F321726

General Info

Members Datasets Scaffolds Average Seq Length
211 119 422 161

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1000156|Ga0265319_100015621
Length 182
Sequence MPDEPDPAASDDGAARVEPAPPLPLDTLLDRWEAAWSGRDAAAFAPLCDPAVQYEDPLTPAPLIGADELAAHAERLWQGFPDVRVERAGERLADPAGRFAAAPCKLAGTHRGTLEGLPPTRRFVVVHGVVYAELRAGRLLRVRTFFDRYEAAVQLGVLPAAGTLGERALLMLRGFGLRSRGA

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 3.32
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1000156 3300028563 Bacteria 51344
2 Ga0070676_10515549 3300005328 Unclassified 851
3 Ga0070683_100092591 3300005329 Bacteria 2839
4 Ga0070682_100223820 3300005337 Bacteria 1341
5 Ga0070687_100032475 3300005343 Bacteria 2569
6 Ga0070692_10080011 3300005345 Bacteria 1758
7 Ga0070669_100062324 3300005353 Bacteria 2742
8 Ga0070714_100061827 3300005435 Bacteria 3217
9 Ga0070714_100760564 3300005435 Bacteria 937
10 Ga0070713_100709682 3300005436 Unclassified 960
11 Ga0070710_10212950 3300005437 Bacteria 1226
12 Ga0070701_10076277 3300005438 Bacteria 1804
13 Ga0070701_10218850 3300005438 Bacteria 1134
14 Ga0070711_100008732 3300005439 Bacteria 6218
15 Ga0070711_100094159 3300005439 Bacteria 2165
16 Ga0070663_100091036 3300005455 Bacteria 2260
17 Ga0070681_10501520 3300005458 Bacteria 1127
18 Ga0070684_100040837 3300005535 Bacteria 3996
19 Ga0070665_100041878 3300005548 Bacteria 4604
20 Ga0070664_100201170 3300005564 Bacteria 1778
21 Ga0068854_100572896 3300005578 Bacteria 960
22 Ga0068864_100242899 3300005618 Bacteria 1669
23 Ga0070717_10032211 3300006028 Bacteria 4223
24 Ga0070717_10044812 3300006028 Bacteria 3614
25 Ga0070717_10045929 3300006028 Bacteria 3572
26 Ga0070717_10164590 3300006028 Bacteria 1926
27 Ga0070712_100004948 3300006175 Bacteria 8238
28 Ga0070712_100179760 3300006175 Bacteria 1647
29 Ga0075428_100797329 3300006844 Bacteria 1004
30 Ga0075436_100467307 3300006914 Unclassified 920
31 Ga0111539_11257845 3300009094 Bacteria 859
32 Ga0105241_11267215 3300009174 Unclassified 701
33 Ga0105249_10412596 3300009553 Bacteria 1383
34 Ga0105246_10216909 3300011119 Bacteria 1497
35 Ga0157372_10944969 3300013307 Unclassified 999
36 Ga0163163_10241368 3300014325 Bacteria 1856
37 Ga0157377_10066068 3300014745 Bacteria 2079
38 Ga0157379_10002657 3300014968 Bacteria 15053
39 Ga0157379_11285743 3300014968 Bacteria 706
40 Ga0213874_10000101 3300021377 Bacteria 13780
41 Ga0213874_10012765 3300021377 Bacteria 2162
42 Ga0213876_10053618 3300021384 Bacteria 2129
43 Ga0213876_10067888 3300021384 Bacteria 1883
44 Ga0213875_10000219 3300021388 Bacteria 58104
45 Ga0213875_10007202 3300021388 Bacteria 5772
46 Ga0213875_10011972 3300021388 Bacteria 4298
47 Ga0207692_10437049 3300025898 Unclassified 822
48 Ga0207707_10170307 3300025912 Bacteria 1903
49 Ga0207695_10204634 3300025913 Bacteria 1887
50 Ga0207693_10001995 3300025915 Bacteria 17910
51 Ga0207693_10103801 3300025915 Bacteria 2229
52 Ga0207693_10281305 3300025915 Bacteria 1304
53 Ga0207663_10010520 3300025916 Bacteria 4929
54 Ga0207662_10034648 3300025918 Bacteria 2946
55 Ga0207649_10217125 3300025920 Bacteria 1360
56 Ga0207649_10281900 3300025920 Bacteria 1208
57 Ga0207681_10068726 3300025923 Bacteria 2462
58 Ga0207700_10072128 3300025928 Bacteria 2662
59 Ga0207700_10254291 3300025928 Bacteria 1502
60 Ga0207664_10023903 3300025929 Bacteria 4586
61 Ga0207664_10853912 3300025929 Bacteria 818
62 Ga0207665_10324171 3300025939 Bacteria 1157
63 Ga0207665_11330130 3300025939 Bacteria 573
64 Ga0207661_10079595 3300025944 Bacteria 2701
65 Ga0207679_10084751 3300025945 Bacteria 2433
66 Ga0207679_10147618 3300025945 Bacteria 1909
67 Ga0207651_10196537 3300025960 Bacteria 1613
68 Ga0207674_10038575 3300026116 Bacteria 4955
69 Ga0268266_10073216 3300028379 Bacteria 2973
70 Ga0265327_10162856 3300031251 Bacteria 1029
71 Ga0373954_0578558 3300035118 Bacteria 557
72 Ga0373956_0419492 3300035119 Unclassified 639
73 Ga0373955_0081249 3300035172 Bacteria 1832
74 Ga0373937_0037216 3300036401 Bacteria 4434
75 Ga0395899_0448441 3300037312 Bacteria 845
76 Ga0395900_0487639 3300037418 Bacteria 1184
77 Ga0395898_0467009 3300037466 Bacteria 1201
78 Ga0395905_1550484 3300037471 Bacteria 567
79 Ga0436364_0263750 3300037853 Bacteria 6057
80 Ga0436364_0293323 3300037853 Bacteria 887
81 Ga0436364_0480777 3300037853 Bacteria 914
82 Ga0436364_0631908 3300037853 Bacteria 2620
83 Ga0436364_1156440 3300037853 Bacteria 43375
84 Ga0436364_1384806 3300037853 Bacteria 13561
85 Ga0395901_0619544 3300038443 Bacteria 1089
86 Ga0395901_0903692 3300038443 Bacteria 865
87 Ga0395901_1094697 3300038443 Bacteria 768
88 Ga0395901_1710534 3300038443 Bacteria 580
89 Ga0436365_0053870 3300039437 Bacteria 1284
90 Ga0436365_0402777 3300039437 Bacteria 3202
91 Ga0436365_0501540 3300039437 Bacteria 8206
92 Ga0436365_0645521 3300039437 Bacteria 30415
93 Ga0436365_0802469 3300039437 Bacteria 2211
94 Ga0436365_0827182 3300039437 Bacteria 1518
95 Ga0436365_1660868 3300039437 Bacteria 763
96 Ga0436365_1694406 3300039437 Bacteria 2127
97 Ga0436363_0656840 3300039450 Bacteria 8257
98 Ga0436363_0844230 3300039450 Bacteria 1053
99 Ga0436363_1045753 3300039450 Bacteria 64108
100 Ga0436363_1147946 3300039450 Bacteria 1739
101 Ga0436363_1192555 3300039450 Bacteria 9269
102 Ga0436363_1304399 3300039450 Bacteria 1042
103 Ga0436362_0148479 3300039453 Bacteria 625
104 Ga0436362_0195023 3300039453 Bacteria 1393
105 Ga0436362_0683633 3300039453 Bacteria 2463
106 Ga0436362_1096713 3300039453 Unclassified 887
107 Ga0466972_0131836 3300044658 Bacteria 1177
108 Ga0466972_0220064 3300044658 Bacteria 888
109 Ga0466965_0020195 3300044683 Bacteria 3201
110 Ga0466966_0031975 3300044684 Bacteria 3413
111 Ga0466966_0042905 3300044684 Bacteria 2901
112 Ga0466966_0080605 3300044684 Bacteria 2027
113 Ga0466966_0120446 3300044684 Bacteria 1612
114 Ga0466966_0388363 3300044684 Bacteria 839
115 Ga0466966_0771859 3300044684 Unclassified 579
116 Ga0466961_0002124 3300044693 Bacteria 12328
117 Ga0466961_0026182 3300044693 Bacteria 3751
118 Ga0466961_0193359 3300044693 Bacteria 1261
119 Ga0466961_0694132 3300044693 Bacteria 610
120 Ga0466963_0015311 3300044694 Bacteria 4745
121 Ga0466963_0035884 3300044694 Bacteria 3231
122 Ga0466963_0103272 3300044694 Bacteria 1953
123 Ga0466963_0104862 3300044694 Bacteria 1937
124 Ga0466963_0109781 3300044694 Bacteria 1893
125 Ga0466963_0290269 3300044694 Bacteria 1150
126 Ga0466963_0889958 3300044694 Bacteria 627
127 Ga0466971_0002035 3300044719 Bacteria 8563
128 Ga0466971_0015590 3300044719 Bacteria 3348
129 Ga0466971_0204882 3300044719 Bacteria 932
130 Ga0466971_0271863 3300044719 Unclassified 810
131 Ga0466968_0013866 3300044735 Bacteria 3175
132 Ga0466968_0130009 3300044735 Unclassified 1145
133 Ga0466968_0350258 3300044735 Bacteria 717
134 Ga0466970_0061187 3300044765 Bacteria 2017
135 Ga0466970_0123396 3300044765 Bacteria 1420
136 Ga0466970_0257851 3300044765 Bacteria 978
137 Ga0466970_0394786 3300044765 Bacteria 789
138 Ga0466970_0448916 3300044765 Bacteria 739
139 Ga0466970_0802380 3300044765 Bacteria 551
140 Ga0466957_0009044 3300044842 Bacteria 5678
141 Ga0466957_0308918 3300044842 Bacteria 1064
142 Ga0466960_0000471 3300044901 Bacteria 13779
143 Ga0466960_0030388 3300044901 Bacteria 2486
144 Ga0466960_0150529 3300044901 Bacteria 1243
145 Ga0466960_0361434 3300044901 Bacteria 830
146 Ga0466959_0013854 3300045049 Bacteria 5855
147 Ga0466959_0063075 3300045049 Bacteria 2692
148 Ga0466959_0078856 3300045049 Bacteria 2375
149 Ga0466959_0127944 3300045049 Bacteria 1802
150 Ga0466959_0266523 3300045049 Unclassified 1178
151 Ga0466959_0350642 3300045049 Bacteria 1006
152 Ga0466959_0560155 3300045049 Unclassified 770
153 Ga0466958_0022108 3300045836 Bacteria 3722
154 Ga0466958_0027924 3300045836 Bacteria 3342
155 Ga0466958_0035963 3300045836 Bacteria 2961
156 Ga0466958_0102508 3300045836 Bacteria 1781
157 Ga0466958_0109766 3300045836 Bacteria 1722
158 Ga0466958_0263696 3300045836 Bacteria 1103
159 Ga0466958_0643820 3300045836 Unclassified 690
160 Ga0466967_0024084 3300045976 Bacteria 4999
161 Ga0466967_0041140 3300045976 Bacteria 3982
162 Ga0466967_0184207 3300045976 Bacteria 1971
163 Ga0466967_0857551 3300045976 Bacteria 903
164 Ga0466967_1429360 3300045976 Bacteria 689
165 Ga0466967_2295838 3300045976 Bacteria 535
166 Ga0495592_0235311 3300046454 Bacteria 1218
167 Ga0495629_0271865 3300046459 Bacteria 1164
168 Ga0495629_1049931 3300046459 Bacteria 528
169 Ga0495641_0227630 3300046461 Bacteria 837
170 Ga0495651_0018837 3300046462 Bacteria 5346
171 Ga0495653_0511539 3300046463 Bacteria 747
172 Ga0495650_0000070 3300046471 Bacteria 258497
173 Ga0495639_0235116 3300046475 Bacteria 903
174 Ga0495596_0158309 3300046500 Bacteria 880
175 Ga0495608_0009506 3300046511 Bacteria 6792
176 Ga0495618_0116211 3300046514 Bacteria 1713
177 Ga0495628_0187779 3300046516 Bacteria 1561
178 Ga0495630_0747183 3300046517 Bacteria 748
179 Ga0495597_0259678 3300046542 Bacteria 681
180 Ga0495645_0667204 3300046543 Unclassified 634
181 Ga0495667_0045561 3300046559 Bacteria 2903
182 Ga0495634_0052045 3300046642 Bacteria 2746
183 Ga0495657_0166711 3300046675 Bacteria 1359
184 Ga0495599_0321853 3300046678 Bacteria 931
185 Ga0495623_0044738 3300046679 Bacteria 2813
186 Ga0495646_0041211 3300046680 Bacteria 2838
187 Ga0495613_0250403 3300046689 Bacteria 1236
188 Ga0495604_0092845 3300047317 Bacteria 2235
189 Ga0495604_0437008 3300047317 Bacteria 857
190 Ga0495674_0756212 3300047319 Unclassified 759
191 Ga0495676_0203669 3300047321 Bacteria 1374
192 Ga0495680_0039945 3300047322 Bacteria 3739
193 Ga0495684_0099949 3300047471 Bacteria 2193
194 Ga0495686_0532057 3300047472 Bacteria 615
195 Ga0495593_0083122 3300047673 Bacteria 1655
196 Ga0495602_0452565 3300048088 Bacteria 906
197 Ga0496100_0899138 3300048903 Unclassified 695
198 Ga0496104_0299584 3300048907 Bacteria 1520
199 Ga0496104_1603625 3300048907 Unclassified 553
200 Ga0496107_0541328 3300048910 Bacteria 863
201 Ga0496108_1343563 3300048911 Bacteria 600
202 Ga0496113_0021839 3300048916 Bacteria 4519
203 Ga0496114_1346128 3300048917 Bacteria 601
204 Ga0496119_0029465 3300048922 Bacteria 3722
205 Ga0496121_0020055 3300048924 Bacteria 6644
206 Ga0501034_0023244 3300049571 Bacteria 6316
207 Ga0501067_0347361 3300049583 Unclassified 827
208 Ga0495619_0520768 3300053085 Bacteria 817
209 Ga0500616_0021415 3300053153 Bacteria 3625
210 Ga0466962_0000849 3300061719 Bacteria 13813
211 Ga0466962_0031893 3300061719 Bacteria 2523
212 Ga0265319_1000156
213 Ga0070676_10515549
214 Ga0070683_100092591
215 Ga0070682_100223820
216 Ga0070687_100032475
217 Ga0070692_10080011
218 Ga0070669_100062324
219 Ga0070714_100061827
220 Ga0070714_100760564
221 Ga0070713_100709682
222 Ga0070710_10212950
223 Ga0070701_10076277
224 Ga0070701_10218850
225 Ga0070711_100008732
226 Ga0070711_100094159
227 Ga0070663_100091036
228 Ga0070681_10501520
229 Ga0070684_100040837
230 Ga0070665_100041878
231 Ga0070664_100201170
232 Ga0068854_100572896
233 Ga0068864_100242899
234 Ga0070717_10032211
235 Ga0070717_10044812
236 Ga0070717_10045929
237 Ga0070717_10164590
238 Ga0070712_100004948
239 Ga0070712_100179760
240 Ga0075428_100797329
241 Ga0075436_100467307
242 Ga0111539_11257845
243 Ga0105241_11267215
244 Ga0105249_10412596
245 Ga0105246_10216909
246 Ga0157372_10944969
247 Ga0163163_10241368
248 Ga0157377_10066068
249 Ga0157379_10002657
250 Ga0157379_11285743
251 Ga0213874_10000101
252 Ga0213874_10012765
253 Ga0213876_10053618
254 Ga0213876_10067888
255 Ga0213875_10000219
256 Ga0213875_10007202
257 Ga0213875_10011972
258 Ga0207692_10437049
259 Ga0207707_10170307
260 Ga0207695_10204634
261 Ga0207693_10001995
262 Ga0207693_10103801
263 Ga0207693_10281305
264 Ga0207663_10010520
265 Ga0207662_10034648
266 Ga0207649_10217125
267 Ga0207649_10281900
268 Ga0207681_10068726
269 Ga0207700_10072128
270 Ga0207700_10254291
271 Ga0207664_10023903
272 Ga0207664_10853912
273 Ga0207665_10324171
274 Ga0207665_11330130
275 Ga0207661_10079595
276 Ga0207679_10084751
277 Ga0207679_10147618
278 Ga0207651_10196537
279 Ga0207674_10038575
280 Ga0268266_10073216
281 Ga0265327_10162856
282 Ga0373954_0578558
283 Ga0373956_0419492
284 Ga0373955_0081249
285 Ga0373937_0037216
286 Ga0395899_0448441
287 Ga0395900_0487639
288 Ga0395898_0467009
289 Ga0395905_1550484
290 Ga0436364_0263750
291 Ga0436364_0293323
292 Ga0436364_0480777
293 Ga0436364_0631908
294 Ga0436364_1156440
295 Ga0436364_1384806
296 Ga0395901_0619544
297 Ga0395901_0903692
298 Ga0395901_1094697
299 Ga0395901_1710534
300 Ga0436365_0053870
301 Ga0436365_0402777
302 Ga0436365_0501540
303 Ga0436365_0645521
304 Ga0436365_0802469
305 Ga0436365_0827182
306 Ga0436365_1660868
307 Ga0436365_1694406
308 Ga0436363_0656840
309 Ga0436363_0844230
310 Ga0436363_1045753
311 Ga0436363_1147946
312 Ga0436363_1192555
313 Ga0436363_1304399
314 Ga0436362_0148479
315 Ga0436362_0195023
316 Ga0436362_0683633
317 Ga0436362_1096713
318 Ga0466972_0131836
319 Ga0466972_0220064
320 Ga0466965_0020195
321 Ga0466966_0031975
322 Ga0466966_0042905
323 Ga0466966_0080605
324 Ga0466966_0120446
325 Ga0466966_0388363
326 Ga0466966_0771859
327 Ga0466961_0002124
328 Ga0466961_0026182
329 Ga0466961_0193359
330 Ga0466961_0694132
331 Ga0466963_0015311
332 Ga0466963_0035884
333 Ga0466963_0103272
334 Ga0466963_0104862
335 Ga0466963_0109781
336 Ga0466963_0290269
337 Ga0466963_0889958
338 Ga0466971_0002035
339 Ga0466971_0015590
340 Ga0466971_0204882
341 Ga0466971_0271863
342 Ga0466968_0013866
343 Ga0466968_0130009
344 Ga0466968_0350258
345 Ga0466970_0061187
346 Ga0466970_0123396
347 Ga0466970_0257851
348 Ga0466970_0394786
349 Ga0466970_0448916
350 Ga0466970_0802380
351 Ga0466957_0009044
352 Ga0466957_0308918
353 Ga0466960_0000471
354 Ga0466960_0030388
355 Ga0466960_0150529
356 Ga0466960_0361434
357 Ga0466959_0013854
358 Ga0466959_0063075
359 Ga0466959_0078856
360 Ga0466959_0127944
361 Ga0466959_0266523
362 Ga0466959_0350642
363 Ga0466959_0560155
364 Ga0466958_0022108
365 Ga0466958_0027924
366 Ga0466958_0035963
367 Ga0466958_0102508
368 Ga0466958_0109766
369 Ga0466958_0263696
370 Ga0466958_0643820
371 Ga0466967_0024084
372 Ga0466967_0041140
373 Ga0466967_0184207
374 Ga0466967_0857551
375 Ga0466967_1429360
376 Ga0466967_2295838
377 Ga0495592_0235311
378 Ga0495629_0271865
379 Ga0495629_1049931
380 Ga0495641_0227630
381 Ga0495651_0018837
382 Ga0495653_0511539
383 Ga0495650_0000070
384 Ga0495639_0235116
385 Ga0495596_0158309
386 Ga0495608_0009506
387 Ga0495618_0116211
388 Ga0495628_0187779
389 Ga0495630_0747183
390 Ga0495597_0259678
391 Ga0495645_0667204
392 Ga0495667_0045561
393 Ga0495634_0052045
394 Ga0495657_0166711
395 Ga0495599_0321853
396 Ga0495623_0044738
397 Ga0495646_0041211
398 Ga0495613_0250403
399 Ga0495604_0092845
400 Ga0495604_0437008
401 Ga0495674_0756212
402 Ga0495676_0203669
403 Ga0495680_0039945
404 Ga0495684_0099949
405 Ga0495686_0532057
406 Ga0495593_0083122
407 Ga0495602_0452565
408 Ga0496100_0899138
409 Ga0496104_0299584
410 Ga0496104_1603625
411 Ga0496107_0541328
412 Ga0496108_1343563
413 Ga0496113_0021839
414 Ga0496114_1346128
415 Ga0496119_0029465
416 Ga0496121_0020055
417 Ga0501034_0023244
418 Ga0501067_0347361
419 Ga0495619_0520768
420 Ga0500616_0021415
421 Ga0466962_0000849
422 Ga0466962_0031893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

26

155

0.93

PF12680

SnoaL_2

SnoaL-like domain

29

142

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.9052 9 139
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8877 2 132
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8823 1 132
3ov4-assembly1.cif.gz_B crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8793 1 132
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8783 2 132
ID Description Score Start End Superfamily
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9034 9 139 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8806 4 137 3.10.450.50
3k0zB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8718 7 139 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8707 1 132 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8673 5 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7V3XF94-F1-model_v4 Nuclear transport factor 2 family protein 0.9536 4 139 GO:0030638
AF-A0A6J7DWZ2-F1-model_v4 Unannotated protein 0.9514 8 163 GO:0030638
AF-A0A6I2Y6L5-F1-model_v4 Ester cyclase 0.9511 3 163 GO:0030638
AF-A0A7K0S0K8-F1-model_v4 SnoaL-like domain-containing protein 0.947 8 163 GO:0030638
AF-A0A6J7KYJ0-F1-model_v4 Unannotated protein 0.9422 8 163

Map