F322634
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 130 | 209 | 351 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100268705|Ga0068858_1002687052 |
| Length | 374 |
| Sequence | VTFQSIKNKMEKYQKANPKDFDPMQLNLPPVIFGTSGLGNLFTAIAEEEKLNIVSECVRLSKDKVVFDSAGKYGAGLALETLGKCLKELNVPPENVVISNKLGWLRTDLKTKEPTFEPGVWKNLKYDAVQNISYDGIIDCFEQGNELLGGYIPQMVSVHDPDEYINNAKDHHHAEKLYNDILEAYDALHDLKAQGEVQFIGVGAKDWKIIRRIAKDIQLDWIMIANSMTIKSHPKELLDFIAEMEAKGVYVINSAVFHSGFLVGSNYFDYRPIEKGTSQNDALYQWRDHFFEKCNKFNVMPSEACVQFSLNVPGVKSIALNTTNSARVQSNLGMINTNIPLEFWQELKINDLIELDFASWLSTENRPKKLTEWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 2 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 3 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 98 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 99 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 100 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 101 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 102 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 112 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 113 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 114 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 115 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 116 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 125 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 126 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 127 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 128 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 129 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 130 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10040746 | 3300001990 | Bacteria | 1425 |
| 2 | JGI24744J21845_10003488 | 3300002077 | Bacteria | 3233 |
| 3 | rootH2_10005548 | 3300003320 | Bacteria | 26624 |
| 4 | rootH2_10009880 | 3300003320 | Bacteria | 22399 |
| 5 | rootH2_10032558 | 3300003320 | Bacteria | 26006 |
| 6 | rootH2_10076393 | 3300003320 | Unclassified | 3822 |
| 7 | rootL2_10095770 | 3300003322 | Unclassified | 2879 |
| 8 | rootH1_10090136 | 3300003323 | Bacteria | 4254 |
| 9 | rootH1_10320258 | 3300003323 | Bacteria | 2164 |
| 10 | Ga0065712_10103410 | 3300005290 | Bacteria | 1985 |
| 11 | Ga0070676_10003007 | 3300005328 | Bacteria | 8718 |
| 12 | Ga0070683_100258787 | 3300005329 | Bacteria | 1655 |
| 13 | Ga0068869_100028708 | 3300005334 | Bacteria | 3891 |
| 14 | Ga0068869_100095505 | 3300005334 | Bacteria | 2243 |
| 15 | Ga0068868_100014262 | 3300005338 | Bacteria | 5854 |
| 16 | Ga0070660_100006690 | 3300005339 | Bacteria | 8001 |
| 17 | Ga0070668_100143341 | 3300005347 | Bacteria | 1927 |
| 18 | Ga0070669_100214914 | 3300005353 | Unclassified | 1518 |
| 19 | Ga0070675_100108777 | 3300005354 | Bacteria | 2341 |
| 20 | Ga0070674_100017033 | 3300005356 | Bacteria | 4562 |
| 21 | Ga0070673_100010951 | 3300005364 | Bacteria | 6169 |
| 22 | Ga0070667_100203048 | 3300005367 | Bacteria | 1759 |
| 23 | Ga0070678_100003639 | 3300005456 | Bacteria | 8601 |
| 24 | Ga0070662_100000145 | 3300005457 | Bacteria | 40435 |
| 25 | Ga0068867_100009545 | 3300005459 | Bacteria | 6840 |
| 26 | Ga0068867_100017349 | 3300005459 | Bacteria | 5113 |
| 27 | Ga0070685_10171153 | 3300005466 | Bacteria | 1392 |
| 28 | Ga0070698_100128989 | 3300005471 | Bacteria | 2485 |
| 29 | Ga0070679_100339138 | 3300005530 | Bacteria | 1451 |
| 30 | Ga0070684_100001847 | 3300005535 | Bacteria | 15506 |
| 31 | Ga0068853_100002173 | 3300005539 | Bacteria | 14608 |
| 32 | Ga0068853_100063457 | 3300005539 | Unclassified | 3200 |
| 33 | Ga0068853_100110709 | 3300005539 | Bacteria | 2439 |
| 34 | Ga0068853_100211257 | 3300005539 | Bacteria | 1769 |
| 35 | Ga0070672_100083604 | 3300005543 | Bacteria | 2562 |
| 36 | Ga0068855_100000381 | 3300005563 | Bacteria | 54655 |
| 37 | Ga0068855_100061443 | 3300005563 | Bacteria | 4390 |
| 38 | Ga0068855_100217519 | 3300005563 | Bacteria | 2144 |
| 39 | Ga0068857_100016004 | 3300005577 | Bacteria | 6569 |
| 40 | Ga0068857_100082560 | 3300005577 | Bacteria | 2871 |
| 41 | Ga0068854_100340103 | 3300005578 | Bacteria | 1225 |
| 42 | Ga0068854_100340112 | 3300005578 | Bacteria | 1225 |
| 43 | Ga0068856_100007449 | 3300005614 | Bacteria | 10681 |
| 44 | Ga0068856_100036514 | 3300005614 | Bacteria | 4818 |
| 45 | Ga0068856_100085462 | 3300005614 | Bacteria | 3134 |
| 46 | Ga0068852_100000735 | 3300005616 | Bacteria | 21499 |
| 47 | Ga0068852_100006209 | 3300005616 | Bacteria | 8613 |
| 48 | Ga0068852_100278127 | 3300005616 | Bacteria | 1613 |
| 49 | Ga0068852_100290007 | 3300005616 | Bacteria | 1580 |
| 50 | Ga0068859_100292792 | 3300005617 | Unclassified | 1721 |
| 51 | Ga0068866_10014089 | 3300005718 | Bacteria | 3522 |
| 52 | Ga0068851_10149105 | 3300005834 | Bacteria | 1277 |
| 53 | Ga0068858_100268705 | 3300005842 | Bacteria | 1622 |
| 54 | Ga0068860_100084439 | 3300005843 | Bacteria | 3021 |
| 55 | Ga0068862_100173419 | 3300005844 | Bacteria | 1932 |
| 56 | Ga0097621_100000417 | 3300006237 | Bacteria | 29675 |
| 57 | Ga0097621_100066526 | 3300006237 | Bacteria | 2968 |
| 58 | Ga0068871_100000037 | 3300006358 | Bacteria | 70231 |
| 59 | Ga0068871_100044773 | 3300006358 | Bacteria | 3560 |
| 60 | Ga0068871_100079834 | 3300006358 | Bacteria | 2708 |
| 61 | Ga0068871_100299437 | 3300006358 | Bacteria | 1411 |
| 62 | Ga0068865_100000067 | 3300006881 | Bacteria | 54449 |
| 63 | Ga0068865_100013166 | 3300006881 | Bacteria | 5220 |
| 64 | Ga0097620_100292807 | 3300006931 | Unclassified | 1721 |
| 65 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 66 | Ga0105240_10000452 | 3300009093 | Bacteria | 75496 |
| 67 | Ga0105240_10000658 | 3300009093 | Bacteria | 63681 |
| 68 | Ga0105240_10008740 | 3300009093 | Bacteria | 14440 |
| 69 | Ga0105240_10028323 | 3300009093 | Bacteria | 7319 |
| 70 | Ga0105240_10045413 | 3300009093 | Bacteria | 5573 |
| 71 | Ga0105247_10001487 | 3300009101 | Bacteria | 16818 |
| 72 | Ga0105241_10000251 | 3300009174 | Bacteria | 40576 |
| 73 | Ga0105241_10002828 | 3300009174 | Bacteria | 12965 |
| 74 | Ga0105241_10007486 | 3300009174 | Bacteria | 8036 |
| 75 | Ga0105242_10008998 | 3300009176 | Bacteria | 7670 |
| 76 | Ga0105242_10011442 | 3300009176 | Bacteria | 6823 |
| 77 | Ga0105242_10016898 | 3300009176 | Bacteria | 5679 |
| 78 | Ga0105237_10001623 | 3300009545 | Bacteria | 29201 |
| 79 | Ga0105237_10023090 | 3300009545 | Bacteria | 6377 |
| 80 | Ga0105237_10025317 | 3300009545 | Bacteria | 6070 |
| 81 | Ga0105238_10004030 | 3300009551 | Bacteria | 14574 |
| 82 | Ga0105238_10026791 | 3300009551 | Bacteria | 5876 |
| 83 | Ga0105238_10186746 | 3300009551 | Bacteria | 2049 |
| 84 | Ga0105249_10007385 | 3300009553 | Bacteria | 9587 |
| 85 | Ga0105249_10291987 | 3300009553 | Unclassified | 1632 |
| 86 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 87 | Ga0105239_10001736 | 3300010375 | Bacteria | 28729 |
| 88 | Ga0105239_10004453 | 3300010375 | Bacteria | 16747 |
| 89 | Ga0105239_10005235 | 3300010375 | Bacteria | 15262 |
| 90 | Ga0105239_10057695 | 3300010375 | Bacteria | 4258 |
| 91 | Ga0157373_10008476 | 3300013100 | Bacteria | 7634 |
| 92 | Ga0157373_10104108 | 3300013100 | Bacteria | 1996 |
| 93 | Ga0157371_10002127 | 3300013102 | Bacteria | 19280 |
| 94 | Ga0157371_10023777 | 3300013102 | Unclassified | 4479 |
| 95 | Ga0157371_10134746 | 3300013102 | Bacteria | 1758 |
| 96 | Ga0157370_10007451 | 3300013104 | Bacteria | 11897 |
| 97 | Ga0157370_10202496 | 3300013104 | Bacteria | 1841 |
| 98 | Ga0157370_10252091 | 3300013104 | Bacteria | 1633 |
| 99 | Ga0157374_10000418 | 3300013296 | Bacteria | 38471 |
| 100 | Ga0157374_10045137 | 3300013296 | Bacteria | 4078 |
| 101 | Ga0157378_10016322 | 3300013297 | Bacteria | 6504 |
| 102 | Ga0157378_10039700 | 3300013297 | Bacteria | 4175 |
| 103 | Ga0163162_10000219 | 3300013306 | Bacteria | 52440 |
| 104 | Ga0163162_10116018 | 3300013306 | Bacteria | 2778 |
| 105 | Ga0157372_10000244 | 3300013307 | Bacteria | 60217 |
| 106 | Ga0157372_10005769 | 3300013307 | Bacteria | 13194 |
| 107 | Ga0157372_10010856 | 3300013307 | Bacteria | 9696 |
| 108 | Ga0157372_10071227 | 3300013307 | Bacteria | 3915 |
| 109 | Ga0157372_10087412 | 3300013307 | Bacteria | 3537 |
| 110 | Ga0157372_10185914 | 3300013307 | Bacteria | 2406 |
| 111 | Ga0157372_10356923 | 3300013307 | Bacteria | 1703 |
| 112 | Ga0157375_10029186 | 3300013308 | Bacteria | 5184 |
| 113 | Ga0157375_10029664 | 3300013308 | Bacteria | 5147 |
| 114 | Ga0163163_10142979 | 3300014325 | Bacteria | 2435 |
| 115 | Ga0163163_10211022 | 3300014325 | Bacteria | 1991 |
| 116 | Ga0157380_10010169 | 3300014326 | Bacteria | 6761 |
| 117 | Ga0157380_10108698 | 3300014326 | Bacteria | 2325 |
| 118 | Ga0157377_10003667 | 3300014745 | Bacteria | 6965 |
| 119 | Ga0157379_10064971 | 3300014968 | Bacteria | 3261 |
| 120 | Ga0157376_10012691 | 3300014969 | Bacteria | 6265 |
| 121 | Ga0163161_10070564 | 3300017792 | Bacteria | 2554 |
| 122 | Ga0209233_1014534 | 3300025261 | Bacteria | 2214 |
| 123 | Ga0207642_10019767 | 3300025899 | Bacteria | 2615 |
| 124 | Ga0207710_10000450 | 3300025900 | Bacteria | 26576 |
| 125 | Ga0207647_10000302 | 3300025904 | Bacteria | 40592 |
| 126 | Ga0207647_10101881 | 3300025904 | Bacteria | 1703 |
| 127 | Ga0207645_10000067 | 3300025907 | Bacteria | 75648 |
| 128 | Ga0207654_10001422 | 3300025911 | Bacteria | 12701 |
| 129 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 130 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 131 | Ga0207695_10000060 | 3300025913 | Bacteria | 360217 |
| 132 | Ga0207695_10000567 | 3300025913 | Bacteria | 75760 |
| 133 | Ga0207695_10001921 | 3300025913 | Bacteria | 32318 |
| 134 | Ga0207695_10051329 | 3300025913 | Bacteria | 4332 |
| 135 | Ga0207671_10005528 | 3300025914 | Bacteria | 11618 |
| 136 | Ga0207671_10006718 | 3300025914 | Bacteria | 10188 |
| 137 | Ga0207671_10016091 | 3300025914 | Bacteria | 5828 |
| 138 | Ga0207694_10028919 | 3300025924 | Bacteria | 4226 |
| 139 | Ga0207694_10091617 | 3300025924 | Bacteria | 2399 |
| 140 | Ga0207659_10208466 | 3300025926 | Unclassified | 1565 |
| 141 | Ga0207690_10065066 | 3300025932 | Bacteria | 2492 |
| 142 | Ga0207706_10000538 | 3300025933 | Bacteria | 40240 |
| 143 | Ga0207686_10030090 | 3300025934 | Bacteria | 3211 |
| 144 | Ga0207686_10151160 | 3300025934 | Bacteria | 1616 |
| 145 | Ga0207669_10021129 | 3300025937 | Bacteria | 3429 |
| 146 | Ga0207704_10000056 | 3300025938 | Bacteria | 78848 |
| 147 | Ga0207704_10020617 | 3300025938 | Unclassified | 3492 |
| 148 | Ga0207689_10032253 | 3300025942 | Unclassified | 4358 |
| 149 | Ga0207661_10016075 | 3300025944 | Bacteria | 5516 |
| 150 | Ga0207667_10000084 | 3300025949 | Bacteria | 152086 |
| 151 | Ga0207667_10000748 | 3300025949 | Bacteria | 42218 |
| 152 | Ga0207667_10085750 | 3300025949 | Bacteria | 3260 |
| 153 | Ga0207667_10184073 | 3300025949 | Bacteria | 2145 |
| 154 | Ga0207651_10076766 | 3300025960 | Bacteria | 2389 |
| 155 | Ga0207712_10004062 | 3300025961 | Bacteria | 9240 |
| 156 | Ga0207658_10110182 | 3300025986 | Bacteria | 2175 |
| 157 | Ga0207677_10006837 | 3300026023 | Bacteria | 6265 |
| 158 | Ga0207703_10263738 | 3300026035 | Bacteria | 1558 |
| 159 | Ga0207639_10003557 | 3300026041 | Bacteria | 10468 |
| 160 | Ga0207639_10020074 | 3300026041 | Bacteria | 4779 |
| 161 | Ga0207639_10045398 | 3300026041 | Unclassified | 3309 |
| 162 | Ga0207648_10000738 | 3300026089 | Bacteria | 36673 |
| 163 | Ga0207648_10008518 | 3300026089 | Bacteria | 9926 |
| 164 | Ga0207648_10028992 | 3300026089 | Bacteria | 4907 |
| 165 | Ga0207674_10000903 | 3300026116 | Bacteria | 38688 |
| 166 | Ga0207683_10006675 | 3300026121 | Bacteria | 9873 |
| 167 | Ga0207683_10011911 | 3300026121 | Bacteria | 7421 |
| 168 | Ga0207698_10003469 | 3300026142 | Bacteria | 9497 |
| 169 | Ga0207698_10185468 | 3300026142 | Bacteria | 1848 |
| 170 | Ga0268264_10000117 | 3300028381 | Bacteria | 195037 |
| 171 | Ga0268264_10066864 | 3300028381 | Bacteria | 3032 |
| 172 | Ga0265338_10060460 | 3300028800 | Bacteria | 3329 |
| 173 | Ga0316177_1014853 | 3300030731 | Bacteria | 10366 |
| 174 | Ga0316176_1124655 | 3300030732 | Bacteria | 17437 |
| 175 | Ga0314311_1230028 | 3300030733 | Bacteria | 1661 |
| 176 | Ga0316183_1126685 | 3300030742 | Bacteria | 30833 |
| 177 | Ga0316181_1044003 | 3300030744 | Bacteria | 43033 |
| 178 | Ga0307509_10177521 | 3300031507 | Bacteria | 2000 |
| 179 | Ga0307408_100002469 | 3300031548 | Bacteria | 12967 |
| 180 | Ga0307408_100003271 | 3300031548 | Bacteria | 11144 |
| 181 | Ga0307412_10001558 | 3300031911 | Bacteria | 12638 |
| 182 | Ga0307414_10108542 | 3300032004 | Bacteria | 2106 |
| 183 | Ga0307414_10201800 | 3300032004 | Bacteria | 1618 |
| 184 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 185 | Ga0395899_0000474 | 3300037312 | Bacteria | 45411 |
| 186 | Ga0395900_0000413 | 3300037418 | Bacteria | 61555 |
| 187 | Ga0395898_0002918 | 3300037466 | Bacteria | 19458 |
| 188 | Ga0395905_0000188 | 3300037471 | Bacteria | 98070 |
| 189 | Ga0395901_0002175 | 3300038443 | Bacteria | 20011 |
| 190 | Ga0439436_0001107 | 3300041404 | Bacteria | 7610 |
| 191 | Ga0439431_0006617 | 3300041997 | Bacteria | 2568 |
| 192 | Ga0439442_009729 | 3300042002 | Bacteria | 1945 |
| 193 | Ga0439449_0117075 | 3300042007 | Unclassified | 989 |
| 194 | Ga0439462_0008711 | 3300042015 | Bacteria | 2563 |
| 195 | Ga0450898_007695 | 3300042134 | Bacteria | 1682 |
| 196 | Ga0466964_0042326 | 3300044706 | Bacteria | 1845 |
| 197 | Ga0453684_0233345 | 3300044712 | Unclassified | 2123 |
| 198 | Ga0466968_0047243 | 3300044735 | Bacteria | 1830 |
| 199 | Ga0451576_0549622 | 3300045051 | Bacteria | 1213 |
| 200 | Ga0495606_0008989 | 3300046507 | Bacteria | 8547 |
| 201 | Ga0495611_0000182 | 3300046648 | Bacteria | 44769 |
| 202 | Ga0495686_0001566 | 3300047472 | Bacteria | 24335 |
| 203 | Ga0501217_014392 | 3300049661 | Bacteria | 1787 |
| 204 | Ga0501222_005894 | 3300049662 | Unclassified | 1648 |
| 205 | Ga0501242_000023 | 3300049674 | Bacteria | 10811 |
| 206 | Ga0501253_011670 | 3300049683 | Bacteria | 1356 |
| 207 | Ga0501257_016489 | 3300049686 | Unclassified | 1714 |
| 208 | Ga0501259_000434 | 3300049688 | Bacteria | 6618 |
| 209 | Ga0500608_017015 | 3300053122 | Bacteria | 3296 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042007 | Ga0439449_0117075 | Ga0439449_0117075_35_937 | 300 |
| 2 | 3300009174 | Ga0105241_10007486 | Ga0105241_100074862 | 324 |
| 3 | 3300009545 | Ga0105237_10025317 | Ga0105237_100253172 | 324 |
| 4 | 3300009551 | Ga0105238_10186746 | Ga0105238_101867462 | 324 |
| 5 | 3300013307 | Ga0157372_10087412 | Ga0157372_100874123 | 324 |
| 6 | 3300049683 | Ga0501253_011670 | Ga0501253_011670_30_1004 | 324 |
| 7 | 3300009093 | Ga0105240_10045413 | Ga0105240_100454132 | 331 |
| 8 | 3300009551 | Ga0105238_10026791 | Ga0105238_100267911 | 331 |
| 9 | 3300013100 | Ga0157373_10104108 | Ga0157373_101041081 | 331 |
| 10 | 3300013104 | Ga0157370_10007451 | Ga0157370_100074517 | 331 |
| 11 | 3300013307 | Ga0157372_10005769 | Ga0157372_100057695 | 331 |
| 12 | 3300009553 | Ga0105249_10291987 | Ga0105249_102919872 | 332 |
| 13 | 3300005539 | Ga0068853_100063457 | Ga0068853_1000634572 | 333 |
| 14 | 3300005577 | Ga0068857_100016004 | Ga0068857_1000160043 | 333 |
| 15 | 3300005578 | Ga0068854_100340103 | Ga0068854_1003401031 | 333 |
| 16 | 3300005616 | Ga0068852_100006209 | Ga0068852_1000062094 | 333 |
| 17 | 3300014325 | Ga0163163_10142979 | Ga0163163_101429792 | 333 |
| 18 | 3300025949 | Ga0207667_10000748 | Ga0207667_100007488 | 333 |
| 19 | 3300026041 | Ga0207639_10045398 | Ga0207639_100453982 | 333 |
| 20 | 3300026116 | Ga0207674_10000903 | Ga0207674_100009035 | 333 |
| 21 | 3300026142 | Ga0207698_10003469 | Ga0207698_100034694 | 333 |
| 22 | 3300030731 | Ga0316177_1014853 | Ga0316177_10148537 | 333 |
| 23 | 3300030732 | Ga0316176_1124655 | Ga0316176_112465510 | 333 |
| 24 | 3300030733 | Ga0314311_1230028 | Ga0314311_12300282 | 333 |
| 25 | iso_pu_bacteria | 2895498888 | 2895500133 | 334 |
| 26 | 3300030742 | Ga0316183_1126685 | Ga0316183_11266857 | 335 |
| 27 | 3300030744 | Ga0316181_1044003 | Ga0316181_104400335 | 335 |
| 28 | 3300046507 | Ga0495606_0008989 | Ga0495606_0008989_4498_5505 | 335 |
| 29 | 3300005329 | Ga0070683_100258787 | Ga0070683_1002587872 | 337 |
| 30 | 3300005367 | Ga0070667_100203048 | Ga0070667_1002030482 | 337 |
| 31 | 3300005535 | Ga0070684_100001847 | Ga0070684_1000018477 | 337 |
| 32 | 3300005563 | Ga0068855_100000381 | Ga0068855_10000038119 | 337 |
| 33 | 3300005578 | Ga0068854_100340112 | Ga0068854_1003401121 | 337 |
| 34 | 3300006358 | Ga0068871_100079834 | Ga0068871_1000798343 | 337 |
| 35 | 3300009093 | Ga0105240_10000452 | Ga0105240_1000045221 | 337 |
| 36 | 3300013104 | Ga0157370_10202496 | Ga0157370_102024962 | 337 |
| 37 | 3300013306 | Ga0163162_10116018 | Ga0163162_101160181 | 337 |
| 38 | 3300013307 | Ga0157372_10000244 | Ga0157372_1000024420 | 337 |
| 39 | 3300014968 | Ga0157379_10064971 | Ga0157379_100649712 | 337 |
| 40 | 3300025913 | Ga0207695_10000060 | Ga0207695_10000060214 | 337 |
| 41 | 3300025944 | Ga0207661_10016075 | Ga0207661_100160753 | 337 |
| 42 | 3300025949 | Ga0207667_10000084 | Ga0207667_1000008433 | 337 |
| 43 | 3300025986 | Ga0207658_10110182 | Ga0207658_101101823 | 337 |
| 44 | 3300010375 | Ga0105239_10004453 | Ga0105239_100044534 | 338 |
| 45 | iso_pu_bacteria | 2738543023 | 2739304810 | 338 |
| 46 | 3300005539 | Ga0068853_100002173 | Ga0068853_1000021734 | 339 |
| 47 | 3300005539 | Ga0068853_100211257 | Ga0068853_1002112572 | 339 |
| 48 | 3300005616 | Ga0068852_100278127 | Ga0068852_1002781272 | 339 |
| 49 | 3300005616 | Ga0068852_100290007 | Ga0068852_1002900072 | 339 |
| 50 | 3300005834 | Ga0068851_10149105 | Ga0068851_101491051 | 339 |
| 51 | 3300009093 | Ga0105240_10008740 | Ga0105240_100087405 | 339 |
| 52 | 3300009551 | Ga0105238_10004030 | Ga0105238_100040304 | 339 |
| 53 | 3300010375 | Ga0105239_10005235 | Ga0105239_100052356 | 339 |
| 54 | 3300013307 | Ga0157372_10356923 | Ga0157372_103569232 | 339 |
| 55 | 3300025904 | Ga0207647_10101881 | Ga0207647_101018812 | 339 |
| 56 | 3300025913 | Ga0207695_10000567 | Ga0207695_1000056740 | 339 |
| 57 | 3300025913 | Ga0207695_10051329 | Ga0207695_100513292 | 339 |
| 58 | 3300025914 | Ga0207671_10016091 | Ga0207671_100160913 | 339 |
| 59 | 3300025924 | Ga0207694_10028919 | Ga0207694_100289193 | 339 |
| 60 | 3300025924 | Ga0207694_10091617 | Ga0207694_100916172 | 339 |
| 61 | 3300026041 | Ga0207639_10003557 | Ga0207639_100035573 | 339 |
| 62 | 3300026142 | Ga0207698_10185468 | Ga0207698_101854682 | 339 |
| 63 | 3300044706 | Ga0466964_0042326 | Ga0466964_0042326_99_1127 | 339 |
| 64 | 3300044735 | Ga0466968_0047243 | Ga0466968_0047243_786_1814 | 339 |
| 65 | 3300031548 | Ga0307408_100002469 | Ga0307408_1000024692 | 340 |
| 66 | 3300031548 | Ga0307408_100003271 | Ga0307408_1000032718 | 340 |
| 67 | 3300031911 | Ga0307412_10001558 | Ga0307412_100015589 | 340 |
| 68 | iso_pu_bacteria | 2738541284 | 2738764314 | 340 |
| 69 | 3300005614 | Ga0068856_100036514 | Ga0068856_1000365143 | 341 |
| 70 | 3300003320 | rootH2_10005548 | rootH2_100055483 | 342 |
| 71 | 3300005530 | Ga0070679_100339138 | Ga0070679_1003391381 | 342 |
| 72 | 3300013102 | Ga0157371_10023777 | Ga0157371_100237772 | 342 |
| 73 | 3300032004 | Ga0307414_10108542 | Ga0307414_101085421 | 343 |
| 74 | 3300003320 | rootH2_10009880 | rootH2_100098808 | 344 |
| 75 | 3300005563 | Ga0068855_100217519 | Ga0068855_1002175192 | 344 |
| 76 | 3300006358 | Ga0068871_100299437 | Ga0068871_1002994371 | 344 |
| 77 | 3300009093 | Ga0105240_10000008 | Ga0105240_1000000860 | 344 |
| 78 | 3300009093 | Ga0105240_10000658 | Ga0105240_100006583 | 344 |
| 79 | 3300025913 | Ga0207695_10000021 | Ga0207695_10000021342 | 344 |
| 80 | 3300025913 | Ga0207695_10000043 | Ga0207695_10000043301 | 344 |
| 81 | 3300025949 | Ga0207667_10184073 | Ga0207667_101840732 | 344 |
| 82 | 3300010375 | Ga0105239_10001736 | Ga0105239_1000173616 | 345 |
| 83 | 3300013307 | Ga0157372_10010856 | Ga0157372_100108564 | 345 |
| 84 | 3300005353 | Ga0070669_100214914 | Ga0070669_1002149141 | 346 |
| 85 | 3300005617 | Ga0068859_100292792 | Ga0068859_1002927923 | 346 |
| 86 | 3300006931 | Ga0097620_100292807 | Ga0097620_1002928073 | 346 |
| 87 | 3300009176 | Ga0105242_10016898 | Ga0105242_100168983 | 346 |
| 88 | 3300025934 | Ga0207686_10030090 | Ga0207686_100300903 | 346 |
| 89 | 3300026089 | Ga0207648_10008518 | Ga0207648_100085185 | 346 |
| 90 | 3300047472 | Ga0495686_0001566 | Ga0495686_0001566_3460_4506 | 346 |
| 91 | 3300003320 | rootH2_10076393 | rootH2_100763932 | 347 |
| 92 | 3300013102 | Ga0157371_10002127 | Ga0157371_1000212716 | 348 |
| 93 | 3300013306 | Ga0163162_10000219 | Ga0163162_1000021924 | 349 |
| 94 | 3300028381 | Ga0268264_10000117 | Ga0268264_10000117133 | 349 |
| 95 | 3300003322 | rootL2_10095770 | rootL2_100957704 | 350 |
| 96 | 3300014326 | Ga0157380_10108698 | Ga0157380_101086982 | 351 |
| 97 | 3300046648 | Ga0495611_0000182 | Ga0495611_0000182_16949_18004 | 351 |
| 98 | 3300025261 | Ga0209233_1014534 | Ga0209233_10145342 | 352 |
| 99 | 3300002077 | JGI24744J21845_10003488 | JGI24744J21845_100034881 | 353 |
| 100 | 3300005328 | Ga0070676_10003007 | Ga0070676_100030074 | 353 |
| 101 | 3300005334 | Ga0068869_100095505 | Ga0068869_1000955052 | 353 |
| 102 | 3300005364 | Ga0070673_100010951 | Ga0070673_1000109515 | 353 |
| 103 | 3300005456 | Ga0070678_100003639 | Ga0070678_1000036395 | 353 |
| 104 | 3300005459 | Ga0068867_100009545 | Ga0068867_1000095454 | 353 |
| 105 | 3300005471 | Ga0070698_100128989 | Ga0070698_1001289893 | 353 |
| 106 | 3300005539 | Ga0068853_100110709 | Ga0068853_1001107092 | 353 |
| 107 | 3300005614 | Ga0068856_100085462 | Ga0068856_1000854625 | 353 |
| 108 | 3300005616 | Ga0068852_100000735 | Ga0068852_10000073511 | 353 |
| 109 | 3300006237 | Ga0097621_100000417 | Ga0097621_1000004174 | 353 |
| 110 | 3300006358 | Ga0068871_100000037 | Ga0068871_10000003740 | 353 |
| 111 | 3300006881 | Ga0068865_100000067 | Ga0068865_10000006712 | 353 |
| 112 | 3300009174 | Ga0105241_10002828 | Ga0105241_100028288 | 353 |
| 113 | 3300009176 | Ga0105242_10011442 | Ga0105242_100114425 | 353 |
| 114 | 3300009545 | Ga0105237_10001623 | Ga0105237_100016237 | 353 |
| 115 | 3300010375 | Ga0105239_10057695 | Ga0105239_100576951 | 353 |
| 116 | 3300013296 | Ga0157374_10045137 | Ga0157374_100451372 | 353 |
| 117 | 3300013297 | Ga0157378_10016322 | Ga0157378_100163224 | 353 |
| 118 | 3300013308 | Ga0157375_10029664 | Ga0157375_100296643 | 353 |
| 119 | 3300025907 | Ga0207645_10000067 | Ga0207645_1000006719 | 353 |
| 120 | 3300025914 | Ga0207671_10006718 | Ga0207671_100067186 | 353 |
| 121 | 3300025934 | Ga0207686_10151160 | Ga0207686_101511602 | 353 |
| 122 | 3300025938 | Ga0207704_10000056 | Ga0207704_1000005624 | 353 |
| 123 | 3300025960 | Ga0207651_10076766 | Ga0207651_100767662 | 353 |
| 124 | 3300026041 | Ga0207639_10020074 | Ga0207639_100200742 | 353 |
| 125 | 3300026089 | Ga0207648_10000738 | Ga0207648_100007386 | 353 |
| 126 | 3300026121 | Ga0207683_10011911 | Ga0207683_100119113 | 353 |
| 127 | 3300041404 | Ga0439436_0001107 | Ga0439436_0001107_2629_3693 | 353 |
| 128 | 3300041997 | Ga0439431_0006617 | Ga0439431_0006617_395_1459 | 353 |
| 129 | 3300042002 | Ga0439442_009729 | Ga0439442_009729_74_1180 | 353 |
| 130 | 3300042015 | Ga0439462_0008711 | Ga0439462_0008711_140_1204 | 353 |
| 131 | 3300042134 | Ga0450898_007695 | Ga0450898_007695_130_1194 | 353 |
| 132 | 3300049661 | Ga0501217_014392 | Ga0501217_014392_122_1183 | 353 |
| 133 | 3300005347 | Ga0070668_100143341 | Ga0070668_1001433412 | 355 |
| 134 | 3300005356 | Ga0070674_100017033 | Ga0070674_1000170332 | 355 |
| 135 | 3300005459 | Ga0068867_100017349 | Ga0068867_1000173492 | 355 |
| 136 | 3300005718 | Ga0068866_10014089 | Ga0068866_100140892 | 355 |
| 137 | 3300006881 | Ga0068865_100013166 | Ga0068865_1000131662 | 355 |
| 138 | 3300009176 | Ga0105242_10008998 | Ga0105242_100089983 | 355 |
| 139 | 3300013307 | Ga0157372_10185914 | Ga0157372_101859142 | 355 |
| 140 | 3300025899 | Ga0207642_10019767 | Ga0207642_100197672 | 355 |
| 141 | 3300025937 | Ga0207669_10021129 | Ga0207669_100211292 | 355 |
| 142 | 3300025938 | Ga0207704_10020617 | Ga0207704_100206172 | 355 |
| 143 | 3300025942 | Ga0207689_10032253 | Ga0207689_100322531 | 355 |
| 144 | 3300026089 | Ga0207648_10028992 | Ga0207648_100289922 | 355 |
| 145 | 3300044712 | Ga0453684_0233345 | Ga0453684_0233345_186_1259 | 355 |
| 146 | 3300045051 | Ga0451576_0549622 | Ga0451576_0549622_20_1093 | 355 |
| 147 | 3300049662 | Ga0501222_005894 | Ga0501222_005894_334_1401 | 355 |
| 148 | 3300049674 | Ga0501242_000023 | Ga0501242_000023_4314_5381 | 355 |
| 149 | 3300049686 | Ga0501257_016489 | Ga0501257_016489_346_1413 | 355 |
| 150 | 3300049688 | Ga0501259_000434 | Ga0501259_000434_2028_3095 | 355 |
| 151 | 3300005290 | Ga0065712_10103410 | Ga0065712_101034101 | 356 |
| 152 | 3300005354 | Ga0070675_100108777 | Ga0070675_1001087772 | 356 |
| 153 | 3300005577 | Ga0068857_100082560 | Ga0068857_1000825602 | 356 |
| 154 | 3300013102 | Ga0157371_10134746 | Ga0157371_101347462 | 356 |
| 155 | 3300014326 | Ga0157380_10010169 | Ga0157380_100101692 | 356 |
| 156 | 3300025926 | Ga0207659_10208466 | Ga0207659_102084662 | 356 |
| 157 | 3300032004 | Ga0307414_10201800 | Ga0307414_102018002 | 356 |
| 158 | 3300003320 | rootH2_10032558 | rootH2_1003255820 | 357 |
| 159 | 3300003323 | rootH1_10320258 | rootH1_103202582 | 357 |
| 160 | 3300028800 | Ga0265338_10060460 | Ga0265338_100604602 | 357 |
| 161 | 3300003323 | rootH1_10090136 | rootH1_100901363 | 358 |
| 162 | 3300006237 | Ga0097621_100066526 | Ga0097621_1000665262 | 358 |
| 163 | 3300006358 | Ga0068871_100044773 | Ga0068871_1000447733 | 358 |
| 164 | 3300009545 | Ga0105237_10023090 | Ga0105237_100230902 | 358 |
| 165 | 3300010375 | Ga0105239_10000004 | Ga0105239_10000004260 | 358 |
| 166 | 3300013297 | Ga0157378_10039700 | Ga0157378_100397002 | 358 |
| 167 | 3300013308 | Ga0157375_10029186 | Ga0157375_100291864 | 358 |
| 168 | 3300014969 | Ga0157376_10012691 | Ga0157376_100126912 | 358 |
| 169 | 3300017792 | Ga0163161_10070564 | Ga0163161_100705642 | 358 |
| 170 | 3300025914 | Ga0207671_10005528 | Ga0207671_100055284 | 358 |
| 171 | 3300031507 | Ga0307509_10177521 | Ga0307509_101775212 | 358 |
| 172 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_807694_808782 | 358 |
| 173 | 3300037312 | Ga0395899_0000474 | Ga0395899_0000474_42230_43306 | 358 |
| 174 | 3300037418 | Ga0395900_0000413 | Ga0395900_0000413_42234_43310 | 358 |
| 175 | 3300037466 | Ga0395898_0002918 | Ga0395898_0002918_17589_18665 | 358 |
| 176 | 3300037471 | Ga0395905_0000188 | Ga0395905_0000188_54761_55837 | 358 |
| 177 | 3300038443 | Ga0395901_0002175 | Ga0395901_0002175_18246_19322 | 358 |
| 178 | 3300053122 | Ga0500608_017015 | Ga0500608_017015_1999_3105 | 358 |
| 179 | 3300005334 | Ga0068869_100028708 | Ga0068869_1000287081 | 359 |
| 180 | 3300005466 | Ga0070685_10171153 | Ga0070685_101711531 | 359 |
| 181 | 3300005843 | Ga0068860_100084439 | Ga0068860_1000844393 | 359 |
| 182 | 3300005844 | Ga0068862_100173419 | Ga0068862_1001734191 | 359 |
| 183 | 3300009101 | Ga0105247_10001487 | Ga0105247_100014875 | 359 |
| 184 | 3300009553 | Ga0105249_10007385 | Ga0105249_100073859 | 359 |
| 185 | 3300014325 | Ga0163163_10211022 | Ga0163163_102110223 | 359 |
| 186 | 3300025900 | Ga0207710_10000450 | Ga0207710_1000045010 | 359 |
| 187 | 3300025961 | Ga0207712_10004062 | Ga0207712_100040626 | 359 |
| 188 | 3300028381 | Ga0268264_10066864 | Ga0268264_100668643 | 359 |
| 189 | 3300005614 | Ga0068856_100007449 | Ga0068856_1000074497 | 360 |
| 190 | 3300009093 | Ga0105240_10028323 | Ga0105240_100283235 | 360 |
| 191 | 3300025913 | Ga0207695_10001921 | Ga0207695_1000192112 | 360 |
| 192 | 3300005543 | Ga0070672_100083604 | Ga0070672_1000836042 | 364 |
| 193 | 3300013104 | Ga0157370_10252091 | Ga0157370_102520911 | 364 |
| 194 | 3300026121 | Ga0207683_10006675 | Ga0207683_100066754 | 364 |
| 195 | 3300001990 | JGI24737J22298_10040746 | JGI24737J22298_100407462 | 365 |
| 196 | 3300005338 | Ga0068868_100014262 | Ga0068868_1000142626 | 365 |
| 197 | 3300005339 | Ga0070660_100006690 | Ga0070660_1000066907 | 365 |
| 198 | 3300005457 | Ga0070662_100000145 | Ga0070662_10000014521 | 365 |
| 199 | 3300005563 | Ga0068855_100061443 | Ga0068855_1000614434 | 365 |
| 200 | 3300005842 | Ga0068858_100268705 | Ga0068858_1002687052 | 365 |
| 201 | 3300009174 | Ga0105241_10000251 | Ga0105241_100002516 | 365 |
| 202 | 3300013100 | Ga0157373_10008476 | Ga0157373_100084765 | 365 |
| 203 | 3300013296 | Ga0157374_10000418 | Ga0157374_100004186 | 365 |
| 204 | 3300013307 | Ga0157372_10071227 | Ga0157372_100712275 | 365 |
| 205 | 3300014745 | Ga0157377_10003667 | Ga0157377_100036674 | 365 |
| 206 | 3300025904 | Ga0207647_10000302 | Ga0207647_100003025 | 365 |
| 207 | 3300025911 | Ga0207654_10001422 | Ga0207654_100014225 | 365 |
| 208 | 3300025932 | Ga0207690_10065066 | Ga0207690_100650663 | 365 |
| 209 | 3300025933 | Ga0207706_10000538 | Ga0207706_1000053820 | 365 |
| 210 | 3300025949 | Ga0207667_10085750 | Ga0207667_100857502 | 365 |
| 211 | 3300026023 | Ga0207677_10006837 | Ga0207677_100068376 | 365 |
| 212 | 3300026035 | Ga0207703_10263738 | Ga0207703_102637382 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4exb-assembly1.cif.gz_A | putative aldo-keto reductase from pseudomona aeruginosa | 0.8611 | 13 | 326 |
| 4exb-assembly2.cif.gz_C | putative aldo-keto reductase from pseudomona aeruginosa | 0.8609 | 13 | 326 |
| 4exb-assembly2.cif.gz_F | putative aldo-keto reductase from pseudomona aeruginosa | 0.8532 | 13 | 326 |
| 4exa-assembly2.cif.gz_C | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8499 | 13 | 326 |
| 4exa-assembly1.cif.gz_A | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8439 | 13 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L2J1_1_132_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8984 | 20 | 153 | 3.20.20.100 |
| af_Q9VGF2_1_211_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8482 | 22 | 207 | 3.20.20.100 |
| af_Q2QQV2_1_312_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8353 | 17 | 340 | 3.20.20.100 |
| af_A0A0P0W8U8_11_146_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8347 | 23 | 147 | 3.20.20.100 |
| 4exaF00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8268 | 13 | 326 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A512CEW8-F1-model_v4 | L-fucose dehydrogenase | 0.9894 | 19 | 344 |
GO:0005829
GO:0016491 |
| AF-A0A7X9IAU1-F1-model_v4 | Aldo/keto reductase | 0.9819 | 19 | 153 |
GO:0005829
GO:0016491 |
| AF-A0A561IPB7-F1-model_v4 | deleted | 0.9808 | 17 | 344 |
|
| AF-A0A814ZT49-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9787 | 15 | 258 |
GO:0004467
GO:0005783 GO:0016020 |
| AF-A0A3N5Y7N2-F1-model_v4 | deleted | 0.977 | 17 | 305 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar