970_0016288
290 Ga0466970_0183707
291 Ga0466970_0267651
292 Ga0466957_1306358
293 Ga0466960_0075830
294 Ga0466960_0219525
295 Ga0466958_0092441
296 Ga0466967_0365026
297 Ga0466967_0590861
298 Ga0495627_000468
299 Ga0495620_0162048
300 Ga0495654_0041816
301 Ga0495625_0569648
302 Ga0495681_0087316
303 Ga0496101_0299037
304 Ga0496104_0123681
305 Ga0496105_0109436
306 Ga0496105_0382087
307 Ga0496105_0766248
308 Ga0496107_0018185
309 Ga0496109_0631309
310 Ga0496109_0794447
311 Ga0496109_0970418
312 Ga0496112_0017805
313 Ga0496114_0102309
314 Ga0496114_0125500
315 Ga0496114_0144141
316 Ga0496114_0280187
317 Ga0496114_0349147
318 Ga0496115_0372445
319 Ga0496115_0853157
320 Ga0496117_0000070
321 Ga0496117_0002857
322 Ga0496118_0010710
323 Ga0496118_0056866
324 Ga0496119_0007599
325 Ga0496119_0008173
326 Ga0496119_0014465
327 Ga0496119_0038049
328 Ga0496119_0279225
329 Ga0496119_0328382
330 Ga0496119_0328726
331 Ga0496119_0472981
332 Ga0496120_0002811
333 Ga0496120_0087794
334 Ga0496121_0084050
335 Ga0496122_0000814
336 Ga0496122_0013256
337 Ga0496122_0015894
338 Ga0496122_0338525
339 Ga0496123_0000009
340 Ga0496123_0009717
341 Ga0496124_0002146
342 Ga0496124_0003499
343 Ga0496124_0081703
344 Ga0496125_0000371
345 Ga0496125_0004163
346 Ga0496125_0008841
347 Ga0496125_0020884
348 Ga0496126_0047966
349 Ga0496126_0048235
350 Ga0496126_0081532
351 Ga0496126_0408101
352 Ga0501034_0000777
353 Ga0501034_0032916
354 Ga0501034_0042006
355 Ga0501034_0043185
356 Ga0501034_0274667
357 Ga0501034_0358089
358 Ga0501037_0337256
359 Ga0501037_0737631
360 Ga0501038_0117648
361 Ga0501039_0130050
362 Ga0501039_1296382
363 Ga0501070_0233810
364 Ga0501073_0676478
365 Ga0501083_0895512
366 Ga0501044_0536151
367 nmdc:mga00v17_240898_c1
368 nmdc:mga00v17_368578_c1
369 nmdc:mga00v17_413205_c1
370 nmdc:mga00v17_61052_c1
371 nmdc:mga0yw44_29133_c1
372 nmdc:mga0yw44_614945_c1
373 nmdc:mga0yw44_839707_c1
374 nmdc:mga04h51_57745_c1
375 nmdc:mga07m45_378131_c1
376 Ga0500554_037508
377 Ga0501082_0053887
378 2643732644
379 2643786275
380 2643847726
381 2643994756
382 2644171447
383 2644680972
384 2730230595
385 2747952448
386 2758224914
387 2774378961
388 2774382837
389 2774400836
390 2808628824
391 2808884721
392 2809226193
393 2812322039
394 2833709829
395 2852632451
396 2852647653
397 2852664002
398 2857480689
399 2857633438
400 2857725934
401 2870629340
402 2870803718
403 2870805669
404 2873319581
405 2904510423
406 2906800394
407 2908678359
408 2919070683
409 2919397148
410 2920880547
411 2945968819
412 2946045277
413 2946083970
414 2974294912
415 2974325287
416 2977230256
417 2977239058
418 2977253026
419 2977265452
420 2984543157
421 8004184467
422 8016255243
423 8045832117
424 8055071836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

22

62

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

21

68

0.95

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

87

157

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tgn-assembly1.cif.gz_A crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state 0.9112 5 46
2qww-assembly2.cif.gz_D crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9006 4 46
2fxa-assembly3.cif.gz_D structure of the protease production regulatory protein hpr from bacillus subtilis. 0.899 1 46
3bdd-assembly2.cif.gz_D crystal structure of a putative multiple antibiotic-resistance repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a resolution 0.897 3 46
3i4p-assembly1.cif.gz_A crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens 0.8858 3 139
ID Description Score Start End Superfamily
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9919 55 135 3.30.70.920
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9799 55 135 3.30.70.920
2p6tF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9778 3 54 1.10.10.10
2vbwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9773 3 54 1.10.10.10
2vbwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.977 3 54 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A259SKR6-F1-model_v4 AsnC family transcriptional regulator 0.932 55 152 GO:0005829
GO:0043200
GO:0043565
AF-A0A654TK45-F1-model_v4 AsnC family transcriptional regulator 0.9288 48 147 GO:0005829
GO:0043200
GO:0043565
AF-A0A259SKR6-F1-model_v4 AsnC family transcriptional regulator 0.9226 55 152 GO:0005829
GO:0043200
GO:0043565
AF-A0A654TK45-F1-model_v4 AsnC family transcriptional regulator 0.9112 48 147 GO:0005829
GO:0043200
GO:0043565
AF-A0A2E9V7G9-F1-model_v4 AsnC family transcriptional regulator 0.9087 3 142 GO:0005829
GO:0043200
GO:0043565

Map