F322634

General Info

Members Datasets Scaffolds Average Seq Length
212 130 209 351

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100268705|Ga0068858_1002687052
Length 374
Sequence VTFQSIKNKMEKYQKANPKDFDPMQLNLPPVIFGTSGLGNLFTAIAEEEKLNIVSECVRLSKDKVVFDSAGKYGAGLALETLGKCLKELNVPPENVVISNKLGWLRTDLKTKEPTFEPGVWKNLKYDAVQNISYDGIIDCFEQGNELLGGYIPQMVSVHDPDEYINNAKDHHHAEKLYNDILEAYDALHDLKAQGEVQFIGVGAKDWKIIRRIAKDIQLDWIMIANSMTIKSHPKELLDFIAEMEAKGVYVINSAVFHSGFLVGSNYFDYRPIEKGTSQNDALYQWRDHFFEKCNKFNVMPSEACVQFSLNVPGVKSIALNTTNSARVQSNLGMINTNIPLEFWQELKINDLIELDFASWLSTENRPKKLTEWR

Samples

Sample ID Description Type Environment
1 2738541284 Pedobacter sp. YR016 Isolate Unclassified
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
101 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
126 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
127 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10040746 3300001990 Bacteria 1425
2 JGI24744J21845_10003488 3300002077 Bacteria 3233
3 rootH2_10005548 3300003320 Bacteria 26624
4 rootH2_10009880 3300003320 Bacteria 22399
5 rootH2_10032558 3300003320 Bacteria 26006
6 rootH2_10076393 3300003320 Unclassified 3822
7 rootL2_10095770 3300003322 Unclassified 2879
8 rootH1_10090136 3300003323 Bacteria 4254
9 rootH1_10320258 3300003323 Bacteria 2164
10 Ga0065712_10103410 3300005290 Bacteria 1985
11 Ga0070676_10003007 3300005328 Bacteria 8718
12 Ga0070683_100258787 3300005329 Bacteria 1655
13 Ga0068869_100028708 3300005334 Bacteria 3891
14 Ga0068869_100095505 3300005334 Bacteria 2243
15 Ga0068868_100014262 3300005338 Bacteria 5854
16 Ga0070660_100006690 3300005339 Bacteria 8001
17 Ga0070668_100143341 3300005347 Bacteria 1927
18 Ga0070669_100214914 3300005353 Unclassified 1518
19 Ga0070675_100108777 3300005354 Bacteria 2341
20 Ga0070674_100017033 3300005356 Bacteria 4562
21 Ga0070673_100010951 3300005364 Bacteria 6169
22 Ga0070667_100203048 3300005367 Bacteria 1759
23 Ga0070678_100003639 3300005456 Bacteria 8601
24 Ga0070662_100000145 3300005457 Bacteria 40435
25 Ga0068867_100009545 3300005459 Bacteria 6840
26 Ga0068867_100017349 3300005459 Bacteria 5113
27 Ga0070685_10171153 3300005466 Bacteria 1392
28 Ga0070698_100128989 3300005471 Bacteria 2485
29 Ga0070679_100339138 3300005530 Bacteria 1451
30 Ga0070684_100001847 3300005535 Bacteria 15506
31 Ga0068853_100002173 3300005539 Bacteria 14608
32 Ga0068853_100063457 3300005539 Unclassified 3200
33 Ga0068853_100110709 3300005539 Bacteria 2439
34 Ga0068853_100211257 3300005539 Bacteria 1769
35 Ga0070672_100083604 3300005543 Bacteria 2562
36 Ga0068855_100000381 3300005563 Bacteria 54655
37 Ga0068855_100061443 3300005563 Bacteria 4390
38 Ga0068855_100217519 3300005563 Bacteria 2144
39 Ga0068857_100016004 3300005577 Bacteria 6569
40 Ga0068857_100082560 3300005577 Bacteria 2871
41 Ga0068854_100340103 3300005578 Bacteria 1225
42 Ga0068854_100340112 3300005578 Bacteria 1225
43 Ga0068856_100007449 3300005614 Bacteria 10681
44 Ga0068856_100036514 3300005614 Bacteria 4818
45 Ga0068856_100085462 3300005614 Bacteria 3134
46 Ga0068852_100000735 3300005616 Bacteria 21499
47 Ga0068852_100006209 3300005616 Bacteria 8613
48 Ga0068852_100278127 3300005616 Bacteria 1613
49 Ga0068852_100290007 3300005616 Bacteria 1580
50 Ga0068859_100292792 3300005617 Unclassified 1721
51 Ga0068866_10014089 3300005718 Bacteria 3522
52 Ga0068851_10149105 3300005834 Bacteria 1277
53 Ga0068858_100268705 3300005842 Bacteria 1622
54 Ga0068860_100084439 3300005843 Bacteria 3021
55 Ga0068862_100173419 3300005844 Bacteria 1932
56 Ga0097621_100000417 3300006237 Bacteria 29675
57 Ga0097621_100066526 3300006237 Bacteria 2968
58 Ga0068871_100000037 3300006358 Bacteria 70231
59 Ga0068871_100044773 3300006358 Bacteria 3560
60 Ga0068871_100079834 3300006358 Bacteria 2708
61 Ga0068871_100299437 3300006358 Bacteria 1411
62 Ga0068865_100000067 3300006881 Bacteria 54449
63 Ga0068865_100013166 3300006881 Bacteria 5220
64 Ga0097620_100292807 3300006931 Unclassified 1721
65 Ga0105240_10000008 3300009093 Bacteria 618862
66 Ga0105240_10000452 3300009093 Bacteria 75496
67 Ga0105240_10000658 3300009093 Bacteria 63681
68 Ga0105240_10008740 3300009093 Bacteria 14440
69 Ga0105240_10028323 3300009093 Bacteria 7319
70 Ga0105240_10045413 3300009093 Bacteria 5573
71 Ga0105247_10001487 3300009101 Bacteria 16818
72 Ga0105241_10000251 3300009174 Bacteria 40576
73 Ga0105241_10002828 3300009174 Bacteria 12965
74 Ga0105241_10007486 3300009174 Bacteria 8036
75 Ga0105242_10008998 3300009176 Bacteria 7670
76 Ga0105242_10011442 3300009176 Bacteria 6823
77 Ga0105242_10016898 3300009176 Bacteria 5679
78 Ga0105237_10001623 3300009545 Bacteria 29201
79 Ga0105237_10023090 3300009545 Bacteria 6377
80 Ga0105237_10025317 3300009545 Bacteria 6070
81 Ga0105238_10004030 3300009551 Bacteria 14574
82 Ga0105238_10026791 3300009551 Bacteria 5876
83 Ga0105238_10186746 3300009551 Bacteria 2049
84 Ga0105249_10007385 3300009553 Bacteria 9587
85 Ga0105249_10291987 3300009553 Unclassified 1632
86 Ga0105239_10000004 3300010375 Bacteria 532483
87 Ga0105239_10001736 3300010375 Bacteria 28729
88 Ga0105239_10004453 3300010375 Bacteria 16747
89 Ga0105239_10005235 3300010375 Bacteria 15262
90 Ga0105239_10057695 3300010375 Bacteria 4258
91 Ga0157373_10008476 3300013100 Bacteria 7634
92 Ga0157373_10104108 3300013100 Bacteria 1996
93 Ga0157371_10002127 3300013102 Bacteria 19280
94 Ga0157371_10023777 3300013102 Unclassified 4479
95 Ga0157371_10134746 3300013102 Bacteria 1758
96 Ga0157370_10007451 3300013104 Bacteria 11897
97 Ga0157370_10202496 3300013104 Bacteria 1841
98 Ga0157370_10252091 3300013104 Bacteria 1633
99 Ga0157374_10000418 3300013296 Bacteria 38471
100 Ga0157374_10045137 3300013296 Bacteria 4078
101 Ga0157378_10016322 3300013297 Bacteria 6504
102 Ga0157378_10039700 3300013297 Bacteria 4175
103 Ga0163162_10000219 3300013306 Bacteria 52440
104 Ga0163162_10116018 3300013306 Bacteria 2778
105 Ga0157372_10000244 3300013307 Bacteria 60217
106 Ga0157372_10005769 3300013307 Bacteria 13194
107 Ga0157372_10010856 3300013307 Bacteria 9696
108 Ga0157372_10071227 3300013307 Bacteria 3915
109 Ga0157372_10087412 3300013307 Bacteria 3537
110 Ga0157372_10185914 3300013307 Bacteria 2406
111 Ga0157372_10356923 3300013307 Bacteria 1703
112 Ga0157375_10029186 3300013308 Bacteria 5184
113 Ga0157375_10029664 3300013308 Bacteria 5147
114 Ga0163163_10142979 3300014325 Bacteria 2435
115 Ga0163163_10211022 3300014325 Bacteria 1991
116 Ga0157380_10010169 3300014326 Bacteria 6761
117 Ga0157380_10108698 3300014326 Bacteria 2325
118 Ga0157377_10003667 3300014745 Bacteria 6965
119 Ga0157379_10064971 3300014968 Bacteria 3261
120 Ga0157376_10012691 3300014969 Bacteria 6265
121 Ga0163161_10070564 3300017792 Bacteria 2554
122 Ga0209233_1014534 3300025261 Bacteria 2214
123 Ga0207642_10019767 3300025899 Bacteria 2615
124 Ga0207710_10000450 3300025900 Bacteria 26576
125 Ga0207647_10000302 3300025904 Bacteria 40592
126 Ga0207647_10101881 3300025904 Bacteria 1703
127 Ga0207645_10000067 3300025907 Bacteria 75648
128 Ga0207654_10001422 3300025911 Bacteria 12701
129 Ga0207695_10000021 3300025913 Bacteria 679399
130 Ga0207695_10000043 3300025913 Bacteria 444585
131 Ga0207695_10000060 3300025913 Bacteria 360217
132 Ga0207695_10000567 3300025913 Bacteria 75760
133 Ga0207695_10001921 3300025913 Bacteria 32318
134 Ga0207695_10051329 3300025913 Bacteria 4332
135 Ga0207671_10005528 3300025914 Bacteria 11618
136 Ga0207671_10006718 3300025914 Bacteria 10188
137 Ga0207671_10016091 3300025914 Bacteria 5828
138 Ga0207694_10028919 3300025924 Bacteria 4226
139 Ga0207694_10091617 3300025924 Bacteria 2399
140 Ga0207659_10208466 3300025926 Unclassified 1565
141 Ga0207690_10065066 3300025932 Bacteria 2492
142 Ga0207706_10000538 3300025933 Bacteria 40240
143 Ga0207686_10030090 3300025934 Bacteria 3211
144 Ga0207686_10151160 3300025934 Bacteria 1616
145 Ga0207669_10021129 3300025937 Bacteria 3429
146 Ga0207704_10000056 3300025938 Bacteria 78848
147 Ga0207704_10020617 3300025938 Unclassified 3492
148 Ga0207689_10032253 3300025942 Unclassified 4358
149 Ga0207661_10016075 3300025944 Bacteria 5516
150 Ga0207667_10000084 3300025949 Bacteria 152086
151 Ga0207667_10000748 3300025949 Bacteria 42218
152 Ga0207667_10085750 3300025949 Bacteria 3260
153 Ga0207667_10184073 3300025949 Bacteria 2145
154 Ga0207651_10076766 3300025960 Bacteria 2389
155 Ga0207712_10004062 3300025961 Bacteria 9240
156 Ga0207658_10110182 3300025986 Bacteria 2175
157 Ga0207677_10006837 3300026023 Bacteria 6265
158 Ga0207703_10263738 3300026035 Bacteria 1558
159 Ga0207639_10003557 3300026041 Bacteria 10468
160 Ga0207639_10020074 3300026041 Bacteria 4779
161 Ga0207639_10045398 3300026041 Unclassified 3309
162 Ga0207648_10000738 3300026089 Bacteria 36673
163 Ga0207648_10008518 3300026089 Bacteria 9926
164 Ga0207648_10028992 3300026089 Bacteria 4907
165 Ga0207674_10000903 3300026116 Bacteria 38688
166 Ga0207683_10006675 3300026121 Bacteria 9873
167 Ga0207683_10011911 3300026121 Bacteria 7421
168 Ga0207698_10003469 3300026142 Bacteria 9497
169 Ga0207698_10185468 3300026142 Bacteria 1848
170 Ga0268264_10000117 3300028381 Bacteria 195037
171 Ga0268264_10066864 3300028381 Bacteria 3032
172 Ga0265338_10060460 3300028800 Bacteria 3329
173 Ga0316177_1014853 3300030731 Bacteria 10366
174 Ga0316176_1124655 3300030732 Bacteria 17437
175 Ga0314311_1230028 3300030733 Bacteria 1661
176 Ga0316183_1126685 3300030742 Bacteria 30833
177 Ga0316181_1044003 3300030744 Bacteria 43033
178 Ga0307509_10177521 3300031507 Bacteria 2000
179 Ga0307408_100002469 3300031548 Bacteria 12967
180 Ga0307408_100003271 3300031548 Bacteria 11144
181 Ga0307412_10001558 3300031911 Bacteria 12638
182 Ga0307414_10108542 3300032004 Bacteria 2106
183 Ga0307414_10201800 3300032004 Bacteria 1618
184 Ga0395899_0000001 3300037312 Bacteria 1750322
185 Ga0395899_0000474 3300037312 Bacteria 45411
186 Ga0395900_0000413 3300037418 Bacteria 61555
187 Ga0395898_0002918 3300037466 Bacteria 19458
188 Ga0395905_0000188 3300037471 Bacteria 98070
189 Ga0395901_0002175 3300038443 Bacteria 20011
190 Ga0439436_0001107 3300041404 Bacteria 7610
191 Ga0439431_0006617 3300041997 Bacteria 2568
192 Ga0439442_009729 3300042002 Bacteria 1945
193 Ga0439449_0117075 3300042007 Unclassified 989
194 Ga0439462_0008711 3300042015 Bacteria 2563
195 Ga0450898_007695 3300042134 Bacteria 1682
196 Ga0466964_0042326 3300044706 Bacteria 1845
197 Ga0453684_0233345 3300044712 Unclassified 2123
198 Ga0466968_0047243 3300044735 Bacteria 1830
199 Ga0451576_0549622 3300045051 Bacteria 1213
200 Ga0495606_0008989 3300046507 Bacteria 8547
201 Ga0495611_0000182 3300046648 Bacteria 44769
202 Ga0495686_0001566 3300047472 Bacteria 24335
203 Ga0501217_014392 3300049661 Bacteria 1787
204 Ga0501222_005894 3300049662 Unclassified 1648
205 Ga0501242_000023 3300049674 Bacteria 10811
206 Ga0501253_011670 3300049683 Bacteria 1356
207 Ga0501257_016489 3300049686 Unclassified 1714
208 Ga0501259_000434 3300049688 Bacteria 6618
209 Ga0500608_017015 3300053122 Bacteria 3296

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042007 Ga0439449_0117075 Ga0439449_0117075_35_937 300
2 3300009174 Ga0105241_10007486 Ga0105241_100074862 324
3 3300009545 Ga0105237_10025317 Ga0105237_100253172 324
4 3300009551 Ga0105238_10186746 Ga0105238_101867462 324
5 3300013307 Ga0157372_10087412 Ga0157372_100874123 324
6 3300049683 Ga0501253_011670 Ga0501253_011670_30_1004 324
7 3300009093 Ga0105240_10045413 Ga0105240_100454132 331
8 3300009551 Ga0105238_10026791 Ga0105238_100267911 331
9 3300013100 Ga0157373_10104108 Ga0157373_101041081 331
10 3300013104 Ga0157370_10007451 Ga0157370_100074517 331
11 3300013307 Ga0157372_10005769 Ga0157372_100057695 331
12 3300009553 Ga0105249_10291987 Ga0105249_102919872 332
13 3300005539 Ga0068853_100063457 Ga0068853_1000634572 333
14 3300005577 Ga0068857_100016004 Ga0068857_1000160043 333
15 3300005578 Ga0068854_100340103 Ga0068854_1003401031 333
16 3300005616 Ga0068852_100006209 Ga0068852_1000062094 333
17 3300014325 Ga0163163_10142979 Ga0163163_101429792 333
18 3300025949 Ga0207667_10000748 Ga0207667_100007488 333
19 3300026041 Ga0207639_10045398 Ga0207639_100453982 333
20 3300026116 Ga0207674_10000903 Ga0207674_100009035 333
21 3300026142 Ga0207698_10003469 Ga0207698_100034694 333
22 3300030731 Ga0316177_1014853 Ga0316177_10148537 333
23 3300030732 Ga0316176_1124655 Ga0316176_112465510 333
24 3300030733 Ga0314311_1230028 Ga0314311_12300282 333
25 iso_pu_bacteria 2895498888 2895500133 334
26 3300030742 Ga0316183_1126685 Ga0316183_11266857 335
27 3300030744 Ga0316181_1044003 Ga0316181_104400335 335
28 3300046507 Ga0495606_0008989 Ga0495606_0008989_4498_5505 335
29 3300005329 Ga0070683_100258787 Ga0070683_1002587872 337
30 3300005367 Ga0070667_100203048 Ga0070667_1002030482 337
31 3300005535 Ga0070684_100001847 Ga0070684_1000018477 337
32 3300005563 Ga0068855_100000381 Ga0068855_10000038119 337
33 3300005578 Ga0068854_100340112 Ga0068854_1003401121 337
34 3300006358 Ga0068871_100079834 Ga0068871_1000798343 337
35 3300009093 Ga0105240_10000452 Ga0105240_1000045221 337
36 3300013104 Ga0157370_10202496 Ga0157370_102024962 337
37 3300013306 Ga0163162_10116018 Ga0163162_101160181 337
38 3300013307 Ga0157372_10000244 Ga0157372_1000024420 337
39 3300014968 Ga0157379_10064971 Ga0157379_100649712 337
40 3300025913 Ga0207695_10000060 Ga0207695_10000060214 337
41 3300025944 Ga0207661_10016075 Ga0207661_100160753 337
42 3300025949 Ga0207667_10000084 Ga0207667_1000008433 337
43 3300025986 Ga0207658_10110182 Ga0207658_101101823 337
44 3300010375 Ga0105239_10004453 Ga0105239_100044534 338
45 iso_pu_bacteria 2738543023 2739304810 338
46 3300005539 Ga0068853_100002173 Ga0068853_1000021734 339
47 3300005539 Ga0068853_100211257 Ga0068853_1002112572 339
48 3300005616 Ga0068852_100278127 Ga0068852_1002781272 339
49 3300005616 Ga0068852_100290007 Ga0068852_1002900072 339
50 3300005834 Ga0068851_10149105 Ga0068851_101491051 339
51 3300009093 Ga0105240_10008740 Ga0105240_100087405 339
52 3300009551 Ga0105238_10004030 Ga0105238_100040304 339
53 3300010375 Ga0105239_10005235 Ga0105239_100052356 339
54 3300013307 Ga0157372_10356923 Ga0157372_103569232 339
55 3300025904 Ga0207647_10101881 Ga0207647_101018812 339
56 3300025913 Ga0207695_10000567 Ga0207695_1000056740 339
57 3300025913 Ga0207695_10051329 Ga0207695_100513292 339
58 3300025914 Ga0207671_10016091 Ga0207671_100160913 339
59 3300025924 Ga0207694_10028919 Ga0207694_100289193 339
60 3300025924 Ga0207694_10091617 Ga0207694_100916172 339
61 3300026041 Ga0207639_10003557 Ga0207639_100035573 339
62 3300026142 Ga0207698_10185468 Ga0207698_101854682 339
63 3300044706 Ga0466964_0042326 Ga0466964_0042326_99_1127 339
64 3300044735 Ga0466968_0047243 Ga0466968_0047243_786_1814 339
65 3300031548 Ga0307408_100002469 Ga0307408_1000024692 340
66 3300031548 Ga0307408_100003271 Ga0307408_1000032718 340
67 3300031911 Ga0307412_10001558 Ga0307412_100015589 340
68 iso_pu_bacteria 2738541284 2738764314 340
69 3300005614 Ga0068856_100036514 Ga0068856_1000365143 341
70 3300003320 rootH2_10005548 rootH2_100055483 342
71 3300005530 Ga0070679_100339138 Ga0070679_1003391381 342
72 3300013102 Ga0157371_10023777 Ga0157371_100237772 342
73 3300032004 Ga0307414_10108542 Ga0307414_101085421 343
74 3300003320 rootH2_10009880 rootH2_100098808 344
75 3300005563 Ga0068855_100217519 Ga0068855_1002175192 344
76 3300006358 Ga0068871_100299437 Ga0068871_1002994371 344
77 3300009093 Ga0105240_10000008 Ga0105240_1000000860 344
78 3300009093 Ga0105240_10000658 Ga0105240_100006583 344
79 3300025913 Ga0207695_10000021 Ga0207695_10000021342 344
80 3300025913 Ga0207695_10000043 Ga0207695_10000043301 344
81 3300025949 Ga0207667_10184073 Ga0207667_101840732 344
82 3300010375 Ga0105239_10001736 Ga0105239_1000173616 345
83 3300013307 Ga0157372_10010856 Ga0157372_100108564 345
84 3300005353 Ga0070669_100214914 Ga0070669_1002149141 346
85 3300005617 Ga0068859_100292792 Ga0068859_1002927923 346
86 3300006931 Ga0097620_100292807 Ga0097620_1002928073 346
87 3300009176 Ga0105242_10016898 Ga0105242_100168983 346
88 3300025934 Ga0207686_10030090 Ga0207686_100300903 346
89 3300026089 Ga0207648_10008518 Ga0207648_100085185 346
90 3300047472 Ga0495686_0001566 Ga0495686_0001566_3460_4506 346
91 3300003320 rootH2_10076393 rootH2_100763932 347
92 3300013102 Ga0157371_10002127 Ga0157371_1000212716 348
93 3300013306 Ga0163162_10000219 Ga0163162_1000021924 349
94 3300028381 Ga0268264_10000117 Ga0268264_10000117133 349
95 3300003322 rootL2_10095770 rootL2_100957704 350
96 3300014326 Ga0157380_10108698 Ga0157380_101086982 351
97 3300046648 Ga0495611_0000182 Ga0495611_0000182_16949_18004 351
98 3300025261 Ga0209233_1014534 Ga0209233_10145342 352
99 3300002077 JGI24744J21845_10003488 JGI24744J21845_100034881 353
100 3300005328 Ga0070676_10003007 Ga0070676_100030074 353
101 3300005334 Ga0068869_100095505 Ga0068869_1000955052 353
102 3300005364 Ga0070673_100010951 Ga0070673_1000109515 353
103 3300005456 Ga0070678_100003639 Ga0070678_1000036395 353
104 3300005459 Ga0068867_100009545 Ga0068867_1000095454 353
105 3300005471 Ga0070698_100128989 Ga0070698_1001289893 353
106 3300005539 Ga0068853_100110709 Ga0068853_1001107092 353
107 3300005614 Ga0068856_100085462 Ga0068856_1000854625 353
108 3300005616 Ga0068852_100000735 Ga0068852_10000073511 353
109 3300006237 Ga0097621_100000417 Ga0097621_1000004174 353
110 3300006358 Ga0068871_100000037 Ga0068871_10000003740 353
111 3300006881 Ga0068865_100000067 Ga0068865_10000006712 353
112 3300009174 Ga0105241_10002828 Ga0105241_100028288 353
113 3300009176 Ga0105242_10011442 Ga0105242_100114425 353
114 3300009545 Ga0105237_10001623 Ga0105237_100016237 353
115 3300010375 Ga0105239_10057695 Ga0105239_100576951 353
116 3300013296 Ga0157374_10045137 Ga0157374_100451372 353
117 3300013297 Ga0157378_10016322 Ga0157378_100163224 353
118 3300013308 Ga0157375_10029664 Ga0157375_100296643 353
119 3300025907 Ga0207645_10000067 Ga0207645_1000006719 353
120 3300025914 Ga0207671_10006718 Ga0207671_100067186 353
121 3300025934 Ga0207686_10151160 Ga0207686_101511602 353
122 3300025938 Ga0207704_10000056 Ga0207704_1000005624 353
123 3300025960 Ga0207651_10076766 Ga0207651_100767662 353
124 3300026041 Ga0207639_10020074 Ga0207639_100200742 353
125 3300026089 Ga0207648_10000738 Ga0207648_100007386 353
126 3300026121 Ga0207683_10011911 Ga0207683_100119113 353
127 3300041404 Ga0439436_0001107 Ga0439436_0001107_2629_3693 353
128 3300041997 Ga0439431_0006617 Ga0439431_0006617_395_1459 353
129 3300042002 Ga0439442_009729 Ga0439442_009729_74_1180 353
130 3300042015 Ga0439462_0008711 Ga0439462_0008711_140_1204 353
131 3300042134 Ga0450898_007695 Ga0450898_007695_130_1194 353
132 3300049661 Ga0501217_014392 Ga0501217_014392_122_1183 353
133 3300005347 Ga0070668_100143341 Ga0070668_1001433412 355
134 3300005356 Ga0070674_100017033 Ga0070674_1000170332 355
135 3300005459 Ga0068867_100017349 Ga0068867_1000173492 355
136 3300005718 Ga0068866_10014089 Ga0068866_100140892 355
137 3300006881 Ga0068865_100013166 Ga0068865_1000131662 355
138 3300009176 Ga0105242_10008998 Ga0105242_100089983 355
139 3300013307 Ga0157372_10185914 Ga0157372_101859142 355
140 3300025899 Ga0207642_10019767 Ga0207642_100197672 355
141 3300025937 Ga0207669_10021129 Ga0207669_100211292 355
142 3300025938 Ga0207704_10020617 Ga0207704_100206172 355
143 3300025942 Ga0207689_10032253 Ga0207689_100322531 355
144 3300026089 Ga0207648_10028992 Ga0207648_100289922 355
145 3300044712 Ga0453684_0233345 Ga0453684_0233345_186_1259 355
146 3300045051 Ga0451576_0549622 Ga0451576_0549622_20_1093 355
147 3300049662 Ga0501222_005894 Ga0501222_005894_334_1401 355
148 3300049674 Ga0501242_000023 Ga0501242_000023_4314_5381 355
149 3300049686 Ga0501257_016489 Ga0501257_016489_346_1413 355
150 3300049688 Ga0501259_000434 Ga0501259_000434_2028_3095 355
151 3300005290 Ga0065712_10103410 Ga0065712_101034101 356
152 3300005354 Ga0070675_100108777 Ga0070675_1001087772 356
153 3300005577 Ga0068857_100082560 Ga0068857_1000825602 356
154 3300013102 Ga0157371_10134746 Ga0157371_101347462 356
155 3300014326 Ga0157380_10010169 Ga0157380_100101692 356
156 3300025926 Ga0207659_10208466 Ga0207659_102084662 356
157 3300032004 Ga0307414_10201800 Ga0307414_102018002 356
158 3300003320 rootH2_10032558 rootH2_1003255820 357
159 3300003323 rootH1_10320258 rootH1_103202582 357
160 3300028800 Ga0265338_10060460 Ga0265338_100604602 357
161 3300003323 rootH1_10090136 rootH1_100901363 358
162 3300006237 Ga0097621_100066526 Ga0097621_1000665262 358
163 3300006358 Ga0068871_100044773 Ga0068871_1000447733 358
164 3300009545 Ga0105237_10023090 Ga0105237_100230902 358
165 3300010375 Ga0105239_10000004 Ga0105239_10000004260 358
166 3300013297 Ga0157378_10039700 Ga0157378_100397002 358
167 3300013308 Ga0157375_10029186 Ga0157375_100291864 358
168 3300014969 Ga0157376_10012691 Ga0157376_100126912 358
169 3300017792 Ga0163161_10070564 Ga0163161_100705642 358
170 3300025914 Ga0207671_10005528 Ga0207671_100055284 358
171 3300031507 Ga0307509_10177521 Ga0307509_101775212 358
172 3300037312 Ga0395899_0000001 Ga0395899_0000001_807694_808782 358
173 3300037312 Ga0395899_0000474 Ga0395899_0000474_42230_43306 358
174 3300037418 Ga0395900_0000413 Ga0395900_0000413_42234_43310 358
175 3300037466 Ga0395898_0002918 Ga0395898_0002918_17589_18665 358
176 3300037471 Ga0395905_0000188 Ga0395905_0000188_54761_55837 358
177 3300038443 Ga0395901_0002175 Ga0395901_0002175_18246_19322 358
178 3300053122 Ga0500608_017015 Ga0500608_017015_1999_3105 358
179 3300005334 Ga0068869_100028708 Ga0068869_1000287081 359
180 3300005466 Ga0070685_10171153 Ga0070685_101711531 359
181 3300005843 Ga0068860_100084439 Ga0068860_1000844393 359
182 3300005844 Ga0068862_100173419 Ga0068862_1001734191 359
183 3300009101 Ga0105247_10001487 Ga0105247_100014875 359
184 3300009553 Ga0105249_10007385 Ga0105249_100073859 359
185 3300014325 Ga0163163_10211022 Ga0163163_102110223 359
186 3300025900 Ga0207710_10000450 Ga0207710_1000045010 359
187 3300025961 Ga0207712_10004062 Ga0207712_100040626 359
188 3300028381 Ga0268264_10066864 Ga0268264_100668643 359
189 3300005614 Ga0068856_100007449 Ga0068856_1000074497 360
190 3300009093 Ga0105240_10028323 Ga0105240_100283235 360
191 3300025913 Ga0207695_10001921 Ga0207695_1000192112 360
192 3300005543 Ga0070672_100083604 Ga0070672_1000836042 364
193 3300013104 Ga0157370_10252091 Ga0157370_102520911 364
194 3300026121 Ga0207683_10006675 Ga0207683_100066754 364
195 3300001990 JGI24737J22298_10040746 JGI24737J22298_100407462 365
196 3300005338 Ga0068868_100014262 Ga0068868_1000142626 365
197 3300005339 Ga0070660_100006690 Ga0070660_1000066907 365
198 3300005457 Ga0070662_100000145 Ga0070662_10000014521 365
199 3300005563 Ga0068855_100061443 Ga0068855_1000614434 365
200 3300005842 Ga0068858_100268705 Ga0068858_1002687052 365
201 3300009174 Ga0105241_10000251 Ga0105241_100002516 365
202 3300013100 Ga0157373_10008476 Ga0157373_100084765 365
203 3300013296 Ga0157374_10000418 Ga0157374_100004186 365
204 3300013307 Ga0157372_10071227 Ga0157372_100712275 365
205 3300014745 Ga0157377_10003667 Ga0157377_100036674 365
206 3300025904 Ga0207647_10000302 Ga0207647_100003025 365
207 3300025911 Ga0207654_10001422 Ga0207654_100014225 365
208 3300025932 Ga0207690_10065066 Ga0207690_100650663 365
209 3300025933 Ga0207706_10000538 Ga0207706_1000053820 365
210 3300025949 Ga0207667_10085750 Ga0207667_100857502 365
211 3300026023 Ga0207677_10006837 Ga0207677_100068376 365
212 3300026035 Ga0207703_10263738 Ga0207703_102637382 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

30

351

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8611 13 326
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8609 13 326
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8532 13 326
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8499 13 326
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8439 13 326
ID Description Score Start End Superfamily
af_K7L2J1_1_132_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8984 20 153 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8482 22 207 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8353 17 340 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8347 23 147 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8268 13 326 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A512CEW8-F1-model_v4 L-fucose dehydrogenase 0.9894 19 344 GO:0005829
GO:0016491
AF-A0A7X9IAU1-F1-model_v4 Aldo/keto reductase 0.9819 19 153 GO:0005829
GO:0016491
AF-A0A561IPB7-F1-model_v4 deleted 0.9808 17 344
AF-A0A814ZT49-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9787 15 258 GO:0004467
GO:0005783
GO:0016020
AF-A0A3N5Y7N2-F1-model_v4 deleted 0.977 17 305

Feature Viewer

pLDDT pTM Quality
90.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map