F321857

General Info

Members Datasets Scaffolds Average Seq Length
211 138 422 276

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0715219|Ga0436362_0715219_659_1612
Length 311
Sequence MGREHGHYLWGKRADATIARARRTLTRMVSLDLAVNAVVAGLLLGGFYAAVTVGVTISFGMLDIVNIAHPAFIMLGSFVAYIVNSNFGIDPILIGVVIAPVFFLVGMAVYQIYYYAFERRGEESIQGLAFFFGLLFVGEVGLILVFGVDYRFVEAPYIGPSLHLGFVDLPLRMLIPFLVSLLMLAVLQVFLGAILAVSQDRLALQLMAADPSRVKRIAFGISIATASVAGALLIIIQPVEPSIGRDYIGRIFAICVLGGMTSFPGMLAGAVLIGGVESITATFYGPSRAPAVAFGFLLLTLAVRPAGILGR

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 6.16
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0715219 3300039453 Unclassified 1739
2 JGI24739J22299_10008489 3300001989 Bacteria 3835
3 JGI24742J22300_10000563 3300002244 Bacteria 5578
4 JGI25153J46596_10028855 3300003215 Bacteria 1916
5 Ga0065707_10218120 3300005295 Bacteria 1236
6 Ga0070658_10111986 3300005327 Bacteria 2262
7 Ga0070671_100163441 3300005355 Bacteria 1882
8 Ga0070714_100212079 3300005435 Bacteria 1775
9 Ga0070713_100573943 3300005436 Bacteria 1070
10 Ga0070710_10013388 3300005437 Bacteria 4107
11 Ga0070711_100138035 3300005439 Bacteria 1824
12 Ga0070711_100140469 3300005439 Bacteria 1810
13 Ga0070711_100367755 3300005439 Unclassified 1160
14 Ga0070681_10002673 3300005458 Bacteria 16371
15 Ga0070681_10069944 3300005458 Bacteria 3475
16 Ga0070681_10121529 3300005458 Bacteria 2546
17 Ga0070681_10546581 3300005458 Bacteria 1072
18 Ga0070706_100208207 3300005467 Bacteria 1826
19 Ga0070707_100006734 3300005468 Bacteria 10649
20 Ga0070707_100148660 3300005468 Bacteria 2281
21 Ga0070698_100076387 3300005471 Bacteria 3352
22 Ga0070699_100320619 3300005518 Bacteria 1393
23 Ga0070679_100037432 3300005530 Bacteria 4820
24 Ga0070679_100076934 3300005530 Bacteria 3325
25 Ga0070679_100195893 3300005530 Bacteria 1988
26 Ga0070679_100199803 3300005530 Bacteria 1966
27 Ga0070684_100369713 3300005535 Bacteria 1320
28 Ga0070697_100027435 3300005536 Bacteria 4555
29 Ga0068853_100178135 3300005539 Bacteria 1927
30 Ga0068857_100281469 3300005577 Bacteria 1530
31 Ga0068856_100122564 3300005614 Bacteria 2602
32 Ga0068864_100081156 3300005618 Bacteria 2843
33 Ga0068864_100314982 3300005618 Bacteria 1468
34 Ga0068862_100160135 3300005844 Bacteria 2009
35 Ga0081538_10063605 3300005981 Bacteria 2093
36 Ga0081540_1005337 3300005983 Bacteria 9617
37 Ga0081540_1026514 3300005983 Bacteria 3306
38 Ga0070717_10008105 3300006028 Bacteria 7837
39 Ga0070715_10144851 3300006163 Bacteria 1158
40 Ga0070716_100025563 3300006173 Bacteria 3152
41 Ga0070716_100222877 3300006173 Bacteria 1268
42 Ga0070712_100016688 3300006175 Bacteria 4746
43 Ga0070712_100270988 3300006175 Bacteria 1364
44 Ga0075366_10073342 3300006195 Bacteria 2040
45 Ga0075428_100104881 3300006844 Bacteria 3083
46 Ga0075430_100061840 3300006846 Bacteria 3146
47 Ga0075431_100080419 3300006847 Bacteria 3365
48 Ga0075433_10042761 3300006852 Bacteria 3932
49 Ga0075434_100004132 3300006871 Bacteria 13019
50 Ga0075429_100064372 3300006880 Bacteria 3194
51 Ga0075435_100016181 3300007076 Bacteria 5620
52 Ga0075435_100052020 3300007076 Bacteria 3300
53 Ga0075435_100260110 3300007076 Bacteria 1478
54 Ga0099794_10062046 3300007265 Bacteria 1817
55 Ga0105240_10030893 3300009093 Bacteria 6958
56 Ga0111539_10064013 3300009094 Bacteria 4351
57 Ga0111539_10747070 3300009094 Bacteria 1139
58 Ga0114129_10024655 3300009147 Bacteria 8525
59 Ga0114129_10031938 3300009147 Bacteria 7445
60 Ga0105248_10217635 3300009177 Bacteria 2151
61 Ga0105248_10524589 3300009177 Bacteria 1336
62 Ga0105238_10014485 3300009551 Bacteria 7973
63 Ga0099796_10057022 3300010159 Bacteria 1373
64 Ga0157370_10012658 3300013104 Bacteria 8737
65 Ga0157370_10087182 3300013104 Bacteria 2932
66 Ga0157369_10031126 3300013105 Bacteria 5879
67 Ga0163163_10058477 3300014325 Bacteria 3812
68 Ga0163163_10360563 3300014325 Bacteria 1510
69 Ga0182008_10097944 3300014497 Bacteria 1448
70 Ga0157376_10470945 3300014969 Bacteria 1229
71 Ga0213876_10163400 3300021384 Bacteria 1185
72 Ga0213875_10000120 3300021388 Bacteria 88115
73 Ga0213875_10001349 3300021388 Bacteria 16169
74 Ga0213875_10061027 3300021388 Bacteria 1763
75 Ga0213875_10077692 3300021388 Bacteria 1549
76 Ga0209758_1000244 3300025297 Bacteria 112497
77 Ga0207692_10010923 3300025898 Bacteria 3843
78 Ga0207699_10065169 3300025906 Bacteria 2207
79 Ga0207699_10232389 3300025906 Bacteria 1263
80 Ga0207654_10221545 3300025911 Bacteria 1255
81 Ga0207707_10010790 3300025912 Bacteria 7939
82 Ga0207707_10161660 3300025912 Bacteria 1958
83 Ga0207707_10240902 3300025912 Bacteria 1572
84 Ga0207695_10397638 3300025913 Bacteria 1262
85 Ga0207695_10411263 3300025913 Bacteria 1237
86 Ga0207693_10026858 3300025915 Bacteria 4554
87 Ga0207693_10211703 3300025915 Bacteria 1523
88 Ga0207663_10156685 3300025916 Bacteria 1603
89 Ga0207660_10032358 3300025917 Bacteria 3610
90 Ga0207652_10009135 3300025921 Bacteria 7980
91 Ga0207652_10163068 3300025921 Bacteria 1998
92 Ga0207652_10245018 3300025921 Bacteria 1616
93 Ga0207646_10053369 3300025922 Bacteria 3616
94 Ga0207700_10135328 3300025928 Bacteria 2018
95 Ga0207700_10205681 3300025928 Bacteria 1661
96 Ga0207700_10232874 3300025928 Bacteria 1567
97 Ga0207664_10193262 3300025929 Bacteria 1753
98 Ga0207664_10318031 3300025929 Unclassified 1373
99 Ga0207644_10033807 3300025931 Bacteria 3576
100 Ga0207690_10102235 3300025932 Bacteria 2049
101 Ga0207661_10282397 3300025944 Bacteria 1484
102 Ga0207639_10137038 3300026041 Bacteria 2034
103 Ga0207639_10644539 3300026041 Bacteria 980
104 Ga0207702_10090616 3300026078 Bacteria 2676
105 Ga0207702_10488423 3300026078 Bacteria 1199
106 Ga0207676_10129415 3300026095 Bacteria 2144
107 Ga0207676_10573549 3300026095 Bacteria 1081
108 Ga0207428_10120616 3300027907 Bacteria 2011
109 Ga0268265_10068395 3300028380 Bacteria 2754
110 Ga0265338_10251680 3300028800 Bacteria 1303
111 Ga0307411_10199008 3300032005 Bacteria 1537
112 Ga0373941_0028156 3300035115 Unclassified 1647
113 Ga0373953_0023157 3300035117 Bacteria 2349
114 Ga0373957_0009585 3300035120 Bacteria 3173
115 Ga0373943_0027197 3300035170 Bacteria 2686
116 Ga0373943_0150063 3300035170 Bacteria 1262
117 Ga0373955_0214878 3300035172 Bacteria 1147
118 Ga0373935_0015103 3300035692 Bacteria 4663
119 Ga0373935_0077853 3300035692 Bacteria 2150
120 Ga0373935_0096171 3300035692 Bacteria 1946
121 Ga0373927_0069984 3300035695 Bacteria 2271
122 Ga0373933_0037891 3300035724 Bacteria 2831
123 Ga0373933_0150144 3300035724 Bacteria 1475
124 Ga0373947_0109441 3300035725 Bacteria 1744
125 Ga0373937_0006097 3300036401 Bacteria 10381
126 Ga0373937_0006931 3300036401 Bacteria 9784
127 Ga0373937_0051815 3300036401 Bacteria 3762
128 Ga0373937_0068994 3300036401 Bacteria 3259
129 Ga0373937_0088611 3300036401 Bacteria 2865
130 Ga0373937_0152260 3300036401 Bacteria 2167
131 Ga0373937_0483097 3300036401 Bacteria 1177
132 Ga0373925_0115480 3300037068 Bacteria 2078
133 Ga0373925_0226318 3300037068 Bacteria 1494
134 Ga0436364_0168578 3300037853 Bacteria 2189
135 Ga0436364_0369195 3300037853 Bacteria 68092
136 Ga0436364_0485256 3300037853 Bacteria 44626
137 Ga0436364_0529511 3300037853 Bacteria 1961
138 Ga0436364_0561519 3300037853 Bacteria 2543
139 Ga0436364_0625040 3300037853 Bacteria 2536
140 Ga0436364_1002376 3300037853 Bacteria 9450
141 Ga0436364_1284638 3300037853 Bacteria 5477
142 Ga0436364_1376011 3300037853 Bacteria 1307
143 Ga0436365_0485943 3300039437 Unclassified 2280
144 Ga0436365_1135733 3300039437 Bacteria 6400
145 Ga0436360_0607665 3300039438 Bacteria 1459
146 Ga0436360_1025755 3300039438 Bacteria 1595
147 Ga0436360_1030496 3300039438 Bacteria 925
148 Ga0436361_0399086 3300039447 Bacteria 1534
149 Ga0436363_0781996 3300039450 Unclassified 1316
150 Ga0436362_0574590 3300039453 Bacteria 3695
151 Ga0436362_1024144 3300039453 Bacteria 1778
152 Ga0495603_0147048 3300046455 Bacteria 1370
153 Ga0495590_0062897 3300046457 Bacteria 1299
154 Ga0495582_0070154 3300046473 Bacteria 1938
155 Ga0495662_0029961 3300046476 Bacteria 2627
156 Ga0495618_0079332 3300046514 Bacteria 2094
157 Ga0495618_0172991 3300046514 Bacteria 1374
158 Ga0495666_0180540 3300046526 Unclassified 975
159 Ga0495665_0064399 3300046531 Bacteria 1935
160 Ga0495640_0033312 3300046533 Bacteria 3661
161 Ga0495634_0031530 3300046642 Bacteria 3650
162 Ga0495635_0082700 3300046663 Bacteria 2197
163 Ga0495647_0012928 3300046681 Bacteria 2882
164 Ga0495674_0017125 3300047319 Bacteria 6750
165 Ga0495680_0066143 3300047322 Bacteria 2767
166 Ga0496100_0066955 3300048903 Bacteria 2384
167 Ga0496101_0147702 3300048904 Bacteria 1796
168 Ga0496104_0007059 3300048907 Bacteria 9907
169 Ga0496105_0000424 3300048908 Bacteria 27799
170 Ga0496108_0002701 3300048911 Bacteria 14201
171 Ga0496109_0001304 3300048912 Bacteria 20607
172 Ga0496110_0000973 3300048913 Bacteria 20082
173 Ga0496110_0194105 3300048913 Bacteria 1844
174 Ga0496111_0000315 3300048914 Bacteria 23917
175 Ga0496111_0085525 3300048914 Bacteria 2306
176 Ga0496112_0066973 3300048915 Bacteria 3543
177 Ga0496113_0000218 3300048916 Bacteria 26800
178 Ga0496114_0109031 3300048917 Bacteria 2371
179 Ga0501033_0044266 3300049570 Bacteria 3314
180 Ga0501038_0068222 3300049574 Bacteria 3023
181 Ga0501038_0242679 3300049574 Bacteria 1430
182 Ga0501042_0156884 3300049578 Bacteria 1642
183 Ga0501043_0044211 3300049579 Bacteria 3502
184 Ga0501047_0012917 3300049581 Bacteria 7911
185 Ga0501047_0015696 3300049581 Bacteria 7216
186 Ga0501069_0028017 3300049585 Bacteria 3088
187 Ga0501070_0000946 3300049586 Bacteria 26204
188 Ga0501070_0030502 3300049586 Bacteria 4518
189 Ga0501072_0213299 3300049588 Bacteria 1539
190 Ga0501076_0372589 3300049592 Bacteria 1173
191 Ga0501080_0078947 3300049742 Bacteria 3060
192 Ga0501080_0412530 3300049742 Bacteria 1214
193 Ga0501044_0485025 3300049823 Bacteria 1139
194 nmdc:mga0k408_51103_c1 3300050493 Bacteria 2394
195 nmdc:mga06z11_61524_c1 3300050494 Bacteria 1958
196 nmdc:mga05p37_12850_c1 3300050507 Bacteria 10013
197 nmdc:mga05p37_22956_c1 3300050507 Bacteria 7567
198 nmdc:mga06r32_146688_c1 3300050510 Bacteria 2337
199 nmdc:mga06r32_288408_c1 3300050510 Bacteria 1628
200 nmdc:mga08y16_138426_c1 3300050511 Bacteria 2531
201 nmdc:mga0n895_7213_c1 3300050512 Bacteria 9518
202 nmdc:mga0rr50_11160_c1 3300050513 Bacteria 5733
203 nmdc:mga0rr50_122993_c1 3300050513 Bacteria 2068
204 Ga0495601_0001053 3300053077 Bacteria 15108
205 Ga0495601_0016376 3300053077 Bacteria 4492
206 Ga0495601_0019615 3300053077 Bacteria 4125
207 Ga0495595_0085397 3300053084 Bacteria 1509
208 Ga0495619_0001866 3300053085 Bacteria 14035
209 Ga0495619_0145634 3300053085 Bacteria 1633
210 Ga0500568_0085535 3300053139 Bacteria 1194
211 Ga0500552_001435 3300053733 Bacteria 2278
212 Ga0436362_0715219
213 JGI24739J22299_10008489
214 JGI24742J22300_10000563
215 JGI25153J46596_10028855
216 Ga0065707_10218120
217 Ga0070658_10111986
218 Ga0070671_100163441
219 Ga0070714_100212079
220 Ga0070713_100573943
221 Ga0070710_10013388
222 Ga0070711_100138035
223 Ga0070711_100140469
224 Ga0070711_100367755
225 Ga0070681_10002673
226 Ga0070681_10069944
227 Ga0070681_10121529
228 Ga0070681_10546581
229 Ga0070706_100208207
230 Ga0070707_100006734
231 Ga0070707_100148660
232 Ga0070698_100076387
233 Ga0070699_100320619
234 Ga0070679_100037432
235 Ga0070679_100076934
236 Ga0070679_100195893
237 Ga0070679_100199803
238 Ga0070684_100369713
239 Ga0070697_100027435
240 Ga0068853_100178135
241 Ga0068857_100281469
242 Ga0068856_100122564
243 Ga0068864_100081156
244 Ga0068864_100314982
245 Ga0068862_100160135
246 Ga0081538_10063605
247 Ga0081540_1005337
248 Ga0081540_1026514
249 Ga0070717_10008105
250 Ga0070715_10144851
251 Ga0070716_100025563
252 Ga0070716_100222877
253 Ga0070712_100016688
254 Ga0070712_100270988
255 Ga0075366_10073342
256 Ga0075428_100104881
257 Ga0075430_100061840
258 Ga0075431_100080419
259 Ga0075433_10042761
260 Ga0075434_100004132
261 Ga0075429_100064372
262 Ga0075435_100016181
263 Ga0075435_100052020
264 Ga0075435_100260110
265 Ga0099794_10062046
266 Ga0105240_10030893
267 Ga0111539_10064013
268 Ga0111539_10747070
269 Ga0114129_10024655
270 Ga0114129_10031938
271 Ga0105248_10217635
272 Ga0105248_10524589
273 Ga0105238_10014485
274 Ga0099796_10057022
275 Ga0157370_10012658
276 Ga0157370_10087182
277 Ga0157369_10031126
278 Ga0163163_10058477
279 Ga0163163_10360563
280 Ga0182008_10097944
281 Ga0157376_10470945
282 Ga0213876_10163400
283 Ga0213875_10000120
284 Ga0213875_10001349
285 Ga0213875_10061027
286 Ga0213875_10077692
287 Ga0209758_1000244
288 Ga0207692_10010923
289 Ga0207699_10065169
290 Ga0207699_10232389
291 Ga0207654_10221545
292 Ga0207707_10010790
293 Ga0207707_10161660
294 Ga0207707_10240902
295 Ga0207695_10397638
296 Ga0207695_10411263
297 Ga0207693_10026858
298 Ga0207693_10211703
299 Ga0207663_10156685
300 Ga0207660_10032358
301 Ga0207652_10009135
302 Ga0207652_10163068
303 Ga0207652_10245018
304 Ga0207646_10053369
305 Ga0207700_10135328
306 Ga0207700_10205681
307 Ga0207700_10232874
308 Ga0207664_10193262
309 Ga0207664_10318031
310 Ga0207644_10033807
311 Ga0207690_10102235
312 Ga0207661_10282397
313 Ga0207639_10137038
314 Ga0207639_10644539
315 Ga0207702_10090616
316 Ga0207702_10488423
317 Ga0207676_10129415
318 Ga0207676_10573549
319 Ga0207428_10120616
320 Ga0268265_10068395
321 Ga0265338_10251680
322 Ga0307411_10199008
323 Ga0373941_0028156
324 Ga0373953_0023157
325 Ga0373957_0009585
326 Ga0373943_0027197
327 Ga0373943_0150063
328 Ga0373955_0214878
329 Ga0373935_0015103
330 Ga0373935_0077853
331 Ga0373935_0096171
332 Ga0373927_0069984
333 Ga0373933_0037891
334 Ga0373933_0150144
335 Ga0373947_0109441
336 Ga0373937_0006097
337 Ga0373937_0006931
338 Ga0373937_0051815
339 Ga0373937_0068994
340 Ga0373937_0088611
341 Ga0373937_0152260
342 Ga0373937_0483097
343 Ga0373925_0115480
344 Ga0373925_0226318
345 Ga0436364_0168578
346 Ga0436364_0369195
347 Ga0436364_0485256
348 Ga0436364_0529511
349 Ga0436364_0561519
350 Ga0436364_0625040
351 Ga0436364_1002376
352 Ga0436364_1284638
353 Ga0436364_1376011
354 Ga0436365_0485943
355 Ga0436365_1135733
356 Ga0436360_0607665
357 Ga0436360_1025755
358 Ga0436360_1030496
359 Ga0436361_0399086
360 Ga0436363_0781996
361 Ga0436362_0574590
362 Ga0436362_1024144
363 Ga0495603_0147048
364 Ga0495590_0062897
365 Ga0495582_0070154
366 Ga0495662_0029961
367 Ga0495618_0079332
368 Ga0495618_0172991
369 Ga0495666_0180540
370 Ga0495665_0064399
371 Ga0495640_0033312
372 Ga0495634_0031530
373 Ga0495635_0082700
374 Ga0495647_0012928
375 Ga0495674_0017125
376 Ga0495680_0066143
377 Ga0496100_0066955
378 Ga0496101_0147702
379 Ga0496104_0007059
380 Ga0496105_0000424
381 Ga0496108_0002701
382 Ga0496109_0001304
383 Ga0496110_0000973
384 Ga0496110_0194105
385 Ga0496111_0000315
386 Ga0496111_0085525
387 Ga0496112_0066973
388 Ga0496113_0000218
389 Ga0496114_0109031
390 Ga0501033_0044266
391 Ga0501038_0068222
392 Ga0501038_0242679
393 Ga0501042_0156884
394 Ga0501043_0044211
395 Ga0501047_0012917
396 Ga0501047_0015696
397 Ga0501069_0028017
398 Ga0501070_0000946
399 Ga0501070_0030502
400 Ga0501072_0213299
401 Ga0501076_0372589
402 Ga0501080_0078947
403 Ga0501080_0412530
404 Ga0501044_0485025
405 nmdc:mga0k408_51103_c1
406 nmdc:mga06z11_61524_c1
407 nmdc:mga05p37_12850_c1
408 nmdc:mga05p37_22956_c1
409 nmdc:mga06r32_146688_c1
410 nmdc:mga06r32_288408_c1
411 nmdc:mga08y16_138426_c1
412 nmdc:mga0n895_7213_c1
413 nmdc:mga0rr50_11160_c1
414 nmdc:mga0rr50_122993_c1
415 Ga0495601_0001053
416 Ga0495601_0016376
417 Ga0495601_0019615
418 Ga0495595_0085397
419 Ga0495619_0001866
420 Ga0495619_0145634
421 Ga0500568_0085535
422 Ga0500552_001435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

37

303

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.3903 6 242
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3801 6 237
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.3763 6 242
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3639 6 237
6wbv-assembly1.cif.gz_A structure of human ferroportin bound to hepcidin and cobalt in lipid nanodisc 0.3562 14 239
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6766 12 237 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6232 12 237 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.621 6 238 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5892 6 238 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5363 6 236 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A497MUK1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8772 83 247 GO:0005886
GO:0006865
GO:0022857
AF-A0A497MUK1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8628 83 247 GO:0005886
GO:0006865
GO:0022857
AF-A0A537AYD4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8485 1 247 GO:0005886
GO:0006865
GO:0022857
AF-A0A537AYD4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8452 1 247 GO:0005886
GO:0006865
GO:0022857
AF-Q1M9I1-F1-model_v4 Branched-chain amino acid ABC transporter permease component 0.8405 3 247 GO:0005886
GO:0006865
GO:0022857

Map