F323051

General Info

Members Datasets Scaffolds Average Seq Length
212 141 207 336

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0028910|Ga0373957_0028910_208_1383
Length 391
Sequence MLFYFQATRIGVRAKKFSCADRHRAHITDRLSNAPQTRAGPRTCKIEILYLQSSPMPIINHQFRLAARPMGLPKRSDFNYTEEPVQDPGPGQLLVKVLYVSLDPAMRGWMNEGKSYIAPVGIGDVMRAGAVGRVIASQNPGFAVGDHVVGMFGMQEYALSDGKGITKVDPRLAPLPVYLGTLGMPGLTAYFGLLEVGALKAGDTVVVSGAAGAVGMPVGQIAKIKGARAVGLAGSPEKCQYVVKELGFDACIDYKKEDVKTALRQHCPNGINVYFDNVGGEILDAALAQLARGARVVICGAISQYNSTTGFKGPSNYMSLLVNSARMEGFVVFNYMARYAEALREMAGWRAAGKLKSREDVVAGLETFPETLLKLFTGENFGKLVIKVADN

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
3 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
4 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 1.42
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 5.19
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10009165 3300002075 Bacteria 2236
2 Ga0058863_10141989 3300004799 Bacteria 3689
3 Ga0070683_100108763 3300005329 Bacteria 2615
4 Ga0070683_100239027 3300005329 Bacteria 1727
5 Ga0070670_100045205 3300005331 Bacteria 3785
6 Ga0070680_100001678 3300005336 Bacteria 16212
7 Ga0070680_100070903 3300005336 Bacteria 2863
8 Ga0068868_100119808 3300005338 Bacteria 2146
9 Ga0070714_100006022 3300005435 Bacteria 9313
10 Ga0070713_100039212 3300005436 Bacteria 3843
11 Ga0070713_100123901 3300005436 Bacteria 2270
12 Ga0070713_100184316 3300005436 Bacteria 1877
13 Ga0070711_100032843 3300005439 Bacteria 3453
14 Ga0070711_100101230 3300005439 Bacteria 2096
15 Ga0070700_100096559 3300005441 Bacteria 1939
16 Ga0070678_100171408 3300005456 Bacteria 1768
17 Ga0070681_10011881 3300005458 Bacteria 8634
18 Ga0070681_10075008 3300005458 Bacteria 3343
19 Ga0070681_10097189 3300005458 Bacteria 2892
20 Ga0070707_100197299 3300005468 Bacteria 1962
21 Ga0070679_100001651 3300005530 Bacteria 20100
22 Ga0070679_100002152 3300005530 Bacteria 17765
23 Ga0070679_100019842 3300005530 Bacteria 6545
24 Ga0070679_100095634 3300005530 Bacteria 2958
25 Ga0070684_100063102 3300005535 Bacteria 3247
26 Ga0070684_100194244 3300005535 Bacteria 1848
27 Ga0068853_100159131 3300005539 Bacteria 2037
28 Ga0070695_100016460 3300005545 Bacteria 4476
29 Ga0070693_100107701 3300005547 Bacteria 1709
30 Ga0068855_100242881 3300005563 Bacteria 2011
31 Ga0068856_100024451 3300005614 Bacteria 5881
32 Ga0068852_100224094 3300005616 Bacteria 1789
33 Ga0081455_10157240 3300005937 Bacteria 1746
34 Ga0070717_10074073 3300006028 Bacteria 2846
35 Ga0070717_10086751 3300006028 Bacteria 2635
36 Ga0070717_10215464 3300006028 Bacteria 1686
37 Ga0070717_10307569 3300006028 Bacteria 1410
38 Ga0070715_10126967 3300006163 Bacteria 1223
39 Ga0070712_100016163 3300006175 Bacteria 4817
40 Ga0070712_100033979 3300006175 Bacteria 3454
41 Ga0105240_10078725 3300009093 Bacteria 4058
42 Ga0111539_10054065 3300009094 Bacteria 4778
43 Ga0105245_10003591 3300009098 Bacteria 13841
44 Ga0105241_10430729 3300009174 Bacteria 1163
45 Ga0105238_10133294 3300009551 Bacteria 2463
46 Ga0105238_10147316 3300009551 Bacteria 2330
47 Ga0105249_10160694 3300009553 Bacteria 2171
48 Ga0105239_10053412 3300010375 Bacteria 4433
49 Ga0105246_10059159 3300011119 Bacteria 2657
50 Ga0157370_10000583 3300013104 Bacteria 45511
51 Ga0157369_10078722 3300013105 Bacteria 3531
52 Ga0157369_10157127 3300013105 Bacteria 2401
53 Ga0157374_10286935 3300013296 Bacteria 1626
54 Ga0163162_10000007 3300013306 Bacteria 368084
55 Ga0157379_10115519 3300014968 Bacteria 2413
56 Ga0157376_10179956 3300014969 Bacteria 1932
57 Ga0213872_10073353 3300021361 Bacteria 1541
58 Ga0213871_10000059 3300021441 Bacteria 8713
59 Ga0207647_10028566 3300025904 Bacteria 3620
60 Ga0207685_10022706 3300025905 Bacteria 2125
61 Ga0207699_10099197 3300025906 Bacteria 1844
62 Ga0207699_10187678 3300025906 Bacteria 1393
63 Ga0207699_10208841 3300025906 Bacteria 1327
64 Ga0207707_10010142 3300025912 Bacteria 8175
65 Ga0207707_10191046 3300025912 Bacteria 1786
66 Ga0207707_10199765 3300025912 Bacteria 1743
67 Ga0207695_10283309 3300025913 Bacteria 1551
68 Ga0207693_10022959 3300025915 Bacteria 4954
69 Ga0207663_10000839 3300025916 Bacteria 13934
70 Ga0207663_10049265 3300025916 Bacteria 2612
71 Ga0207660_10002090 3300025917 Bacteria 13239
72 Ga0207660_10062073 3300025917 Bacteria 2691
73 Ga0207652_10008872 3300025921 Bacteria 8101
74 Ga0207652_10008960 3300025921 Bacteria 8064
75 Ga0207652_10342179 3300025921 Bacteria 1350
76 Ga0207681_10043457 3300025923 Bacteria 3008
77 Ga0207694_10017232 3300025924 Bacteria 5458
78 Ga0207694_10120395 3300025924 Bacteria 2095
79 Ga0207650_10381153 3300025925 Bacteria 1164
80 Ga0207687_10009335 3300025927 Bacteria 6414
81 Ga0207700_10016588 3300025928 Bacteria 4898
82 Ga0207700_10038637 3300025928 Bacteria 3466
83 Ga0207700_10130904 3300025928 Bacteria 2048
84 Ga0207700_10324307 3300025928 Bacteria 1335
85 Ga0207664_10095740 3300025929 Bacteria 2443
86 Ga0207664_10135124 3300025929 Bacteria 2080
87 Ga0207665_10188594 3300025939 Bacteria 1497
88 Ga0207661_10006786 3300025944 Bacteria 8109
89 Ga0207661_10168660 3300025944 Bacteria 1904
90 Ga0207667_10100942 3300025949 Bacteria 2977
91 Ga0207658_10153704 3300025986 Bacteria 1878
92 Ga0207639_10177864 3300026041 Bacteria 1807
93 Ga0207702_10136869 3300026078 Bacteria 2211
94 Ga0207674_10086744 3300026116 Bacteria 3124
95 Ga0207683_10208108 3300026121 Bacteria 1779
96 Ga0268265_10190925 3300028380 Bacteria 1769
97 Ga0268265_10419120 3300028380 Bacteria 1243
98 Ga0265760_10004230 3300031090 Bacteria 4130
99 Ga0265760_10010908 3300031090 Bacteria 2596
100 Ga0307513_10116884 3300031456 Bacteria 2645
101 Ga0307509_10166341 3300031507 Bacteria 2093
102 Ga0307507_10018684 3300033179 Bacteria 7864
103 Ga0373936_0010628 3300035113 Bacteria 3475
104 Ga0373945_0016079 3300035116 Bacteria 2520
105 Ga0373956_0008829 3300035119 Bacteria 4084
106 Ga0373957_0028910 3300035120 Bacteria 2022
107 Ga0373946_0004109 3300035171 Bacteria 5185
108 Ga0373924_0006626 3300035410 Bacteria 4154
109 Ga0373935_0003636 3300035692 Bacteria 8990
110 Ga0373927_0009387 3300035695 Bacteria 6562
111 Ga0373927_0009571 3300035695 Bacteria 6499
112 Ga0373947_0061140 3300035725 Bacteria 2288
113 Ga0373937_0000215 3300036401 Bacteria 55874
114 Ga0373937_0054589 3300036401 Bacteria 3667
115 Ga0373937_0195449 3300036401 Bacteria 1901
116 Ga0373937_0276541 3300036401 Bacteria 1585
117 Ga0373925_0007033 3300037068 Bacteria 8219
118 Ga0373925_0014866 3300037068 Bacteria 5626
119 Ga0373925_0029941 3300037068 Bacteria 3993
120 Ga0373925_0177873 3300037068 Bacteria 1682
121 Ga0395899_0000018 3300037312 Bacteria 423194
122 Ga0395900_0095253 3300037418 Bacteria 3059
123 Ga0395900_0099433 3300037418 Bacteria 2988
124 Ga0395900_0270718 3300037418 Bacteria 1693
125 Ga0395898_0001399 3300037466 Bacteria 34417
126 Ga0395898_0069026 3300037466 Bacteria 3420
127 Ga0395898_0070862 3300037466 Bacteria 3369
128 Ga0395898_0081057 3300037466 Bacteria 3130
129 Ga0395898_0220960 3300037466 Bacteria 1807
130 Ga0436364_0406615 3300037853 Bacteria 2869
131 Ga0436364_0789534 3300037853 Bacteria 3906
132 Ga0436360_0559393 3300039438 Bacteria 20330
133 Ga0436361_0705943 3300039447 Bacteria 3393
134 Ga0436361_0848922 3300039447 Bacteria 3991
135 Ga0436363_0878800 3300039450 Bacteria 1667
136 Ga0436363_1376027 3300039450 Bacteria 1280
137 Ga0436363_1455908 3300039450 Bacteria 1818
138 Ga0436362_0595877 3300039453 Bacteria 7757
139 Ga0451845_0206529 3300041501 Bacteria 1073
140 Ga0439446_0014747 3300042156 Bacteria 2161
141 Ga0439434_0037080 3300042435 Bacteria 1492
142 Ga0466969_0070237 3300044656 Bacteria 1685
143 Ga0466972_0000094 3300044658 Bacteria 78156
144 Ga0466972_0001759 3300044658 Bacteria 10621
145 Ga0466972_0005099 3300044658 Bacteria 6581
146 Ga0466965_0007849 3300044683 Bacteria 4921
147 Ga0466961_0011747 3300044693 Bacteria 5596
148 Ga0466963_0000251 3300044694 Bacteria 23541
149 Ga0466963_0124100 3300044694 Bacteria 1779
150 Ga0466964_0024126 3300044706 Bacteria 2368
151 Ga0466964_0035438 3300044706 Bacteria 1995
152 Ga0466971_0005768 3300044719 Bacteria 5385
153 Ga0466968_0015750 3300044735 Bacteria 3002
154 Ga0466970_0035108 3300044765 Bacteria 2657
155 Ga0466957_0014544 3300044842 Bacteria 4583
156 Ga0466957_0056256 3300044842 Bacteria 2405
157 Ga0466960_0000886 3300044901 Bacteria 10573
158 Ga0466960_0007790 3300044901 Bacteria 4367
159 Ga0466960_0134098 3300044901 Bacteria 1310
160 Ga0466959_0152520 3300045049 Bacteria 1628
161 Ga0466959_0250959 3300045049 Bacteria 1220
162 Ga0466958_0129123 3300045836 Bacteria 1586
163 Ga0466958_0167009 3300045836 Bacteria 1392
164 Ga0466967_0000282 3300045976 Bacteria 22536
165 Ga0466967_0107154 3300045976 Bacteria 2563
166 Ga0466967_0266339 3300045976 Bacteria 1640
167 Ga0495603_0161185 3300046455 Bacteria 1301
168 Ga0495629_0060695 3300046459 Bacteria 2642
169 Ga0495638_0013909 3300046460 Bacteria 5458
170 Ga0495651_0090441 3300046462 Bacteria 2296
171 Ga0495651_0169061 3300046462 Bacteria 1559
172 Ga0495650_0000104 3300046471 Bacteria 208976
173 Ga0495639_0053713 3300046475 Bacteria 1836
174 Ga0495594_0026817 3300046499 Bacteria 3102
175 Ga0495594_0121785 3300046499 Bacteria 1475
176 Ga0495628_0084671 3300046516 Bacteria 2460
177 Ga0495630_0056246 3300046517 Bacteria 2948
178 Ga0495587_0050998 3300046536 Bacteria 2448
179 Ga0495588_0049741 3300046674 Bacteria 2156
180 Ga0495623_0019208 3300046679 Bacteria 4418
181 Ga0495623_0079827 3300046679 Bacteria 2026
182 Ga0495658_0048193 3300046683 Bacteria 2402
183 Ga0495624_0185630 3300046690 Bacteria 1266
184 Ga0495589_0029364 3300046794 Bacteria 2772
185 Ga0495604_0001414 3300047317 Bacteria 19678
186 Ga0495604_0060230 3300047317 Bacteria 2908
187 Ga0495604_0092709 3300047317 Bacteria 2237
188 Ga0495636_0004705 3300047318 Bacteria 5353
189 Ga0495602_0189960 3300048088 Bacteria 1576
190 Ga0495602_0259688 3300048088 Bacteria 1289
191 Ga0496102_0043143 3300048905 Bacteria 4089
192 Ga0496102_0125110 3300048905 Bacteria 2403
193 Ga0496103_0115212 3300048906 Bacteria 1709
194 Ga0496104_0022102 3300048907 Bacteria 5846
195 Ga0496104_0241617 3300048907 Bacteria 1718
196 Ga0496105_0007321 3300048908 Bacteria 8526
197 Ga0496110_0050520 3300048913 Bacteria 3651
198 Ga0496112_0002871 3300048915 Bacteria 14006
199 Ga0496112_0174400 3300048915 Bacteria 2115
200 Ga0496112_0352994 3300048915 Bacteria 1413
201 Ga0496113_0050005 3300048916 Bacteria 3114
202 Ga0501033_0012889 3300049570 Bacteria 6377
203 Ga0501076_0465371 3300049592 Bacteria 1041
204 Ga0501257_015063 3300049686 Bacteria 1784
205 Ga0501044_0010696 3300049823 Bacteria 9955
206 Ga0500616_0006475 3300053153 Bacteria 7662
207 Ga0466962_0038668 3300061719 Bacteria 2285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100101230 Ga0070711_1001012302 301
2 3300025928 Ga0207700_10038637 Ga0207700_100386373 301
3 3300013296 Ga0157374_10286935 Ga0157374_102869352 312
4 3300014969 Ga0157376_10179956 Ga0157376_101799562 312
5 3300025916 Ga0207663_10049265 Ga0207663_100492653 312
6 3300025929 Ga0207664_10135124 Ga0207664_101351243 312
7 3300005329 Ga0070683_100108763 Ga0070683_1001087632 313
8 3300005456 Ga0070678_100171408 Ga0070678_1001714082 313
9 3300005535 Ga0070684_100063102 Ga0070684_1000631023 313
10 3300005563 Ga0068855_100242881 Ga0068855_1002428812 313
11 3300025944 Ga0207661_10168660 Ga0207661_101686602 313
12 3300026116 Ga0207674_10086744 Ga0207674_100867442 313
13 3300026121 Ga0207683_10208108 Ga0207683_102081082 313
14 3300045049 Ga0466959_0250959 Ga0466959_0250959_129_1124 313
15 3300005458 Ga0070681_10075008 Ga0070681_100750082 314
16 3300005530 Ga0070679_100019842 Ga0070679_1000198422 314
17 3300026078 Ga0207702_10136869 Ga0207702_101368692 314
18 3300047317 Ga0495604_0092709 Ga0495604_0092709_67_1071 316
19 3300048088 Ga0495602_0259688 Ga0495602_0259688_52_1056 316
20 3300037418 Ga0395900_0270718 Ga0395900_0270718_429_1514 317
21 3300049592 Ga0501076_0465371 Ga0501076_0465371_68_1030 317
22 3300046462 Ga0495651_0169061 Ga0495651_0169061_441_1445 318
23 3300005545 Ga0070695_100016460 Ga0070695_1000164602 322
24 3300037853 Ga0436364_0406615 Ga0436364_0406615_122_1129 322
25 3300009093 Ga0105240_10078725 Ga0105240_100787254 324
26 3300025913 Ga0207695_10283309 Ga0207695_102833092 324
27 3300031090 Ga0265760_10004230 Ga0265760_100042301 325
28 3300037853 Ga0436364_0789534 Ga0436364_0789534_2653_3747 325
29 3300046460 Ga0495638_0013909 Ga0495638_0013909_721_1728 326
30 3300021441 Ga0213871_10000059 Ga0213871_100000594 328
31 3300031090 Ga0265760_10010908 Ga0265760_100109082 328
32 3300033179 Ga0307507_10018684 Ga0307507_100186844 328
33 3300039438 Ga0436360_0559393 Ga0436360_0559393_4392_5486 328
34 3300039447 Ga0436361_0705943 Ga0436361_0705943_1182_2276 328
35 3300039453 Ga0436362_0595877 Ga0436362_0595877_3383_4477 328
36 3300010375 Ga0105239_10053412 Ga0105239_100534123 331
37 3300039450 Ga0436363_1455908 Ga0436363_1455908_212_1228 331
38 3300042156 Ga0439446_0014747 Ga0439446_0014747_43_1038 331
39 3300042435 Ga0439434_0037080 Ga0439434_0037080_264_1259 331
40 3300044658 Ga0466972_0000094 Ga0466972_0000094_61812_62807 331
41 3300044842 Ga0466957_0014544 Ga0466957_0014544_3094_4095 331
42 3300048905 Ga0496102_0125110 Ga0496102_0125110_946_1947 331
43 3300048907 Ga0496104_0022102 Ga0496104_0022102_3099_4100 331
44 3300048915 Ga0496112_0174400 Ga0496112_0174400_985_1986 331
45 iso_pu_bacteria 2808606359 2808848353 331
46 iso_pu_bacteria 2808606375 2808915424 331
47 iso_pu_bacteria 2912715099 2912723267 331
48 iso_pu_bacteria 8056829672 8056830820 331
49 3300005331 Ga0070670_100045205 Ga0070670_1000452052 332
50 3300005435 Ga0070714_100006022 Ga0070714_1000060228 332
51 3300006028 Ga0070717_10086751 Ga0070717_100867512 332
52 3300025925 Ga0207650_10381153 Ga0207650_103811531 332
53 3300044658 Ga0466972_0005099 Ga0466972_0005099_296_1309 332
54 3300044683 Ga0466965_0007849 Ga0466965_0007849_3212_4225 332
55 3300044706 Ga0466964_0024126 Ga0466964_0024126_1070_2083 332
56 3300044706 Ga0466964_0035438 Ga0466964_0035438_868_1881 332
57 3300044735 Ga0466968_0015750 Ga0466968_0015750_1374_2387 332
58 3300049686 Ga0501257_015063 Ga0501257_015063_490_1497 332
59 3300005336 Ga0070680_100070903 Ga0070680_1000709032 333
60 3300005530 Ga0070679_100002152 Ga0070679_10000215210 333
61 3300005530 Ga0070679_100095634 Ga0070679_1000956341 333
62 3300006175 Ga0070712_100033979 Ga0070712_1000339794 333
63 3300009551 Ga0105238_10147316 Ga0105238_101473163 333
64 3300009553 Ga0105249_10160694 Ga0105249_101606942 333
65 3300013306 Ga0163162_10000007 Ga0163162_10000007212 333
66 3300014968 Ga0157379_10115519 Ga0157379_101155193 333
67 3300025906 Ga0207699_10099197 Ga0207699_100991972 333
68 3300025906 Ga0207699_10208841 Ga0207699_102088412 333
69 3300025917 Ga0207660_10062073 Ga0207660_100620732 333
70 3300025921 Ga0207652_10008872 Ga0207652_100088728 333
71 3300025921 Ga0207652_10342179 Ga0207652_103421791 333
72 3300025924 Ga0207694_10017232 Ga0207694_100172326 333
73 3300025986 Ga0207658_10153704 Ga0207658_101537042 333
74 3300028380 Ga0268265_10419120 Ga0268265_104191201 333
75 3300039450 Ga0436363_0878800 Ga0436363_0878800_563_1576 333
76 3300045976 Ga0466967_0107154 Ga0466967_0107154_1431_2450 333
77 3300048915 Ga0496112_0352994 Ga0496112_0352994_324_1331 333
78 3300004799 Ga0058863_10141989 Ga0058863_101419892 334
79 3300005329 Ga0070683_100239027 Ga0070683_1002390272 334
80 3300005336 Ga0070680_100001678 Ga0070680_1000016782 334
81 3300005338 Ga0068868_100119808 Ga0068868_1001198083 334
82 3300005436 Ga0070713_100039212 Ga0070713_1000392123 334
83 3300005436 Ga0070713_100123901 Ga0070713_1001239011 334
84 3300005436 Ga0070713_100184316 Ga0070713_1001843161 334
85 3300005439 Ga0070711_100032843 Ga0070711_1000328432 334
86 3300005458 Ga0070681_10011881 Ga0070681_100118816 334
87 3300005458 Ga0070681_10097189 Ga0070681_100971892 334
88 3300005468 Ga0070707_100197299 Ga0070707_1001972992 334
89 3300005530 Ga0070679_100001651 Ga0070679_10000165120 334
90 3300005535 Ga0070684_100194244 Ga0070684_1001942441 334
91 3300005539 Ga0068853_100159131 Ga0068853_1001591311 334
92 3300005547 Ga0070693_100107701 Ga0070693_1001077011 334
93 3300005614 Ga0068856_100024451 Ga0068856_1000244513 334
94 3300005616 Ga0068852_100224094 Ga0068852_1002240942 334
95 3300006028 Ga0070717_10074073 Ga0070717_100740733 334
96 3300006028 Ga0070717_10215464 Ga0070717_102154642 334
97 3300006028 Ga0070717_10307569 Ga0070717_103075692 334
98 3300006163 Ga0070715_10126967 Ga0070715_101269672 334
99 3300006175 Ga0070712_100016163 Ga0070712_1000161631 334
100 3300009094 Ga0111539_10054065 Ga0111539_100540653 334
101 3300009098 Ga0105245_10003591 Ga0105245_1000359110 334
102 3300009174 Ga0105241_10430729 Ga0105241_104307291 334
103 3300009551 Ga0105238_10133294 Ga0105238_101332942 334
104 3300013104 Ga0157370_10000583 Ga0157370_1000058333 334
105 3300013105 Ga0157369_10078722 Ga0157369_100787223 334
106 3300013105 Ga0157369_10157127 Ga0157369_101571271 334
107 3300021361 Ga0213872_10073353 Ga0213872_100733531 334
108 3300025905 Ga0207685_10022706 Ga0207685_100227062 334
109 3300025906 Ga0207699_10187678 Ga0207699_101876781 334
110 3300025912 Ga0207707_10010142 Ga0207707_100101426 334
111 3300025912 Ga0207707_10191046 Ga0207707_101910462 334
112 3300025912 Ga0207707_10199765 Ga0207707_101997651 334
113 3300025915 Ga0207693_10022959 Ga0207693_100229592 334
114 3300025916 Ga0207663_10000839 Ga0207663_100008398 334
115 3300025917 Ga0207660_10002090 Ga0207660_100020905 334
116 3300025921 Ga0207652_10008960 Ga0207652_100089602 334
117 3300025924 Ga0207694_10120395 Ga0207694_101203952 334
118 3300025927 Ga0207687_10009335 Ga0207687_100093353 334
119 3300025928 Ga0207700_10016588 Ga0207700_100165885 334
120 3300025928 Ga0207700_10130904 Ga0207700_101309042 334
121 3300025928 Ga0207700_10324307 Ga0207700_103243072 334
122 3300025929 Ga0207664_10095740 Ga0207664_100957402 334
123 3300025939 Ga0207665_10188594 Ga0207665_101885941 334
124 3300025944 Ga0207661_10006786 Ga0207661_100067869 334
125 3300025949 Ga0207667_10100942 Ga0207667_101009422 334
126 3300026041 Ga0207639_10177864 Ga0207639_101778642 334
127 3300028380 Ga0268265_10190925 Ga0268265_101909251 334
128 3300031456 Ga0307513_10116884 Ga0307513_101168843 334
129 3300031507 Ga0307509_10166341 Ga0307509_101663411 334
130 3300035113 Ga0373936_0010628 Ga0373936_0010628_478_1488 334
131 3300035116 Ga0373945_0016079 Ga0373945_0016079_1389_2399 334
132 3300035119 Ga0373956_0008829 Ga0373956_0008829_2428_3564 334
133 3300035120 Ga0373957_0028910 Ga0373957_0028910_208_1383 334
134 3300035171 Ga0373946_0004109 Ga0373946_0004109_1366_2418 334
135 3300035410 Ga0373924_0006626 Ga0373924_0006626_650_1660 334
136 3300035692 Ga0373935_0003636 Ga0373935_0003636_1007_2017 334
137 3300035695 Ga0373927_0009387 Ga0373927_0009387_4909_5919 334
138 3300035695 Ga0373927_0009571 Ga0373927_0009571_4922_5974 334
139 3300035725 Ga0373947_0061140 Ga0373947_0061140_500_1552 334
140 3300036401 Ga0373937_0000215 Ga0373937_0000215_11196_12206 334
141 3300036401 Ga0373937_0054589 Ga0373937_0054589_2062_3159 334
142 3300036401 Ga0373937_0195449 Ga0373937_0195449_45_1181 334
143 3300036401 Ga0373937_0276541 Ga0373937_0276541_170_1180 334
144 3300037068 Ga0373925_0007033 Ga0373925_0007033_5142_6239 334
145 3300037068 Ga0373925_0014866 Ga0373925_0014866_4059_5069 334
146 3300037068 Ga0373925_0029941 Ga0373925_0029941_2339_3391 334
147 3300037068 Ga0373925_0177873 Ga0373925_0177873_546_1556 334
148 3300037312 Ga0395899_0000018 Ga0395899_0000018_111899_112903 334
149 3300037466 Ga0395898_0081057 Ga0395898_0081057_355_1362 334
150 3300039447 Ga0436361_0848922 Ga0436361_0848922_507_1511 334
151 3300039450 Ga0436363_1376027 Ga0436363_1376027_57_1082 334
152 3300044656 Ga0466969_0070237 Ga0466969_0070237_226_1230 334
153 3300044694 Ga0466963_0000251 Ga0466963_0000251_3699_4706 334
154 3300044694 Ga0466963_0124100 Ga0466963_0124100_589_1593 334
155 3300044842 Ga0466957_0056256 Ga0466957_0056256_580_1590 334
156 3300045836 Ga0466958_0129123 Ga0466958_0129123_210_1214 334
157 3300045836 Ga0466958_0167009 Ga0466958_0167009_99_1121 334
158 3300045976 Ga0466967_0000282 Ga0466967_0000282_3727_4734 334
159 3300045976 Ga0466967_0266339 Ga0466967_0266339_449_1453 334
160 3300046462 Ga0495651_0090441 Ga0495651_0090441_509_1516 334
161 3300046475 Ga0495639_0053713 Ga0495639_0053713_525_1577 334
162 3300046499 Ga0495594_0026817 Ga0495594_0026817_1839_2936 334
163 3300046516 Ga0495628_0084671 Ga0495628_0084671_1109_2119 334
164 3300046517 Ga0495630_0056246 Ga0495630_0056246_1541_2551 334
165 3300046536 Ga0495587_0050998 Ga0495587_0050998_850_1860 334
166 3300046679 Ga0495623_0019208 Ga0495623_0019208_1382_2392 334
167 3300046683 Ga0495658_0048193 Ga0495658_0048193_930_2027 334
168 3300046690 Ga0495624_0185630 Ga0495624_0185630_238_1248 334
169 3300047317 Ga0495604_0060230 Ga0495604_0060230_1314_2321 334
170 3300048088 Ga0495602_0189960 Ga0495602_0189960_14_1021 334
171 3300048905 Ga0496102_0043143 Ga0496102_0043143_1819_2850 334
172 3300048906 Ga0496103_0115212 Ga0496103_0115212_686_1696 334
173 3300048907 Ga0496104_0241617 Ga0496104_0241617_611_1621 334
174 3300048908 Ga0496105_0007321 Ga0496105_0007321_5262_6272 334
175 3300048913 Ga0496110_0050520 Ga0496110_0050520_983_1993 334
176 3300048915 Ga0496112_0002871 Ga0496112_0002871_12900_13910 334
177 3300048916 Ga0496113_0050005 Ga0496113_0050005_430_1440 334
178 iso_pu_bacteria 2558860112 2558910569 334
179 3300002075 JGI24738J21930_10009165 JGI24738J21930_100091652 335
180 3300005441 Ga0070700_100096559 Ga0070700_1000965592 335
181 3300005937 Ga0081455_10157240 Ga0081455_101572401 335
182 3300011119 Ga0105246_10059159 Ga0105246_100591593 335
183 3300025904 Ga0207647_10028566 Ga0207647_100285662 335
184 3300025923 Ga0207681_10043457 Ga0207681_100434572 335
185 3300037418 Ga0395900_0095253 Ga0395900_0095253_275_1282 335
186 3300037418 Ga0395900_0099433 Ga0395900_0099433_677_1684 335
187 3300037466 Ga0395898_0001399 Ga0395898_0001399_2490_3497 335
188 3300037466 Ga0395898_0069026 Ga0395898_0069026_896_1903 335
189 3300037466 Ga0395898_0070862 Ga0395898_0070862_1641_2648 335
190 3300037466 Ga0395898_0220960 Ga0395898_0220960_10_1017 335
191 3300041501 Ga0451845_0206529 Ga0451845_0206529_37_1044 335
192 3300044658 Ga0466972_0001759 Ga0466972_0001759_2573_3580 335
193 3300044693 Ga0466961_0011747 Ga0466961_0011747_2878_3885 335
194 3300044719 Ga0466971_0005768 Ga0466971_0005768_1008_2015 335
195 3300044765 Ga0466970_0035108 Ga0466970_0035108_1537_2544 335
196 3300044901 Ga0466960_0000886 Ga0466960_0000886_4351_5358 335
197 3300044901 Ga0466960_0007790 Ga0466960_0007790_1565_2572 335
198 3300044901 Ga0466960_0134098 Ga0466960_0134098_253_1260 335
199 3300045049 Ga0466959_0152520 Ga0466959_0152520_28_1044 335
200 3300046455 Ga0495603_0161185 Ga0495603_0161185_70_1077 335
201 3300046459 Ga0495629_0060695 Ga0495629_0060695_1519_2526 335
202 3300046471 Ga0495650_0000104 Ga0495650_0000104_190781_191788 335
203 3300046499 Ga0495594_0121785 Ga0495594_0121785_202_1209 335
204 3300046674 Ga0495588_0049741 Ga0495588_0049741_1033_2040 335
205 3300046679 Ga0495623_0079827 Ga0495623_0079827_509_1516 335
206 3300046794 Ga0495589_0029364 Ga0495589_0029364_88_1095 335
207 3300047317 Ga0495604_0001414 Ga0495604_0001414_846_1853 335
208 3300047318 Ga0495636_0004705 Ga0495636_0004705_2356_3363 335
209 3300049570 Ga0501033_0012889 Ga0501033_0012889_4194_5201 335
210 3300049823 Ga0501044_0010696 Ga0501044_0010696_1392_2399 335
211 3300053153 Ga0500616_0006475 Ga0500616_0006475_806_1813 335
212 3300061719 Ga0466962_0038668 Ga0466962_0038668_994_2001 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

61

168

0.99

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

213

348

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

246

386

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9753 5 333
4b7c-assembly1.cif.gz_B crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9751 3 333
4b7x-assembly1.cif.gz_H crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.975 3 333
4b7c-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9736 3 333
4b7c-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9735 3 333
ID Description Score Start End Superfamily
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9836 126 301 3.40.50.720
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9756 5 125 3.90.180.10
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9726 126 301 3.40.50.720
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9678 10 230 3.40.50.2300
4b7cJ01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9675 3 124 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6L7LYR6-F1-model_v4 deleted 0.9838 159 335
AF-A0A2N1YSZ3-F1-model_v4 deleted 0.9832 1 335
AF-A0A849F2R9-F1-model_v4 NADP-dependent oxidoreductase 0.9811 3 301 GO:0016628
AF-A0A2R5FXQ3-F1-model_v4 Alcohol dehydrogenase 0.9759 74 335 GO:0016628
AF-A0A355V4Y6-F1-model_v4 NADP-dependent oxidoreductase 0.9751 3 92 GO:0016628

Feature Viewer

pLDDT pTM Quality
93.65 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map