F322144

General Info

Members Datasets Scaffolds Average Seq Length
211 97 211 168

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_223686_c1|nmdc:mga09592_223686_c1_649_1242
Length 197
Sequence VLDRDFSNPKSYIQLLAASQVPRPAKEPPMPNPRKPFRINVGFIIHEEVGYSHEIPFELEKVKIDDLELQNFVGKVDIGRTPQGLVVQGKFEADTKLECVRCLKEFIYPIDWEFTELYAFTRKSVSESELLVPEDAQLDIAPLVREYAILEIPIKPLHDEECKGLCIECGQDLNLKDCGHSQESDDSPFATLKDLLE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1636051 2162886011 Unclassified 1453
2 JGI25406J46586_10014250 3300003203 Bacteria 3386
3 Ga0065704_10165726 3300005289 Bacteria 1324
4 Ga0065715_10561321 3300005293 Unclassified 734
5 Ga0065707_10008985 3300005295 Bacteria 2874
6 Ga0065707_10085469 3300005295 Bacteria 6132
7 Ga0065707_10092170 3300005295 Bacteria 3814
8 Ga0065707_10194748 3300005295 Bacteria 1341
9 Ga0065707_10288499 3300005295 Unclassified 1031
10 Ga0068869_100573734 3300005334 Bacteria 950
11 Ga0070680_100219162 3300005336 Bacteria 1606
12 Ga0070689_100999943 3300005340 Unclassified 744
13 Ga0070687_100198415 3300005343 Bacteria 1214
14 Ga0070688_101201765 3300005365 Bacteria 609
15 Ga0070703_10074298 3300005406 Unclassified 1142
16 Ga0070705_100103403 3300005440 Unclassified 1804
17 Ga0070705_100682495 3300005440 Unclassified 805
18 Ga0070700_100375712 3300005441 Unclassified 1061
19 Ga0070694_100069940 3300005444 Bacteria 2415
20 Ga0070694_100988715 3300005444 Bacteria 698
21 Ga0070662_100956264 3300005457 Unclassified 732
22 Ga0070706_100030656 3300005467 Bacteria 4957
23 Ga0070706_100758195 3300005467 Unclassified 899
24 Ga0070707_100942455 3300005468 Bacteria 828
25 Ga0070707_101028864 3300005468 Unclassified 789
26 Ga0070698_100011867 3300005471 Bacteria 9242
27 Ga0070698_100033554 3300005471 Bacteria 5316
28 Ga0070698_100217145 3300005471 Unclassified 1846
29 Ga0070698_100455597 3300005471 Unclassified 1215
30 Ga0070699_100001393 3300005518 Bacteria 22220
31 Ga0070699_100033989 3300005518 Bacteria 4406
32 Ga0070699_100083063 3300005518 Unclassified 2793
33 Ga0070695_100236876 3300005545 Unclassified 1322
34 Ga0070695_100324291 3300005545 Bacteria 1146
35 Ga0070695_100579361 3300005545 Bacteria 878
36 Ga0070696_100481182 3300005546 Unclassified 984
37 Ga0070696_100992830 3300005546 Unclassified 701
38 Ga0070704_100071580 3300005549 Bacteria 2520
39 Ga0070704_100404499 3300005549 Bacteria 1166
40 Ga0068857_100445418 3300005577 Bacteria 1210
41 Ga0068859_100090344 3300005617 Bacteria 3113
42 Ga0068859_100463149 3300005617 Bacteria 1363
43 Ga0068864_100049602 3300005618 Bacteria 3612
44 Ga0068858_100276323 3300005842 Bacteria 1599
45 Ga0068862_100175535 3300005844 Bacteria 1921
46 Ga0081539_10002751 3300005985 Bacteria 23695
47 Ga0081539_10025017 3300005985 Unclassified 3857
48 Ga0075427_10002905 3300006194 Bacteria 2329
49 Ga0075428_100050497 3300006844 Unclassified 4561
50 Ga0075428_100075783 3300006844 Bacteria 3673
51 Ga0075428_100743323 3300006844 Bacteria 1044
52 Ga0075430_100051752 3300006846 Bacteria 3460
53 Ga0075430_100147697 3300006846 Bacteria 1958
54 Ga0075430_100192713 3300006846 Bacteria 1694
55 Ga0075430_100623460 3300006846 Unclassified 890
56 Ga0075431_100091088 3300006847 Bacteria 3147
57 Ga0075431_100150539 3300006847 Bacteria 2396
58 Ga0075431_100356471 3300006847 Bacteria 1470
59 Ga0075433_10739026 3300006852 Unclassified 861
60 Ga0075429_100002777 3300006880 Bacteria 14800
61 Ga0075429_100012208 3300006880 Bacteria 7447
62 Ga0075429_100029870 3300006880 Bacteria 4733
63 Ga0075429_100073271 3300006880 Unclassified 2983
64 Ga0075429_100134471 3300006880 Bacteria 2164
65 Ga0075429_100302828 3300006880 Bacteria 1399
66 Ga0075429_100326135 3300006880 Unclassified 1344
67 Ga0075429_100834257 3300006880 Unclassified 807
68 Ga0097620_100090348 3300006931 Bacteria 3113
69 Ga0097620_100463139 3300006931 Bacteria 1363
70 Ga0114129_10014438 3300009147 Bacteria 11256
71 Ga0114129_10080981 3300009147 Bacteria 4514
72 Ga0114129_10217522 3300009147 Bacteria 2579
73 Ga0114129_12093867 3300009147 Unclassified 683
74 Ga0105243_10196732 3300009148 Unclassified 1765
75 Ga0105243_10215350 3300009148 Bacteria 1694
76 Ga0105241_10739139 3300009174 Unclassified 901
77 Ga0105242_10116044 3300009176 Bacteria 2290
78 Ga0105249_10138944 3300009553 Bacteria 2327
79 Ga0105249_10538297 3300009553 Bacteria 1217
80 Ga0105249_10923300 3300009553 Unclassified 940
81 Ga0105239_10378680 3300010375 Bacteria 1600
82 Ga0163163_10966688 3300014325 Unclassified 915
83 Ga0163163_11347627 3300014325 Unclassified 775
84 Ga0207653_10105325 3300025885 Unclassified 1002
85 Ga0207684_10340299 3300025910 Bacteria 1292
86 Ga0207684_10650007 3300025910 Unclassified 899
87 Ga0207684_11066571 3300025910 Bacteria 674
88 Ga0207660_10421709 3300025917 Bacteria 1076
89 Ga0207662_10269257 3300025918 Bacteria 1124
90 Ga0207646_11061013 3300025922 Unclassified 714
91 Ga0207709_10153039 3300025935 Unclassified 1600
92 Ga0207709_10710227 3300025935 Unclassified 805
93 Ga0207709_11342670 3300025935 Unclassified 591
94 Ga0207712_10059122 3300025961 Bacteria 2712
95 Ga0207712_10321097 3300025961 Bacteria 1277
96 Ga0207703_10396324 3300026035 Bacteria 1280
97 Ga0207708_10219635 3300026075 Bacteria 1522
98 Ga0207708_10439581 3300026075 Unclassified 1084
99 Ga0207676_10180457 3300026095 Bacteria 1848
100 Ga0207674_10612287 3300026116 Bacteria 1052
101 Ga0207675_100166117 3300026118 Bacteria 2108
102 Ga0207675_100215434 3300026118 Bacteria 1849
103 Ga0209966_1019482 3300027695 Bacteria 1307
104 Ga0268265_10108692 3300028380 Bacteria 2258
105 Ga0268265_10204483 3300028380 Unclassified 1716
106 Ga0268265_10337828 3300028380 Bacteria 1370
107 Ga0268265_10916987 3300028380 Unclassified 861
108 Ga0265326_10159038 3300028558 Unclassified 646
109 Ga0265334_10004441 3300028573 Bacteria 6225
110 Ga0265318_10017485 3300028577 Unclassified 2942
111 Ga0265338_10023381 3300028800 Bacteria 6357
112 Ga0265332_10091381 3300031238 Bacteria 1287
113 Ga0265328_10204812 3300031239 Unclassified 749
114 Ga0265328_10285254 3300031239 Unclassified 636
115 Ga0265320_10031571 3300031240 Unclassified 2719
116 Ga0265340_10007326 3300031247 Bacteria 5994
117 Ga0307408_100039957 3300031548 Bacteria 3320
118 Ga0307405_10542888 3300031731 Unclassified 939
119 Ga0307413_10111228 3300031824 Bacteria 1834
120 Ga0307413_10311323 3300031824 Unclassified 1199
121 Ga0307410_10295694 3300031852 Bacteria 1276
122 Ga0307410_11255798 3300031852 Unclassified 647
123 Ga0307406_10145289 3300031901 Bacteria 1685
124 Ga0307412_10474621 3300031911 Unclassified 1036
125 Ga0307412_10808621 3300031911 Unclassified 814
126 Ga0307416_100191035 3300032002 Bacteria 1931
127 Ga0307416_100582051 3300032002 Unclassified 1197
128 Ga0307411_11764655 3300032005 Unclassified 574
129 Ga0307415_100359030 3300032126 Unclassified 1230
130 Ga0307415_100603430 3300032126 Unclassified 977
131 Ga0373940_0170075 3300035088 Unclassified 704
132 Ga0451577_0005632 3300042876 Bacteria 12727
133 Ga0451577_0010044 3300042876 Bacteria 9069
134 Ga0451577_0013772 3300042876 Bacteria 7558
135 Ga0451577_0062957 3300042876 Unclassified 3308
136 Ga0451577_0074566 3300042876 Unclassified 3026
137 Ga0451577_0258398 3300042876 Bacteria 1577
138 Ga0451577_0460396 3300042876 Unclassified 1155
139 Ga0451577_0637925 3300042876 Bacteria 966
140 Ga0451577_1140142 3300042876 Bacteria 697
141 Ga0453683_0000916 3300044673 Bacteria 28160
142 Ga0453683_0015323 3300044673 Bacteria 4965
143 Ga0453683_0053682 3300044673 Bacteria 2522
144 Ga0453683_0072835 3300044673 Bacteria 2150
145 Ga0453684_0000344 3300044712 Bacteria 192860
146 Ga0453684_0003986 3300044712 Bacteria 32255
147 Ga0453684_0005739 3300044712 Bacteria 24257
148 Ga0453684_0009518 3300044712 Bacteria 16987
149 Ga0453684_0012564 3300044712 Bacteria 13939
150 Ga0453684_0023341 3300044712 Bacteria 9120
151 Ga0453684_0082541 3300044712 Bacteria 4003
152 Ga0453684_0117037 3300044712 Bacteria 3226
153 Ga0453684_0162831 3300044712 Unclassified 2636
154 Ga0453684_0215358 3300044712 Bacteria 2229
155 Ga0453684_0297429 3300044712 Bacteria 1836
156 Ga0453684_0318926 3300044712 Unclassified 1761
157 Ga0453684_0663464 3300044712 Unclassified 1137
158 Ga0453684_0674687 3300044712 Bacteria 1125
159 Ga0453684_0757584 3300044712 Bacteria 1051
160 Ga0453684_0994052 3300044712 Unclassified 893
161 Ga0453684_1088600 3300044712 Bacteria 845
162 Ga0453684_1094230 3300044712 Bacteria 842
163 Ga0453684_1192069 3300044712 Unclassified 800
164 Ga0453684_1668653 3300044712 Unclassified 652
165 Ga0451576_0038717 3300045051 Bacteria 5046
166 Ga0451576_0061475 3300045051 Bacteria 3916
167 Ga0451576_0079161 3300045051 Bacteria 3420
168 Ga0451576_0141700 3300045051 Bacteria 2506
169 Ga0451576_0255378 3300045051 Bacteria 1832
170 Ga0451576_0698120 3300045051 Bacteria 1066
171 Ga0451576_1033634 3300045051 Unclassified 861
172 Ga0501041_0076537 3300049577 Bacteria 2059
173 Ga0501042_0386963 3300049578 Bacteria 1013
174 Ga0501071_0129010 3300049587 Unclassified 1878
175 Ga0501072_0061997 3300049588 Bacteria 2950
176 Ga0501072_0259005 3300049588 Unclassified 1385
177 Ga0501073_0176034 3300049589 Bacteria 1481
178 Ga0501075_1096113 3300049591 Unclassified 605
179 Ga0501076_0123657 3300049592 Unclassified 2095
180 Ga0501076_0140087 3300049592 Bacteria 1965
181 Ga0501076_0285296 3300049592 Unclassified 1353
182 Ga0501076_0508243 3300049592 Unclassified 993
183 Ga0501202_095664 3300049652 Unclassified 716
184 Ga0501080_1250565 3300049742 Unclassified 637
185 Ga0501081_0028256 3300049743 Unclassified 3784
186 Ga0501081_0667314 3300049743 Unclassified 780
187 nmdc:mga05p37_1028279_c1 3300050507 Bacteria 872
188 nmdc:mga05p37_177098_c1 3300050507 Unclassified 2597
189 nmdc:mga05p37_247266_c1 3300050507 Bacteria 2141
190 nmdc:mga05p37_79886_c1 3300050507 Bacteria 4027
191 nmdc:mga05p37_8598_c1 3300050507 Bacteria 12072
192 nmdc:mga09592_133576_c1 3300050508 Bacteria 2137
193 nmdc:mga09592_146072_c1 3300050508 Unclassified 2039
194 nmdc:mga09592_223686_c1 3300050508 Unclassified 1630
195 nmdc:mga09592_276417_c1 3300050508 Unclassified 1457
196 nmdc:mga09592_73609_c1 3300050508 Unclassified 2903
197 nmdc:mga09592_88562_c1 3300050508 Bacteria 2644
198 nmdc:mga0qj67_771038_c1 3300050509 Unclassified 762
199 nmdc:mga0qj67_832070_c1 3300050509 Bacteria 730
200 nmdc:mga0qj67_912404_c1 3300050509 Bacteria 692
201 nmdc:mga06r32_240245_c1 3300050510 Bacteria 1799
202 nmdc:mga06r32_286254_c1 3300050510 Bacteria 1635
203 nmdc:mga08y16_1358842_c1 3300050511 Unclassified 675
204 nmdc:mga0n895_1085739_c1 3300050512 Bacteria 778
205 nmdc:mga0n895_450627_c1 3300050512 Bacteria 1299
206 nmdc:mga0a205_200639_c1 3300050515 Bacteria 1885
207 Ga0501084_0089046 3300054114 Bacteria 2591
208 Ga0501084_0153941 3300054114 Unclassified 1939
209 Ga0501084_0988903 3300054114 Unclassified 707
210 Ga0501082_0502075 3300060353 Bacteria 1060
211 Ga0501082_0634352 3300060353 Unclassified 935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0285296 Ga0501076_0285296_159_668 160
2 3300003203 JGI25406J46586_10014250 JGI25406J46586_100142502 167
3 3300005295 Ga0065707_10092170 Ga0065707_100921702 167
4 3300005295 Ga0065707_10194748 Ga0065707_101947482 167
5 3300005295 Ga0065707_10288499 Ga0065707_102884991 167
6 3300005336 Ga0070680_100219162 Ga0070680_1002191621 167
7 3300005440 Ga0070705_100103403 Ga0070705_1001034033 167
8 3300005441 Ga0070700_100375712 Ga0070700_1003757122 167
9 3300005444 Ga0070694_100069940 Ga0070694_1000699403 167
10 3300005457 Ga0070662_100956264 Ga0070662_1009562641 167
11 3300005467 Ga0070706_100030656 Ga0070706_1000306562 167
12 3300005467 Ga0070706_100758195 Ga0070706_1007581952 167
13 3300005471 Ga0070698_100011867 Ga0070698_1000118675 167
14 3300005471 Ga0070698_100217145 Ga0070698_1002171452 167
15 3300005518 Ga0070699_100001393 Ga0070699_10000139327 167
16 3300005518 Ga0070699_100033989 Ga0070699_1000339894 167
17 3300005518 Ga0070699_100083063 Ga0070699_1000830632 167
18 3300005545 Ga0070695_100236876 Ga0070695_1002368762 167
19 3300005545 Ga0070695_100324291 Ga0070695_1003242912 167
20 3300005546 Ga0070696_100481182 Ga0070696_1004811821 167
21 3300005546 Ga0070696_100992830 Ga0070696_1009928301 167
22 3300005549 Ga0070704_100071580 Ga0070704_1000715802 167
23 3300005617 Ga0068859_100463149 Ga0068859_1004631492 167
24 3300005844 Ga0068862_100175535 Ga0068862_1001755352 167
25 3300005985 Ga0081539_10002751 Ga0081539_100027513 167
26 3300006194 Ga0075427_10002905 Ga0075427_100029052 167
27 3300006844 Ga0075428_100050497 Ga0075428_1000504974 167
28 3300006846 Ga0075430_100623460 Ga0075430_1006234602 167
29 3300006847 Ga0075431_100091088 Ga0075431_1000910883 167
30 3300006880 Ga0075429_100302828 Ga0075429_1003028282 167
31 3300006880 Ga0075429_100834257 Ga0075429_1008342571 167
32 3300006931 Ga0097620_100463139 Ga0097620_1004631391 167
33 3300009147 Ga0114129_12093867 Ga0114129_120938672 167
34 3300009148 Ga0105243_10196732 Ga0105243_101967322 167
35 3300009176 Ga0105242_10116044 Ga0105242_101160443 167
36 3300009553 Ga0105249_10138944 Ga0105249_101389442 167
37 3300009553 Ga0105249_10923300 Ga0105249_109233002 167
38 3300014325 Ga0163163_10966688 Ga0163163_109666882 167
39 3300014325 Ga0163163_11347627 Ga0163163_113476271 167
40 3300025910 Ga0207684_10340299 Ga0207684_103402992 167
41 3300025910 Ga0207684_10650007 Ga0207684_106500071 167
42 3300025917 Ga0207660_10421709 Ga0207660_104217092 167
43 3300025922 Ga0207646_11061013 Ga0207646_110610131 167
44 3300025935 Ga0207709_10153039 Ga0207709_101530392 167
45 3300025935 Ga0207709_10710227 Ga0207709_107102271 167
46 3300025961 Ga0207712_10059122 Ga0207712_100591223 167
47 3300026075 Ga0207708_10219635 Ga0207708_102196351 167
48 3300026075 Ga0207708_10439581 Ga0207708_104395812 167
49 3300026118 Ga0207675_100215434 Ga0207675_1002154342 167
50 3300027695 Ga0209966_1019482 Ga0209966_10194822 167
51 3300028380 Ga0268265_10108692 Ga0268265_101086922 167
52 3300028380 Ga0268265_10204483 Ga0268265_102044832 167
53 3300028380 Ga0268265_10916987 Ga0268265_109169872 167
54 3300031239 Ga0265328_10285254 Ga0265328_102852541 167
55 3300031548 Ga0307408_100039957 Ga0307408_1000399573 167
56 3300031824 Ga0307413_10111228 Ga0307413_101112282 167
57 3300031824 Ga0307413_10311323 Ga0307413_103113231 167
58 3300031852 Ga0307410_10295694 Ga0307410_102956942 167
59 3300031901 Ga0307406_10145289 Ga0307406_101452892 167
60 3300031911 Ga0307412_10808621 Ga0307412_108086212 167
61 3300032002 Ga0307416_100191035 Ga0307416_1001910353 167
62 3300032005 Ga0307411_11764655 Ga0307411_117646551 167
63 3300042876 Ga0451577_0005632 Ga0451577_0005632_12142_12648 167
64 3300042876 Ga0451577_0010044 Ga0451577_0010044_8126_8632 167
65 3300042876 Ga0451577_0013772 Ga0451577_0013772_2825_3328 167
66 3300042876 Ga0451577_0074566 Ga0451577_0074566_111_626 167
67 3300042876 Ga0451577_0258398 Ga0451577_0258398_773_1279 167
68 3300042876 Ga0451577_0460396 Ga0451577_0460396_338_844 167
69 3300044673 Ga0453683_0000916 Ga0453683_0000916_15669_16175 167
70 3300044673 Ga0453683_0015323 Ga0453683_0015323_2203_2709 167
71 3300044673 Ga0453683_0053682 Ga0453683_0053682_1068_1574 167
72 3300044673 Ga0453683_0072835 Ga0453683_0072835_42_548 167
73 3300044712 Ga0453684_0000344 Ga0453684_0000344_66202_66708 167
74 3300044712 Ga0453684_0009518 Ga0453684_0009518_16428_16934 167
75 3300044712 Ga0453684_0012564 Ga0453684_0012564_74_580 167
76 3300044712 Ga0453684_0082541 Ga0453684_0082541_127_630 167
77 3300044712 Ga0453684_0117037 Ga0453684_0117037_2512_3018 167
78 3300044712 Ga0453684_0215358 Ga0453684_0215358_1066_1572 167
79 3300044712 Ga0453684_0297429 Ga0453684_0297429_214_720 167
80 3300044712 Ga0453684_0663464 Ga0453684_0663464_165_671 167
81 3300044712 Ga0453684_0674687 Ga0453684_0674687_140_643 167
82 3300044712 Ga0453684_1088600 Ga0453684_1088600_153_668 167
83 3300044712 Ga0453684_1094230 Ga0453684_1094230_269_772 167
84 3300044712 Ga0453684_1192069 Ga0453684_1192069_72_578 167
85 3300045051 Ga0451576_0038717 Ga0451576_0038717_2927_3433 167
86 3300045051 Ga0451576_0061475 Ga0451576_0061475_135_638 167
87 3300045051 Ga0451576_0079161 Ga0451576_0079161_2812_3318 167
88 3300045051 Ga0451576_0141700 Ga0451576_0141700_107_613 167
89 3300045051 Ga0451576_0255378 Ga0451576_0255378_772_1278 167
90 3300045051 Ga0451576_1033634 Ga0451576_1033634_16_519 167
91 3300049578 Ga0501042_0386963 Ga0501042_0386963_285_788 167
92 3300049587 Ga0501071_0129010 Ga0501071_0129010_873_1376 167
93 3300049588 Ga0501072_0061997 Ga0501072_0061997_2363_2866 167
94 3300049592 Ga0501076_0123657 Ga0501076_0123657_127_630 167
95 3300049652 Ga0501202_095664 Ga0501202_095664_136_639 167
96 3300049743 Ga0501081_0028256 Ga0501081_0028256_800_1303 167
97 3300050508 nmdc:mga09592_73609_c1 nmdc:mga09592_73609_c1_1710_2213 167
98 3300050509 nmdc:mga0qj67_771038_c1 nmdc:mga0qj67_771038_c1_182_685 167
99 3300050509 nmdc:mga0qj67_912404_c1 nmdc:mga0qj67_912404_c1_175_678 167
100 3300050510 nmdc:mga06r32_286254_c1 nmdc:mga06r32_286254_c1_483_986 167
101 3300050511 nmdc:mga08y16_1358842_c1 nmdc:mga08y16_1358842_c1_142_645 167
102 3300054114 Ga0501084_0153941 Ga0501084_0153941_784_1287 167
103 3300005440 Ga0070705_100682495 Ga0070705_1006824951 168
104 3300005444 Ga0070694_100988715 Ga0070694_1009887151 168
105 3300005468 Ga0070707_101028864 Ga0070707_1010288642 168
106 3300005471 Ga0070698_100455597 Ga0070698_1004555971 168
107 3300005549 Ga0070704_100404499 Ga0070704_1004044992 168
108 3300005985 Ga0081539_10025017 Ga0081539_100250172 168
109 3300006844 Ga0075428_100075783 Ga0075428_1000757833 168
110 3300006846 Ga0075430_100192713 Ga0075430_1001927132 168
111 3300006847 Ga0075431_100356471 Ga0075431_1003564712 168
112 3300006880 Ga0075429_100012208 Ga0075429_1000122085 168
113 3300006880 Ga0075429_100029870 Ga0075429_1000298702 168
114 3300006880 Ga0075429_100073271 Ga0075429_1000732713 168
115 3300006880 Ga0075429_100326135 Ga0075429_1003261352 168
116 3300009147 Ga0114129_10080981 Ga0114129_100809813 168
117 3300028558 Ga0265326_10159038 Ga0265326_101590382 168
118 3300028573 Ga0265334_10004441 Ga0265334_100044415 168
119 3300028577 Ga0265318_10017485 Ga0265318_100174853 168
120 3300028800 Ga0265338_10023381 Ga0265338_100233816 168
121 3300031238 Ga0265332_10091381 Ga0265332_100913812 168
122 3300031239 Ga0265328_10204812 Ga0265328_102048122 168
123 3300031240 Ga0265320_10031571 Ga0265320_100315712 168
124 3300031247 Ga0265340_10007326 Ga0265340_100073262 168
125 3300031731 Ga0307405_10542888 Ga0307405_105428882 168
126 3300031911 Ga0307412_10474621 Ga0307412_104746212 168
127 3300042876 Ga0451577_0637925 Ga0451577_0637925_202_711 168
128 3300042876 Ga0451577_1140142 Ga0451577_1140142_16_525 168
129 3300044712 Ga0453684_0005739 Ga0453684_0005739_13341_13850 168
130 3300044712 Ga0453684_0023341 Ga0453684_0023341_3877_4386 168
131 3300044712 Ga0453684_0162831 Ga0453684_0162831_482_991 168
132 3300044712 Ga0453684_0318926 Ga0453684_0318926_851_1360 168
133 3300044712 Ga0453684_0757584 Ga0453684_0757584_37_543 168
134 3300044712 Ga0453684_0994052 Ga0453684_0994052_264_770 168
135 3300049589 Ga0501073_0176034 Ga0501073_0176034_709_1218 168
136 3300050507 nmdc:mga05p37_79886_c1 nmdc:mga05p37_79886_c1_3333_3839 168
137 3300050507 nmdc:mga05p37_8598_c1 nmdc:mga05p37_8598_c1_4220_4726 168
138 3300050508 nmdc:mga09592_146072_c1 nmdc:mga09592_146072_c1_655_1161 168
139 3300050508 nmdc:mga09592_223686_c1 nmdc:mga09592_223686_c1_649_1242 168
140 3300050508 nmdc:mga09592_276417_c1 nmdc:mga09592_276417_c1_280_786 168
141 3300050508 nmdc:mga09592_88562_c1 nmdc:mga09592_88562_c1_1116_1622 168
142 3300050509 nmdc:mga0qj67_832070_c1 nmdc:mga0qj67_832070_c1_211_717 168
143 3300050510 nmdc:mga06r32_240245_c1 nmdc:mga06r32_240245_c1_437_943 168
144 2162886011 MRS1b_contig_1636051 MRS1b_0687.00001590 169
145 3300005289 Ga0065704_10165726 Ga0065704_101657262 169
146 3300005293 Ga0065715_10561321 Ga0065715_105613211 169
147 3300005295 Ga0065707_10008985 Ga0065707_100089852 169
148 3300005295 Ga0065707_10085469 Ga0065707_100854693 169
149 3300005334 Ga0068869_100573734 Ga0068869_1005737342 169
150 3300005340 Ga0070689_100999943 Ga0070689_1009999432 169
151 3300005343 Ga0070687_100198415 Ga0070687_1001984152 169
152 3300005365 Ga0070688_101201765 Ga0070688_1012017651 169
153 3300005406 Ga0070703_10074298 Ga0070703_100742981 169
154 3300005468 Ga0070707_100942455 Ga0070707_1009424551 169
155 3300005471 Ga0070698_100033554 Ga0070698_1000335545 169
156 3300005545 Ga0070695_100579361 Ga0070695_1005793611 169
157 3300005577 Ga0068857_100445418 Ga0068857_1004454182 169
158 3300005617 Ga0068859_100090344 Ga0068859_1000903443 169
159 3300005618 Ga0068864_100049602 Ga0068864_1000496023 169
160 3300005842 Ga0068858_100276323 Ga0068858_1002763232 169
161 3300006844 Ga0075428_100743323 Ga0075428_1007433232 169
162 3300006846 Ga0075430_100051752 Ga0075430_1000517523 169
163 3300006846 Ga0075430_100147697 Ga0075430_1001476971 169
164 3300006847 Ga0075431_100150539 Ga0075431_1001505392 169
165 3300006852 Ga0075433_10739026 Ga0075433_107390262 169
166 3300006880 Ga0075429_100002777 Ga0075429_1000027773 169
167 3300006880 Ga0075429_100134471 Ga0075429_1001344713 169
168 3300006931 Ga0097620_100090348 Ga0097620_1000903483 169
169 3300009147 Ga0114129_10014438 Ga0114129_100144389 169
170 3300009147 Ga0114129_10217522 Ga0114129_102175222 169
171 3300009148 Ga0105243_10215350 Ga0105243_102153502 169
172 3300009174 Ga0105241_10739139 Ga0105241_107391392 169
173 3300009553 Ga0105249_10538297 Ga0105249_105382971 169
174 3300010375 Ga0105239_10378680 Ga0105239_103786802 169
175 3300025885 Ga0207653_10105325 Ga0207653_101053251 169
176 3300025910 Ga0207684_11066571 Ga0207684_110665711 169
177 3300025918 Ga0207662_10269257 Ga0207662_102692572 169
178 3300025935 Ga0207709_11342670 Ga0207709_113426701 169
179 3300025961 Ga0207712_10321097 Ga0207712_103210971 169
180 3300026035 Ga0207703_10396324 Ga0207703_103963242 169
181 3300026095 Ga0207676_10180457 Ga0207676_101804572 169
182 3300026116 Ga0207674_10612287 Ga0207674_106122871 169
183 3300026118 Ga0207675_100166117 Ga0207675_1001661173 169
184 3300028380 Ga0268265_10337828 Ga0268265_103378281 169
185 3300031852 Ga0307410_11255798 Ga0307410_112557981 169
186 3300032002 Ga0307416_100582051 Ga0307416_1005820512 169
187 3300032126 Ga0307415_100359030 Ga0307415_1003590302 169
188 3300032126 Ga0307415_100603430 Ga0307415_1006034302 169
189 3300035088 Ga0373940_0170075 Ga0373940_0170075_168_677 169
190 3300042876 Ga0451577_0062957 Ga0451577_0062957_410_922 169
191 3300044712 Ga0453684_0003986 Ga0453684_0003986_19571_20083 169
192 3300044712 Ga0453684_1668653 Ga0453684_1668653_48_557 169
193 3300045051 Ga0451576_0698120 Ga0451576_0698120_16_525 169
194 3300049577 Ga0501041_0076537 Ga0501041_0076537_607_1116 169
195 3300049588 Ga0501072_0259005 Ga0501072_0259005_278_787 169
196 3300049591 Ga0501075_1096113 Ga0501075_1096113_27_536 169
197 3300049592 Ga0501076_0140087 Ga0501076_0140087_1420_1941 169
198 3300049592 Ga0501076_0508243 Ga0501076_0508243_135_644 169
199 3300049742 Ga0501080_1250565 Ga0501080_1250565_33_542 169
200 3300049743 Ga0501081_0667314 Ga0501081_0667314_135_644 169
201 3300050507 nmdc:mga05p37_1028279_c1 nmdc:mga05p37_1028279_c1_213_722 169
202 3300050507 nmdc:mga05p37_177098_c1 nmdc:mga05p37_177098_c1_866_1375 169
203 3300050507 nmdc:mga05p37_247266_c1 nmdc:mga05p37_247266_c1_1462_1971 169
204 3300050508 nmdc:mga09592_133576_c1 nmdc:mga09592_133576_c1_1537_2046 169
205 3300050512 nmdc:mga0n895_1085739_c1 nmdc:mga0n895_1085739_c1_38_547 169
206 3300050512 nmdc:mga0n895_450627_c1 nmdc:mga0n895_450627_c1_480_989 169
207 3300050515 nmdc:mga0a205_200639_c1 nmdc:mga0a205_200639_c1_77_586 169
208 3300054114 Ga0501084_0089046 Ga0501084_0089046_1039_1548 169
209 3300054114 Ga0501084_0988903 Ga0501084_0988903_74_583 169
210 3300060353 Ga0501082_0502075 Ga0501082_0502075_51_560 169
211 3300060353 Ga0501082_0634352 Ga0501082_0634352_63_572 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

87

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vkf-assembly1.cif.gz_A cchfv gp38 (ibar10200) 0.5779 57 87
8oh4-assembly1.cif.gz_I subtomogram averaging structure of cofilactin filament inside microtubule lumen of drosophila s2 cell protrusion. 0.5271 53 122
4z3t-assembly1.cif.gz_A meningococcal factor h binding protein mutant l130r/g133d 0.5215 19 90
3en2-assembly1.cif.gz_A-2 three-dimensional structure of the protein prib from ralstonia solanacearum at the resolution 2.3a. northeast structural genomics consortium target rsr213c. 0.499 23 86
4z3t-assembly2.cif.gz_B meningococcal factor h binding protein mutant l130r/g133d 0.4986 19 90
ID Description Score Start End Superfamily
af_Q4DDJ2_1_218_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6518 49 95 3.40.50.720
af_O53973_67_188_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5425 42 90 3.10.450.50
4z3tB01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.4986 19 90 2.60.40.1980
af_O16774_234_302_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.4893 32 87 3.30.70.100
af_P9WM01_47_220_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.4771 40 93 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A523U631-F1-model_v4 DUF177 domain-containing protein 0.9334 3 91
AF-A0A523BVV4-F1-model_v4 DUF177 domain-containing protein 0.8884 4 155
AF-A0A2M8CPR8-F1-model_v4 DUF177 domain-containing protein 0.8797 1 158
AF-A0A3N5UEI2-F1-model_v4 DUF177 domain-containing protein 0.873 1 116
AF-A0A3D1ZEF9-F1-model_v4 DUF177 domain-containing protein 0.8713 10 90

Feature Viewer

pLDDT pTM Quality
84.38 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map